Prosecution Insights
Last updated: April 19, 2026
Application No. 18/325,912

METHODS FOR TREATING MISMATCH REPAIR DEFICIENT LOCALLY ADVANCED RECTAL CANCER USING DOSTARLIMAB

Non-Final OA §102§103
Filed
May 30, 2023
Examiner
XIAO, YAN
Art Unit
1642
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Sloan-Kettering Institute For Cancer Research
OA Round
1 (Non-Final)
68%
Grant Probability
Favorable
1-2
OA Rounds
3y 0m
To Grant
99%
With Interview

Examiner Intelligence

Grants 68% — above average
68%
Career Allow Rate
508 granted / 749 resolved
+7.8% vs TC avg
Strong +52% interview lift
Without
With
+51.7%
Interview Lift
resolved cases with interview
Typical timeline
3y 0m
Avg Prosecution
29 currently pending
Career history
778
Total Applications
across all art units

Statute-Specific Performance

§101
4.4%
-35.6% vs TC avg
§103
29.5%
-10.5% vs TC avg
§102
19.4%
-20.6% vs TC avg
§112
23.4%
-16.6% vs TC avg
Black line = Tech Center average estimate • Based on career data from 749 resolved cases

Office Action

§102 §103
Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . DETAILED ACTION 2. Claims 1-20 are pending and currently under prosecution. Priority Applicant’s claim under 35 U.S.C. §§ 119(e) for benefit of the earlier filing date of application, is acknowledged. 4. In the event the determination of the status of the application as subject to AIA 35 U.S.C. 102 and 103 (or as subject to pre-AIA 35 U.S.C. 102 and 103) is incorrect, any correction of the statutory basis for the rejection will not be considered a new ground of rejection if the prior art relied upon, and the rationale supporting the rejection, would be the same under either status. Claim Rejections - 35 USC § 102 5. The following is a quotation of the appropriate paragraphs of 35 U.S.C. 102 that form the basis for the rejections under this section made in this Office action: A person shall be entitled to a patent unless – (a)(1) the claimed invention was patented, described in a printed publication, or in public use, on sale or otherwise available to the public before the effective filing date of the claimed invention. 6. Claims 1-20 are rejected under 35 U.S.C. 102(a)(1) as being anticipated by Bobilev et al. (US 20190322746, published on 10/24/2019). Claims 1-20 are herein drawn to a method for treating mismatch repair deficient (MMRd) rectal cancer in a patient in need thereof comprising administering to the patient an effective amount of an anti-PD1 antibody or an antigen binding fragment thereof, wherein the anti-PD 1 antibody or antigen binding fragment comprises a heavy chain immunoglobulin variable domain (VH) and a light chain immunoglobulin variable domain (VL), wherein the VH comprises a VH-CDR1 sequence of SEQ ID NO: 5, a VH-CDR2 sequence of SEQ ID NO: 6, and a VH-CDR3 sequence of SEQ ID NO: 7 and the VL comprises a VL-CDR1 sequence of SEQ ID NO: 8, a VL-CDR2 sequence of SEQ ID NO: 9, and a VL-CDR3 sequence of SEQ ID NO: 10, and wherein the patient has not received a prior cancer therapy, wherein the VH comprises the sequence of SEQ ID NO: 3 and the VL comprises the sequence of SEQ ID NO: 1. Bobilev et al. teach a method of treating cancer, the method comprising administering an anti-PD-1 antibody, wherein the anti-PD-1 antibody comprising VH set forth in SEQ ID NO: 17 and VL set forth in SEQ ID NO: 18; see [0243-0245]. Bobilev et al. teach the cancer is colorectal cancer; see [0053]. Bobilev et al. teach the colorectal cancer has a defective DNA mismatch repair (MMRd) system; see [0047-0048], [0053], [0210], [0216-0218]. It is well known that colorectal cancer includes rectal cancer and/or colon cancer. SEQ ID NOs: 17-18 of Bobilev et al. are 100% identical with the instant claimed SEQ ID NOs: 3 and 1; see below sequence alignment 1. For claim 3, Bobilev et al. teach the anti-PD-1 antibody comprising a heavy chain (HC) set forth in SEQ ID NO: 13 and a light chain (LC) set forth in SEQ ID NO: 14; see [0247-0248]. SEQ ID NOs: 13-14 of Bobilev et al. are 100% identical with the instant claimed SEQ ID NOs: 4 and 2; see below sequence alignment 2. For claims 4-7, 9-10, 12 and 17-19, a wherein clause in a method claim is not given weight when it simply expresses the intended result of a process step positively recited, MPEP 2111.04. For claim 8, Bobilev et al. teach Lynch Syndrome; see [0209]. For claim 11, Bobilev et al. teach prior cancer therapy includes surgery, radiotherapy, chemotherapy, or immunotherapy; see [0083-0084]. For claim 13, Bobilev et al. teach the antibody fragments include Fab, F(ab')2, Fab', scFv, and Fv; see [0149]. For claim 14, Bobilev et al. teach that the anti-PD 1 antibody is administered intravenously; see claim 150. For claims 15-16, Bobilev et al. teach dose and treatment schedules of anti-PD1 antibody; see claims 72-79. For claim 20, Bobilev et al. teach that the MMRd is detected by an immunohistochemistry (IHC); see [0210]. Claim Rejections - 35 USC § 103 7. The following is a quotation of 35 U.S.C. 103 which forms the basis for all obviousness rejections set forth in this Office action: A patent for a claimed invention may not be obtained, notwithstanding that the claimed invention is not identically disclosed as set forth in section 102 of this title, if the differences between the claimed invention and the prior art are such that the claimed invention as a whole would have been obvious before the effective filing date of the claimed invention to a person having ordinary skill in the art to which the claimed invention pertains. Patentability shall not be negated by the manner in which the invention was made. 8. The factual inquiries set forth in Graham v. John Deere Co., 383 U.S. 1, 148 USPQ 459 (1966), that are applied for establishing a background for determining obviousness under 35 U.S.C. 103 are summarized as follows: 1. Determining the scope and contents of the prior art. 2. Ascertaining the differences between the prior art and the claims at issue. 3. Resolving the level of ordinary skill in the pertinent art. 4. Considering objective evidence present in the application indicating obviousness or nonobviousness. 9. Claims 1-20 are rejected under 35 U.S.C. 103 as being unpatentable over Diaz et al. (US 20190023787, published on 01/24/2019) in view of Bobilev et al. (US 20190322746, published on 10/24/2019). Claims 1-20 are herein drawn to a method for treating mismatch repair deficient (MMRd) rectal cancer in a patient in need thereof comprising administering to the patient an effective amount of an anti-PD1 antibody or an antigen binding fragment thereof, wherein the anti-PD 1 antibody or antigen binding fragment comprises a heavy chain immunoglobulin variable domain (VH) and a light chain immunoglobulin variable domain (VL), wherein the VH comprises a VH-CDR1 sequence of SEQ ID NO: 5, a VH-CDR2 sequence of SEQ ID NO: 6, and a VH-CDR3 sequence of SEQ ID NO: 7 and the VL comprises a VL-CDR1 sequence of SEQ ID NO: 8, a VL-CDR2 sequence of SEQ ID NO: 9, and a VL-CDR3 sequence of SEQ ID NO: 10, and wherein the patient has not received a prior cancer therapy, wherein the VH comprises the sequence of SEQ ID NO: 3 and the VL comprises the sequence of SEQ ID NO: 1. Diaz et al. teach a method for treating colorectal cancer in a patient, wherein the patient has been determined to have a tumor that exhibits a mismatch repair (MMR) deficiency status, the method comprises administering an effective amount of an anti-PD-1 antibody to the patient; see entire document, e.g., Figures 1-2, Examples, claims 1-29. For claims 4-7, 9-10, 12 and 17-19, a wherein clause in a method claim is not given weight when it simply expresses the intended result of a process step positively recited, MPEP 2111.04. Diaz et al. teach the colorectal cancer has Lynch Syndrome (instant claim 8); see [0011]. Diaz et al. teach that the prior cancer therapy drug was fluoropyrimidine, or oxaliplatin (instant claim 11); see claim 16. Diaz et al. teach that the anti-PD-1 antibody is administered by intravenous infusion (instant claim 14); see claim 28. Diaz et al. teach that the mismatch repair (MMR) deficiency status in the tumor is determined by immunohistochemistry (instant claim 20); see claims 6 and 20. Diaz et al. do not teach the anti-PD1 antibody comprising the VH comprises the sequence of SEQ ID NO: 3 and the VL comprises the sequence of SEQ ID NO: 1. However, these deficiencies are remedied by Bobilev et al. Bobilev et al. teach a method of treating cancer, the method comprising administering an anti-PD-1 antibody, wherein the anti-PD-1 antibody comprising VH set forth in SEQ ID NO: 17 and VL set forth in SEQ ID NO: 18; see [0243-0245]. Bobilev et al. teach the cancer is colorectal cancer; see [0053]. SEQ ID NOs: 17-18 of Bobilev et al. are 100% identical with the instant claimed SEQ ID NOs: 3 and 1; see below sequence alignment 1. Bobilev et al. teach the anti-PD-1 antibody comprising a heavy chain (HC) set forth in SEQ ID NO: 13 and a light chain (LC) set forth in SEQ ID NO: 14; see [0247-0248]. SEQ ID NOs: 13-14 of Bobilev et al. are 100% identical with the instant claimed SEQ ID NOs: 4 and 2; see below sequence alignment 2. Bobilev et al. teach the antibody fragments include Fab, F(ab')2, Fab', scFv, and Fv (instant claim 13); see [0149]. Bobilev et al. teach dose and treatment schedules of anti-PD1 antibody (instant claims 15-16); see claims 72-79. It would have been prima facie obvious to one of ordinary skill in the art before the effective filing date of the claimed invention to combine the teachings of the references so as to treat colorectal cancer in a patient, wherein the patient has been determined to have a tumor that exhibits a mismatch repair (MMR) deficiency status, the method comprises administering an effective amount of an anti-PD-1 antibody to the patient, wherein the anti-PD-1 antibody comprising instant claimed SEQ ID NOs. One would have been motivated to do so because Diaz et al. teach a method for treating colorectal cancer in a patient, wherein the patient has been determined to have a tumor that exhibits a mismatch repair (MMR) deficiency status, the method comprises administering an effective amount of an anti-PD-1 antibody to the patient; Bobilev et al. teach a method of treating colorectal cancer, the method comprising administering an anti-PD-1 antibody, wherein the anti-PD-1 antibody comprising VH set forth in SEQ ID NO: 17 and VL set forth in SEQ ID NO: 18, SEQ ID NOs: 17-18 of Bobilev et al. are 100% identical with the instant claimed SEQ ID NOs: 3 and 1. Thus, one of ordinary skill in the art would have a reasonable expectation of success that by combining the teachings of the references so as to substitute the anti-PD1 antibody of Diaz et al. for another anti-PD1 antibody of Bobilev et al., because simple substitution of the anti-PD1 antibody of Diaz et al. for another anti-PD1 antibody of Bobilev et al. would obtain predictable results. Given the examination guidelines for determining obviousness under 35 U.S.C. 103 in view of the Supreme Court decision in KSR International Co. V. Teleflex Inc. 82 USPQ2d 1385 (2007) and the Examination Guidelines set forth in the Federal Register (Vol. 72, No. 195, October 10, 2007) and incorporated recently into the MPEP (Revision 9, March 2014), the following rationales to support rejection under 35 U.S.C. 103(a) are noted: A) Combining prior art elements according known methods to yield predictable results. B) Simple substitution of one known element for another to obtain predictable results. C) Use of known technique to improve similar devices (methods, or products) in the same way. D) Applying known technique to a known device (method, or product) ready for improvement to yield predictable results. E) “Obvious to try” --- choosing form a finite number of identified, predictable solutions, with a reasonable expectation of success. (F) Known work in one field of endeavor may prompt variations of it for use in either the same field or a different one based on design incentives or other market forces if the variations are predictable to one of ordinary skill in the art. G) Some teachings, suggestion, or motivation in the prior art that would lead to one of ordinary skill to modify the prior art reference or to combine prior art reference teachings to arrive at the claimed invention. In this case, simple substitution of the anti-PD1 antibody of Diaz et al. for another anti-PD1 antibody of Bobilev et al. would obtain predictable results. Obviousness is not the result of a rigid formula disassociated from the consideration of the facts of a case. Indeed, the common sense of those skilled in the art demonstrates why some combinations would have been obvious where others would not. See KSR International Co. V. Teleflex Inc. 82 USPQ2d 1385 (2007). From the combined teachings of the references, it is apparent that one of ordinary skill in the art would have had a reasonable expectation of success in producing the claimed invention. Conclusion 10. No claim is allowed. 11. Any inquiry concerning this communication or earlier communications from the examiner should be directed to YAN XIAO whose telephone number is (571)270-3578. The examiner can normally be reached M-F 8-5 EST. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Samira Jean-Louis can be reached on 571-270-3503. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /YAN XIAO/Primary Examiner, Art Unit 1642 Sequence alignment 1 US-16-476-534-17 Filing date in PALM: 2019-07-08 Sequence 17, US/16476534 Publication No. US20190322746A1 GENERAL INFORMATION APPLICANT: Tesaro, Inc. TITLE OF INVENTION: METHODS OF TREATING CANCER WITH ANTI-TIM-3 ANTIBODIES FILE REFERENCE: TSR-002WO CURRENT APPLICATION NUMBER: US/16/476,534 CURRENT FILING DATE: 2019-07-08 PRIOR APPLICATION NUMBER: 62/444,354 PRIOR FILING DATE: 2017-01-09 PRIOR APPLICATION NUMBER: 62/582,272 PRIOR FILING DATE: 2017-09-06 NUMBER OF SEQ ID NOS: 26 SEQ ID NO 17 LENGTH: 116 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: Synthetic Polypeptide Query Match 100.0%; Score 614; Length 116; Best Local Similarity 100.0%; Matches 116; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSTISGGGSYTYY 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSTISGGGSYTYY 60 Qy 61 QDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCASPYYAMDYWGQGTTVTVSS 116 |||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 QDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCASPYYAMDYWGQGTTVTVSS 116 US-16-476-534-18 Filing date in PALM: 2019-07-08 Sequence 18, US/16476534 Publication No. US20190322746A1 GENERAL INFORMATION APPLICANT: Tesaro, Inc. TITLE OF INVENTION: METHODS OF TREATING CANCER WITH ANTI-TIM-3 ANTIBODIES FILE REFERENCE: TSR-002WO CURRENT APPLICATION NUMBER: US/16/476,534 CURRENT FILING DATE: 2019-07-08 PRIOR APPLICATION NUMBER: 62/444,354 PRIOR FILING DATE: 2017-01-09 PRIOR APPLICATION NUMBER: 62/582,272 PRIOR FILING DATE: 2017-09-06 NUMBER OF SEQ ID NOS: 26 SEQ ID NO 18 LENGTH: 107 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: Synthetic Polypeptide Query Match 100.0%; Score 573; Length 107; Best Local Similarity 100.0%; Matches 107; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 DIQLTQSPSFLSAYVGDRVTITCKASQDVGTAVAWYQQKPGKAPKLLIYWASTLHTGVPS 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 DIQLTQSPSFLSAYVGDRVTITCKASQDVGTAVAWYQQKPGKAPKLLIYWASTLHTGVPS 60 Qy 61 RFSGSGSGTEFTLTISSLQPEDFATYYCQHYSSYPWTFGQGTKLEIK 107 ||||||||||||||||||||||||||||||||||||||||||||||| Db 61 RFSGSGSGTEFTLTISSLQPEDFATYYCQHYSSYPWTFGQGTKLEIK 107 Sequence alignment 2 US-16-476-534-13 Filing date in PALM: 2019-07-08 Sequence 13, US/16476534 Publication No. US20190322746A1 GENERAL INFORMATION APPLICANT: Tesaro, Inc. TITLE OF INVENTION: METHODS OF TREATING CANCER WITH ANTI-TIM-3 ANTIBODIES FILE REFERENCE: TSR-002WO CURRENT APPLICATION NUMBER: US/16/476,534 CURRENT FILING DATE: 2019-07-08 PRIOR APPLICATION NUMBER: 62/444,354 PRIOR FILING DATE: 2017-01-09 PRIOR APPLICATION NUMBER: 62/582,272 PRIOR FILING DATE: 2017-09-06 NUMBER OF SEQ ID NOS: 26 SEQ ID NO 13 LENGTH: 443 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: Synthetic Polypeptide Query Match 100.0%; Score 2360; Length 443; Best Local Similarity 100.0%; Matches 443; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSTISGGGSYTYY 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYDMSWVRQAPGKGLEWVSTISGGGSYTYY 60 Qy 61 QDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCASPYYAMDYWGQGTTVTVSSASTK 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 QDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCASPYYAMDYWGQGTTVTVSSASTK 120 Qy 121 GPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYS 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 GPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYS 180 Qy 181 LSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFP 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 LSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFP 240 Qy 241 PKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVS 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 PKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVS 300 Qy 301 VLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVS 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 VLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVS 360 Qy 361 LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFS 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFS 420 Qy 421 CSVMHEALHNHYTQKSLSLSLGK 443 ||||||||||||||||||||||| Db 421 CSVMHEALHNHYTQKSLSLSLGK 443 US-16-476-534-14 Filing date in PALM: 2019-07-08 Sequence 14, US/16476534 Publication No. US20190322746A1 GENERAL INFORMATION APPLICANT: Tesaro, Inc. TITLE OF INVENTION: METHODS OF TREATING CANCER WITH ANTI-TIM-3 ANTIBODIES FILE REFERENCE: TSR-002WO CURRENT APPLICATION NUMBER: US/16/476,534 CURRENT FILING DATE: 2019-07-08 PRIOR APPLICATION NUMBER: 62/444,354 PRIOR FILING DATE: 2017-01-09 PRIOR APPLICATION NUMBER: 62/582,272 PRIOR FILING DATE: 2017-09-06 NUMBER OF SEQ ID NOS: 26 SEQ ID NO 14 LENGTH: 214 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: Synthetic Polypeptide Query Match 100.0%; Score 1126; Length 214; Best Local Similarity 100.0%; Matches 214; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 DIQLTQSPSFLSAYVGDRVTITCKASQDVGTAVAWYQQKPGKAPKLLIYWASTLHTGVPS 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 DIQLTQSPSFLSAYVGDRVTITCKASQDVGTAVAWYQQKPGKAPKLLIYWASTLHTGVPS 60 Qy 61 RFSGSGSGTEFTLTISSLQPEDFATYYCQHYSSYPWTFGQGTKLEIKRTVAAPSVFIFPP 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 RFSGSGSGTEFTLTISSLQPEDFATYYCQHYSSYPWTFGQGTKLEIKRTVAAPSVFIFPP 120 Qy 121 SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT 180 Qy 181 LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 214 |||||||||||||||||||||||||||||||||| Db 181 LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 214
Read full office action

Prosecution Timeline

May 30, 2023
Application Filed
May 09, 2024
Response after Non-Final Action
Jan 09, 2026
Non-Final Rejection — §102, §103 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12600763
COMPOSITIONS AND METHODS FOR THE DELIVERY OF THERAPEUTIC BIOLOGICS FOR TREATMENT OF DISEASE
2y 5m to grant Granted Apr 14, 2026
Patent 12590146
CLDN18.2-TARGETING ANTIBODY, PREPARATION METHOD THEREFOR, AND USE THEREOF
2y 5m to grant Granted Mar 31, 2026
Patent 12564641
ERIBULIN ANTIBODY-DRUG CONJUGATES AND METHODS OF USE
2y 5m to grant Granted Mar 03, 2026
Patent 12540176
True human antibody specific for interleukin 1 alpha
2y 5m to grant Granted Feb 03, 2026
Patent 12529702
SCORING METHODS FOR ANTI-PD THERAPY ELIGIBILITY AND COMPOSITIONS FOR PERFORMING SAME
2y 5m to grant Granted Jan 20, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

AI Strategy Recommendation

Get an AI-powered prosecution strategy using examiner precedents, rejection analysis, and claim mapping.
Powered by AI — typically takes 5-10 seconds

Prosecution Projections

1-2
Expected OA Rounds
68%
Grant Probability
99%
With Interview (+51.7%)
3y 0m
Median Time to Grant
Low
PTA Risk
Based on 749 resolved cases by this examiner. Grant probability derived from career allow rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month