Prosecution Insights
Last updated: July 17, 2026
Application No. 18/362,036

WHEAT MS1 POLYNUCLEOTIDES, POLYPEPTIDES, AND METHODS OF USE

Non-Final OA §103§112
Filed
Jul 31, 2023
Priority
Sep 26, 2014 — provisional 62/056,365 +3 more
Examiner
BOGGS, RUSSELL T
Art Unit
1663
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Pioneer Hi-bred International Inc.
OA Round
1 (Non-Final)
73%
Grant Probability
Favorable
1-2
OA Rounds
0m
Est. Remaining
88%
With Interview

Examiner Intelligence

Grants 73% — above average
73%
Career Allowance Rate
485 granted / 664 resolved
+13.0% vs TC avg
Strong +15% interview lift
Without
With
+15.3%
Interview Lift
resolved cases with interview
Typical timeline
2y 10m
Avg Prosecution
21 currently pending
Career history
684
Total Applications
across all art units

Statute-Specific Performance

§101
4.1%
-35.9% vs TC avg
§103
30.4%
-9.6% vs TC avg
§102
14.4%
-25.6% vs TC avg
§112
29.9%
-10.1% vs TC avg
Black line = Tech Center average estimate • Based on career data from 664 resolved cases

Office Action

§103 §112
DETAILED ACTION Notice of Pre-AIA or AIA Status The present application, filed on or after 16 March 2013, is being examined under the first-inventor-to-file provisions of the AIA . Status 1Claims 1-22 as filed on 31 July 2023 were subject to a restriction requirement posted on 20 August 2025. Applicant responded on 22 December 2025 amending claim 15. Applicant elected without traverse SEQ ID NO:5 and SEQ ID NO:7 along with Group II in the reply. The requirement is deemed proper and is therefore made FINAL. Claims 1-22 are pending. Claims 15-17 are examined herein. Claims 1-14 and 18-22 are withdrawn as being drawn to a non-elected invention. Although no claims were cancelled, Applicant is reminded that upon the cancellation of claims to a non-elected invention, the inventorship must be amended in compliance with 37 CFR 1.48(b) if one or more of the currently named inventors is no longer an inventor of at least one claim remaining in the application. Any amendment of inventorship must be accompanied by a request under 37 CFR 1.48(b) and by the fee required under 37 CFR 1.17(i). Examiner’s Notes 2. Citations to Applicant’s specification are abbreviated herein “Spec.” Occasionally, “SEQ ID NO:” may be used as an abbreviation “SEQ ID NO:” herein. The limitation "ms1" has an accepted meaning in the art. See page 2 of the Office action of 16 December 2021 in the parent application 16/697,681. The undersigned italicizes gene designations but not protein designations. In the Office action and in the quotes below follows that convention. Any disagreements regarding italicized versus non-italicized nomenclature is not substantive. The specification and claims are clear. Specification The disclosure is objected to because of the following informalities. The disclosure is objected to because it contains an embedded hyperlink and/or other form of browser-executable code. Applicant is required to delete the embedded hyperlink and/or other form of browser-executable code. See MPEP § 608.01. See page 53. Improper Markush Group Claims 15-17 are rejected on the basis that they contain an improper Markush grouping of alternatives. See In re Harnisch, 631 F.2d 716, 721-22 (CCPA 1980) and Ex parte Hozumi, 3 USPQ2d 1059, 1060 (Bd. Pat. App. & Int. 1984). A Markush grouping is proper if the alternatives defined by the Markush group (i.e., alternatives from which a selection is to be made in the context of a combination or process, or alternative chemical compounds as a whole) share a "single structural similarity" and a common use. A Markush grouping meets these requirements in two situations. First, a Markush grouping is proper if the alternatives are all members of the same recognized physical or chemical class or the same art-recognized class, and are disclosed in the specification or known in the art to be functionally equivalent and have a common use. Second, where a Markush grouping describes alternative chemical compounds, whether by words or chemical formulas, and the alternatives do not belong to a recognized class as set forth above, the members of the Markush grouping may be considered to share a "single structural similarity" and common use where the alternatives share both a substantial structural feature and a common use that flows from the substantial structural feature. See MPEP § 2117. The Markush groupings in claim 15 are improper because the alternatives defined by the Markush grouping do not share both a single structural similarity and a common use for the following reasons. When SEQ ID NO:7 was searched against the Office U.S. Patent databases, only SEQ ID NO:9 shares a high degree of sequence identity. The next closest match, SEQ ID NO:6, is below 36%. SEQ ID NO:1 is only approximately 11% sequence identical. In a similar analysis, SEQ ID NO:40 is only approximately 54% sequence identical. Applicant teachings are that such a diverse group of sequences will function differently with distinct activity, e.g. when expressed transgenically in a any plant. Therefore the species of the Markush group lack both a substantial structural feature and a common use that flows from the substantial structural feature To overcome this rejection, Applicant may set forth each alternative (or grouping of patentably indistinct alternatives) within an improper Markush grouping in a series of independent or dependent claims and/or present convincing arguments that the group members recited in the alternative within a single claim in fact share a single structural similarity as well as a common use. Claims depending on the claims reciting an improper Markush group are included in this rejection. Amending the claims to recite only the elected species would obviate the rejection. 35 USC § 112(a) based Claim Rejections The following is a quotation of 35 U.S.C. 112(a): The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor or joint inventor of carrying out the invention. The following is a quotation of 35 U.S.C. 112 (pre-AIA ), first paragraph: The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same and shall set forth the best mode contemplated by the inventor of carrying out his invention. Claims 15-17 are rejected under 35 U.S.C. 112(a) or 35 U.S.C. 112 (pre-AIA ), first paragraph, as failing to comply with the written description requirement. The claims contain subject matter which was not described in the specification in such a way as to reasonably convey to one skilled in the relevant art that the inventor or a joint inventor, or for pre-AIA the inventor(s), at the time the application was filed, had possession of the claimed invention as broadly as claimed. The Federal Circuit held that a written description of an invention "’requires a precise definition, such as by structure, formula [or] chemical name,’ of the claimed subject matter sufficient to distinguish it from other materials." Regents of the Univ. of Cal. v. Eli Lilly & Co., 119 F.3d 1559, 1568, 43 USPQ2d 1398, 1405 (Fed. Cir. 1997) (quoting Fiers v. Revel, 984 F.2d 1164, 1171, 25 USPQ2d 1601, 1606 (Fed. Cir. 1993)). The court also stated "naming a type of material generally known to exist, in the absence of knowledge as to what that material consists of is not a description of that material." Id., 119 F.3d at 1568, 43 USPQ2d at 1406. The court held that “[a] description of a genus of cDNAs may be achieved by means of a recitation of a representative number of cDNAs, defined by nucleotide sequence, falling within the scope of the genus or of a recitation of structural features common to members of the genus, which features constitute a substantial portion of the genus.” Id., 119 F. 3d at 1569, 43 USPQ2d at 1406. Claim 15 claims various genera that are not supported by adequate written description. Parts (c) and (d) claim genera of nucleotide sequences: at least 85% sequence identity to SEQ ID NO:7; and fragments of at least 500 consecutive nucleotides of SEQ ID NO:7. In the specification, Applicant describes the genetic mapping of ms1. Spec., p. 51. Bridging pages 54-55, Applicant states “SEQ ID NO:5 is the amino acid sequence of the encoded protein) and has been named TaLTPG1, also known as Ms1 (italics in original). In Example 4, Applicant analyzed mutant wheat alleles. Id., p. 55. SEQ ID NO:7 is identified as the ”wild-type Ms1 genomic DNA sequence” (no italics in original). Bridging pages 58-59 Applicant describes transforming the “wheat Ms1 gene” (no italics in original) but does not identify it as SEQ ID NO:7. On pages 59, Applicant states that “the transformed copy of TaMs1 was functional and able to restore fertility to ms1d/ms1d homozygous male sterile plants” (no italics in original). SEQ ID NO:5 is 220 amino acids in length. SEQ ID NO:7 is 4,335 base pairs long and is described as “genomic DNA” in the sequence listing. The portion of SEQ ID NO:7 that is required for encoding SEQ ID NO:5 is 660 base pairs. That is only approximately 15% of SEQ ID NO:7. 500 base pair fragments of SEQ ID NO:7 appear to have a high probability on containing only non-coding sequences such as, for example, an intron. It could be that transgenically expressing an intron would have a phenotypic effect and could modulate male sterility. However there are no teachings in the specification to substantiate that. Applicant’s teachings address the ms1 protein. As Applicant teaches, a 500+ nucleotide fragment of SEQ ID NO:7, SEQ ID NO:46 is the terminator region. Id., p. 58, ll. 21-23. How would transgenic expression of that modulate male fertility? Applicant fails to provide such evidence. Additionally, regarding variants of nucleotide sequences, minor changes in a reading frame, as little as one nucleotide, can massively change the encoded protein. A single nucleotide can introduce a premature stop codon or can produce a frame shift. Applicant acknowledges some of this in the discussion of the changes observed in ms1 genes. Id. p. 55. Applicant describes transforming “the wheat Msl gene” into wheat. Spec., p. 58 (btm)). Applicant analyzes two events (p. 60). This appears to be SEQ ID NO:7. However, variants of SEQ ID NO:7 are not analyzed. Thus, in contrast to the scope of claim 15,Applicant describes only one embodiment. With only the full-length SEQ ID NO:7, if this is the ms1 gene described on page 58, Applicant fails to describe a representative number of species. In a further analysis of Applicant’s invention, SEQ ID NO:7 was translated using a publicly available website. (https :// www.bioinformatics.org/sms2/translate .html (spaces added to disrupt the hyperlink)) When the following fragment of SEQ ID NO:7 was translated, the polypeptide sequence following was obtained. atggagagatcccgcgggctgctgctggtggcggggctgctggcggcgctgctgccggcggcggcggcgcagccgggggcgccgtgcgagcccgcgctgctggcgacgcaggtggcgctcttctgcgcgcccgacatgccgacggcccagtgctgcgagcccgtcgtcgccgccgtcgacctcggcggcggggtgccctgcctctgccgcgtcgccgccgagccgcagctcgtcatggcgggcctcaacgccacccacctcctcacgctctacagctcctgcggcggcctccgccccggcggcgcccacctcgccgccgcctgcgaaggtacgttgtccgcctcctcccctccctccctccctccctctctctctacgtgctcgctttcctgcttacctagtagtacgtagtttcccatgccttcttgactcgctagaagtgctccggtttgggtctgttaatttcctcgctgtactaccggatctgtcgtcggcacggcgcgcggcgtcgggtcctcgccttctcccgtggcgaccgacctgcgcagcgcgcgcgcggcctagctagcttcataccgctgtacctcgacatacacggagcgatctatggtctactctgagtatttcctcatcgtagaacgcatgcgccgctcgcgattgtttcgtcgattctagatccgtgcttgttcccgcgagttagtatgcatctgcgtgcatatgccgtacgcacgcagatgcagagtctgttgctcgagttatctactgtcgttcgctcgaccatatttgcctgttaatttcctgttcatcgtgcatgcagtagtagtagccatgtccacgccttcttgttttgaggcgatcatcgtcgagatccatggctttgctttctgcactatcttctgccttgttttgttctccgcagtacgtacgtcttgcttggtcaaaactgaaaaacgctttgctgtttgtttgatcggcaagagctggccgtgcttttggcaccgcagtgcgtcgcctctgccgcttttgcgaaacatttccatgttgatcctctggcggaactactttttcgcgtgcggtttgcgtggccttcctctctcgtgaaaagaggtcgggtcaaaccaaatggatcgcctcttggcagagcagcggcagcagatagctggccgtctcgcagctttggcagaaccggtctgtggccatctgtcgccgcctgccaccgtttccctgatgtttgtttctctctcgcctgccactgtttcttttcttgttgcgcacgtacgtcgtcacctcctcctacttttttgccagttttgtttacttttgatgaaatatacggatgaatcggctggtgattaactttggctgctgctgttaattactgtggattttggatgcaggacccgctcccccggccgccgtcgtcagcagccccccgcccccgcctccaccgtccgccgcacctcg . MERSRGLLLVAGLLAALLPAAAAQPGAPCEPALLATQVALFCAPDMPTAQCCEPVVAAVDLGGGVPCLCRVAAEPQLVMAGLNATHLLTLYSSCGGLRPGGAHLAAACEGTLSASSPPSLPPSLSTCSLSCLPSST*FPMPS*LARSAPVWVC*FPRCTTGSVVGTARGVGSSPSPVATDLRSARAA*LASYRCTSTYTERSMVYSEYFLIVERMRRSRLFRRF*IRACSRELVCICVHMPYARRCRVCCSSYLLSFARPYLPVNFLFIVHAVVVAMSTPSCFEAIIVEIHGFAFCTIFCLVLFSAVRTSCLVKTEKRFAVCLIGKSWPCFWHRSASPLPLLRNISMLILWRNYFFACGLRGLPLS*KEVGSNQMDRLLAEQRQQIAGRLAALAEPVCGHLSPPATVSLMFVSLSPATVSFLVAHVRRHLLLLFCQFCLLLMKYTDESAGD*LWLLLLITVDFGCRTRSPGRRRQQPPAP ASTVRRTS The underlined portion corresponds to SEQ ID NO:5. After the underlined portion, the sequences are not the same. Thus the relation between SEQ ID NO:5 and SEQ ID NO:7 is uncertain and the two sequences appear to be separate genera with some overlap. Also, as seen above, Applicant’s specification teaches that SEQ ID NO:7 encodes SEQ ID NO:5. (Similar results were obtained when the full length of SEQ ID NO:7 was translated in the first open reading frame. Translate results >rf 1 Untitled RLKPFSYKYRCTPSVGRCEKACFLGRQAPFATYPLLILFRSLTS*AAIDMLF*GSGSCN* TS*TASLMSSFSYIFSRLLACFVFNIRFYDSTSVVASNNL*LLRNMNSRRADGAMKLI*W EVVLHLHLLLDLNTCLGFLPSSST*YFSN*CSTT*NLNPQTYF*YMNNFLI*GKHFSYTN RSF*YMVKISVIYAEMFSNTY*TYL**MVNIFFNN**PFLKCILNIL*YTLYSFIIIDEH LLEF*TFFSKTQAIFQEEYKCKRNEISKKQKRKTKQNRETYRKIQTEKAKKEPELGQAMF PTASLFLNKKASQPMGCSQYSGPAVAARHVIVFAGIQRRNRPQREPDVGLVRSGAFQNSP QAPAAVRSDQHEARTLARGDIFFPRPTTAALHFILNFKIRKRKSFLASRGEAVTGARGAT PPTHPRPHVPRAAASGPSARTAGRAQPEPTPRIERGRRARGLA*RPRHLRLYKPPHTRSP SGIPFRHRTTTTTKP*RASEGERDRPAATMERSRGLLLVAGLLAALLPAAAAQPGAPCEP ALLATQVALFCAPDMPTAQCCEPVVAAVDLGGGVPCLCRVAAEPQLVMAGLNATHLLTLY SSCGGLRPGGAHLAAACEGTLSASSPPSLPPSLSTCSLSCLPSST*FPMPS*LARSAPVW VC*FPRCTTGSVVGTARGVGSSPSPVATDLRSARAA*LASYRCTSTYTERSMVYSEYFLI VERMRRSRLFRRF*IRACSRELVCICVHMPYARRCRVCCSSYLLSFARPYLPVNFLFIVH AVVVAMSTPSCFEAIIVEIHGFAFCTIFCLVLFSAVRTSCLVKTEKRFAVCLIGKSWPCF WHRSASPLPLLRNISMLILWRNYFFACGLRGLPLS*KEVGSNQMDRLLAEQRQQIAGRLA ALAEPVCGHLSPPATVSLMFVSLSPATVSFLVAHVRRHLLLLFCQFCLLLMKYTDESAGD *LWLLLLITVDFGCRTRSPGRRRQQPPAPASTVRRTSPQAASA*EPLPLPLSLPLACISL CLSMSIC*SALFSY*HVHRIGFSQTTHHRRHRRRARSRRPRRRPRTTTAPPPAPRPRPPR RPPPRSRPPPPPPPRRPRRRTPPRPRRRPRRPSSSSPRPCSASTSSSESRADPARDRGPS SRSRVERSSSRSVSCLSPFEVRFCVQSGRRSRWVLSTSGSSSSSYRFCPLVRVCVVAENN *LGVCESSG*DEPLMLCDRSIGMI*MEMDQVLRSADDVIHLDLCGATVSLAFALR*TNAS CMHLVFA*FEL*NGCSTDFCL*CDDSSYAYHLFKFV*QLFVASILLWTNACFSRRTARGD RCGFVLPCCFPRQDKIDGAVLIPNPTITMFRRATWNSRQAVTFCRITLTILPFC*NLSPH PQKLMQQCYARPPMLFHMIVKFGSILSFEP*VRFTICLHVYVPCGEDH*TRLLLDIFRQA LKSEF A certain amount of amino acid sequence variation without losing function is accepted in the art. SEQ ID NO:5 is 220 amino acids in length. However, polypeptide sequences that are up to 15% variant could change up to 33 amino acids. With the regard to the polypeptide variants, Guo et al. teaches that while proteins are fairly tolerant to mutations resulting in single amino acid changes, increasing the number of substitutions additively increases the probability that the protein will be inactivated. Guo et al. (2004) Proc Natl Acad Sci USA 101: 9205-10, p. 9209, rt. col., para. 2. In summary, Applicant fails to describe a representative number of species of sequences related to SEQ ID NO:5 and/or SEQ ID NO:7 that modulate male fertility. Applicant also fails describe the structural elements of a SEQ ID NO:5-related polypeptide (or polynucleotide structures related to SEQ ID NO:7) that are necessary and/or sufficient for the phenotype. Hence Applicant fails to satisfy the written description requirement because Applicant fails to describe a representative number of species of sequences related to SEQ ID NO:5 or SEQ ID NO:7 and Applicant also fails to describe the structural elements of this polypeptide / polynucleotide that are necessary and/or sufficient for activity in the instant invention. Therefore Applicant has not demonstrated to one skilled in the art possession of the broad genus of claimed polypeptides and polynucleotides. One skilled in the art would not be able to envision the claimed genera Since the specification fails to provide an adequate written description to support the breadth of the claims, one of skill in the art would not believe Applicant to be in possession of the invention as broadly as claimed at the time of filing. Dependent claims are included in this rejection because none provide further limitations obviating this rejection. Claims 15-17 are rejected under 35 U.S.C. 112(a) or 35 U.S.C. 112 (pre-AIA ), first paragraph, because the specification, while being enabling for the use of SEQ ID NO:5 and/or SEQ ID NO:7 to modulate male fertility, does not reasonably provide enablement for the invention as broadly as claimed. The specification does not enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the invention commensurate in scope with these claims. The Federal Circuit in In re Wands lists eight considerations for determining whether or not undue experimentation would be necessary to practice an invention. In re Wands, 858 F2d 731, 8 USPQ2d 1400 (Fed. Cir. 1988). These factors are: the quantity of experimentation necessary, the amount of direction or guidance presented, the presence or absence of working examples of the invention, the nature of the invention, the state of the prior art, the relative skill of those in the art, the predictability or unpredictability of the art, and the breadth of the claims. Id., 858 F2d at 737, 8 USPQ2d at 1404. Biotechnology is generally held to be an unpredictable art. In re Vaeck, 947 F.2d 488, 496, 20 U.S.P.Q.2d 1438, 1445 (Fed. Cir. 1991). The scope of the claims is set forth supra in the written description rejectionregarding variants and fragments of SEQ ID NO:7 and/or SEQ ID NO:5 is incorporated by reference herein. The teachings of the specification are also incorporated by reference herein. Random mutagenesis to make polypeptide variants with a large number of variants - up to 33 amino acid substitutions in the instant case – is unpredictable. Guo et al. teaches that while proteins are fairly tolerant to mutations resulting in single amino acid changes, increasing the number of substitutions additively increases the probability that the protein will be inactivated. Guo et al., Proc Natl Acad Sci USA 101: 9205-10 (2004), p. 9209, rt. col., para. 2. Thus, making and analyzing proteins with up to 33 amino acid substitutions that would also function within the instant invention would require undue experimentation. Extensive guidance would be required for making variants of, for example, SEQ ID NO:5 with up to 33 amino acid substitutions as encompassed by the claims. This guidance is not provided by the specification and thus making and using variants of SEQ ID NO:5 or SEQ ID NO:7 as broadly as claimed would require undue experimentation. Claim 15 reads on a vast number of amino acid and nucleotide sequences, such as those sharing 85% sequence identity with SEQ ID NO:5. Applicant, however, provides no affirmative guidance as to which variant sequences in this universe of possible sequences will provide a functional yield-increasing polypeptide in the instant invention and which will not. The claimed invention is not enabled because the effect of expressing in a plant a heterologous nucleic acid sequence that, e.g., encodes a polypeptide having as little as 85% amino acid sequence identity to SEQ ID NO:5 is unpredictable or as little as 85% sequence identity with SEQ ID NO:7. The effect is unpredictable because polypeptides that are related to SEQ ID NO:5 cannot predictably restore fertility to a male sterile plant because, in part, SEQ ID NO:5 or SEQ ID NO:7 were not well characterized at the time of filing the instant application and, additionally, the effect of making widespread changes to a biological sequence is unpredictable. Extensive guidance would be required to enable the invention as broadly as claimed – such guidance is not provided. One of skill in the art, after reading the specification, would be uncertain as to both how to make and how to use a variant of SEQ ID NO:5 or SEQ ID NO:7 to function within the instant invention. One of skill in the art would find it difficult to predict which of the claimed sequence variants could be used in the instant invention, and which could not. Although testing individual sequences can be routine, Applicant has provided no guidance as to how to proceed. Given the claim breadth regarding variant sequences, combined with the unpredictability in the art, and lack of guidance as discussed above, undue experimentation is required to practice Applicant’s invention. Therefore one skilled in the art would be forced to make and test numerous variants of SEQ ID NO:5 and/or SEQ ID NO:7 with no guidance as to which ones could be used in the instant invention. Thus Applicant’s claimed invention would require undue trial and error experimentation with no reasonable expectation of success. Therefore the invention is not enabled throughout the broad scope of the claims. Dependent claims are included in this rejection because none provide further limitations obviating this rejection. Claim Rejections - 35 USC § 103 In the event the determination of the status of the application as subject to AIA 35 U.S.C. 102 and 103 (or as subject to pre-AIA 35 U.S.C. 102 and 103) is incorrect, any correction of the statutory basis (i.e., changing from AIA to pre-AIA ) for the rejection will not be considered a new ground of rejection if the prior art relied upon, and the rationale supporting the rejection, would be the same under either status. The following is a quotation of 35 U.S.C. 103 which forms the basis for all obviousness rejections set forth in this Office action: § 103. Conditions for patentability; non-obvious subject matter A patent for a claimed invention may not be obtained, . . . . if the differences between the claimed invention and the prior art are such that the claimed invention as a whole would have been obvious before the effective filing date of the claimed invention to a person having ordinary skill in the art to which the claimed invention pertains. Patentability shall not be negated by the manner in which the invention was made. Claim 15 is rejected under 35 U.S.C. 103 as being unpatentable over U.S. Patent Publication No. 2006/0143729 A1 Alexandrov & Brover (“AaB”). The factual inquiries set forth in Graham v. John Deere Co., 383 U.S. 1, 18, 148 USPQ 459, 467 (1966), that are applied for establishing a background for determining obviousness under 35 U.S.C. 103(a) are summarized as follows:a. Determining the scope and contents of the prior art.b. Ascertaining the differences between the prior art and the claims at issue.c. Resolving the level of ordinary skill in the pertinent art.d. Considering objective evidence present in the application indicating obviousness or nonobviousness. Instant claim 15 is a method claim where the only active step is introducing into a plant a polynucleotide operably linked to a heterologous promoter active in said plant where the polynucleotide (b) encodes a polypeptide having at least 85% sequence identity to the full length of SEQ ID NO: 5. The preamble requires modulating male fertility in a plant and the last line requires the function of modulating male fertility. Thus clearly the claim has a real-world function. However, according to Applicant’s teachings the modulation of male fertility arises as a property of expressing SEQ ID NO:5 in a wheat plant. As seen in the alignment below, an amino acid sequence falling within the scope of the claims was known in the prior art. Alexandrov & Brover’s claim 1 teaches its disclosed sequences in isolated form and its claim 4 places it in a vector. In this vector is a heterologous promoter. (See also paragraph 0017). Claim 11 is a method claim putting that vector in a plant. See also claims 13-15. Then claim 17 isa regenerated plant. It would have been prima facie obvious to one of ordinary skill in the art as of the effective filing date of the claimed invention to carry out the single active step in claim 15 in view of the teachings of Alexandrov & Brover. Given the level of skill in the art as of the effective filing date of the claimed invention one of ordinary skill in the art would have had a reasonable expectation of success. Applicant defines SEQ ID NO:5 as the polypeptide encoded by the ms1 gene. (Spec., p. 3 (top). Applicant states that when the ms1 gene is transgenically expressed, but without additional limitations / elements, it can restore activity to a plant. (Id., top of p. 58). Alexandrov & Brover does not teach a modulation of male fertility but it teaches the only step of claim 15. “It is not invention to perceive that the product which others had discovered had qualities they failed to detect.” General Elec. Co. v. Jewel Incandescent Lamp Co., 326 US 242, 249, 67 USPQ 155, 158 (1945). Examiner’s Note #2 Claim 17 is not included in this rejection because the starting material is interpreted as being a male sterile plant which is not taught by Alexandrov & Brover in association with SEQ ID NO:5. US-11-174-307B-4072 (NOTE: this sequence has 7 duplicates in the database searched. See complete list at the end of this report) Sequence 4072, US/11174307B GENERAL INFORMATION APPLICANT: ALEXANDROV, Nickolai APPLICANT: BROVER, Vyacheslav TITLE OF INVENTION: NUCLEOTIDE SEQUENCES AND POLYPEPTIDES ENCODED THEREBY TITLE OF INVENTION: USEFUL FOR MODIFYING PLANT CHARACTERISTICS FILE REFERENCE: 2750-1601PUS2 CURRENT APPLICATION NUMBER: US/11/174,307B CURRENT FILING DATE: 2005-06-30 PRIOR APPLICATION NUMBER: 60/583,671 PRIOR FILING DATE: 2004-06-30 PRIOR APPLICATION NUMBER: 60/583,781 PRIOR FILING DATE: 2004-06-30 PRIOR APPLICATION NUMBER: 60/583,651 PRIOR FILING DATE: 2004-06-30 NUMBER OF SEQ ID NOS: 5544 SEQ ID NO 4072 LENGTH: 220 TYPE: PRT ORGANISM: Triticum aestivum FEATURE: NAME/KEY: misc_feature LOCATION: OTHER INFORMATION: PFam Name: Pyr_redox_2; PFam Description: Pyridine FEATURE: NAME/KEY: misc_feature LOCATION: OTHER INFORMATION: PFam Name: Extensin_2; PFam Description: Extensin-like region FEATURE: NAME/KEY: misc_feature LOCATION: OTHER INFORMATION: PFam Name: FH2; PFam Description: Formin Homology 2 Domain FEATURE: NAME/KEY: misc_feature LOCATION: OTHER INFORMATION: PFam Name: GATase_2; PFam Description: Glutamine FEATURE: NAME/KEY: misc_feature LOCATION: OTHER INFORMATION: PFam Name: LMBR1; PFam Description: LMBR1-like membrane protein FEATURE: NAME/KEY: misc_feature LOCATION: OTHER INFORMATION: GI Number: 25989119; NR Description: unknown [Streptomyces FEATURE: NAME/KEY: misc_feature LOCATION: OTHER INFORMATION: GI Number: 6523547; NR Description: hydroxyproline-rich FEATURE: NAME/KEY: misc_feature LOCATION: OTHER INFORMATION: GI Number: 100753; NR Description: hydroxyproline-rich glycoprotein - sorghum >gi|228939|prf||1814452D Hyp-rich FEATURE: NAME/KEY: misc_feature LOCATION: OTHER INFORMATION: GI Number: 7949115; NR Description: Ser/Arg-related nuclear matrix protein; plenty-of-prolines-101; serine/arginine repetitive matrix protein 1 [Mus musculus] >gi|3153821|gb|AAC17422.1| FEATURE: NAME/KEY: misc_feature LOCATION: OTHER INFORMATION: GI Number: 62948087; NR Description: Unknown (protein for Query Match 99.7%; Score 1151; Length 220; Best Local Similarity 99.5%; Matches 219; Conservative 0; Mismatches 1; Indels 0; Gaps 0; Qy 1 MERSRGLLLVAGLLAALLPAAAAQPGAPCEPALLATQVALFCAPDMPTAQCCEPVVAAVD 60 |||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||| Db 1 MERSRGLLLVAGLLVALLPAAAAQPGAPCEPALLATQVALFCAPDMPTAQCCEPVVAAVD 60 Qy 61 LGGGVPCLCRVAAEPQLVMAGLNATHLLTLYSSCGGLRPGGAHLAAACEGPAPPAAVVSS 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 LGGGVPCLCRVAAEPQLVMAGLNATHLLTLYSSCGGLRPGGAHLAAACEGPAPPAAVVSS 120 Qy 121 PPPPPPPSAAPRRKQPAHDAPPPPPPSSEKPSSPPPSQDHDGAAPRAKAAPAQAATSTLA 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 PPPPPPPSAAPRRKQPAHDAPPPPPPSSEKPSSPPPSQDHDGAAPRAKAAPAQAATSTLA 180 Qy 181 PAAAATAPPPQAPHSAAPTAPSKAAFFFVATAMLGLYIIL 220 |||||||||||||||||||||||||||||||||||||||| Db 181 PAAAATAPPPQAPHSAAPTAPSKAAFFFVATAMLGLYIIL 220 Claim 16 is rejected under 35 U.S.C. 103 as being unpatentable over U.S. Patent Publication No. 2006/0143729 A1 Alexandrov & Brover (“AaB”) in view of Tucker et al.’s KX447407 (2016). As seen in the alignment below, SIN:7 was known in the prior art as the wheat Ms1 gene. Thus combining the embodiment of Tucker et al. with the teachings of Alexandrov & Brover is obvious. KX447407 LOCUS KX447407 304512 bp DNA linear PLN 02-OCT-2017 DEFINITION Triticum aestivum clone 4BS Ms1 gene, complete cds. ACCESSION KX447407 VERSION KX447407.1 KEYWORDS . SOURCE Triticum aestivum (bread wheat) ORGANISM Triticum aestivum Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum. REFERENCE 1 (bases 1 to 304512) AUTHORS Tucker,E.J., Baumann,U., Suchecki,R., Kouidri,A., Baes,M., Garcia,M., Okada,T., Dong,C., Wu,Y., Sandhu,A., Singh,M., Langridge,P., Wolters,P., Albertsen,M., Cigan,M. and Whitford,R. TITLE Molecular identification of Ms1 and its application for hybrid wheat breeding JOURNAL Unpublished REFERENCE 2 (bases 1 to 304512) AUTHORS Baumann,U., Suchecki,R. and Tucker,E.J. TITLE Direct Submission JOURNAL Submitted (20-JUN-2016) Australian Centre for Plant Functional Genomics, University of Adelaide, Hartley Grove, Glen Osmond, SA 5064, Australia COMMENT ##Assembly-Data-START## Assembly Method :: MIRA v. 4.0 Sequencing Technology :: Illumina ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..304512 /organism="Triticum aestivum" /mol_type="genomic DNA" /db_xref="taxon:4565" /clone="4BS" gap 39857..39956 /estimated_length=unknown CDS join(224963..225290,226360..226443,226568..226818) /codon_start=1 /product="Ms1" /protein_id="ASO65231.1" /translation="MERSRGLLLVAGLLAALLPAAAAQPGAPCEPALLATQVALFCAP DMPTAQCCEPVVAAVDLGGGVPCLCRVAAEPQLVMAGLNATHLLTLYSSCGGLRPGGA HLAAACEGPAPPAAVVSSPPPPPPPSAAPRRKQPAHDAPPPPPPSSEKPSSPPPSQDH DGAAPRAKAAPAQAATSTLAPAAAATAPPPQAPHSAAPTAPSKAAFFFVATAMLGLYI IL Query Match 100.0%; Score 4335; Length 304512; Best Local Similarity 100.0%; Matches 4335; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 AGACTTAAACCATTTAGTTACAAATATCGATGCACACCTTCGGTGGGGCGTTGTGAAAAA 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 223436 AGACTTAAACCATTTAGTTACAAATATCGATGCACACCTTCGGTGGGGCGTTGTGAAAAA 223495 Qy 61 GCATGTTTTTTGGGTCGACAAGCCCCTTTTGCAACGTATCCTCTTCTAATCCTATTCAGA 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 223496 GCATGTTTTTTGGGTCGACAAGCCCCTTTTGCAACGTATCCTCTTCTAATCCTATTCAGA 223555 Qy 121 TCATTAACATCATAAGCTGCAATTGACATGCTCTTCTGAGGATCAGGTTCATGCAATTAA 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 223556 TCATTAACATCATAAGCTGCAATTGACATGCTCTTCTGAGGATCAGGTTCATGCAATTAA 223615 Qy 181 ACATCATAAACTGCATCTTTGATGTCATCCTTTTCCTATATTTTTTCCAGATTATTGGCT 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 223616 ACATCATAAACTGCATCTTTGATGTCATCCTTTTCCTATATTTTTTCCAGATTATTGGCT 223675 Qy 241 TGCTTCGTTTTCAATATCAGGTTCTATGATTCGACTTCTGTTGTTGCCAGTAATAATTTG 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 223676 TGCTTCGTTTTCAATATCAGGTTCTATGATTCGACTTCTGTTGTTGCCAGTAATAATTTG 223735 Qy 301 TAGTTGCTGCGGAATATGAACTCAAGGAGAGCTGATGGTGCTATGAAGTTGATTTGATGG 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 223736 TAGTTGCTGCGGAATATGAACTCAAGGAGAGCTGATGGTGCTATGAAGTTGATTTGATGG 223795 Qy 361 GAGGTTGTTCTACACCTGCACTTGCTGCTCGACTTAAATACATGCCTTGGATTTCTTCCC 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 223796 GAGGTTGTTCTACACCTGCACTTGCTGCTCGACTTAAATACATGCCTTGGATTTCTTCCC 223855 Qy 421 AGCTCTAGTACATAATATTTTTCAAATTAATGTTCCACGACATAAAATTTAAATCCACAA 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 223856 AGCTCTAGTACATAATATTTTTCAAATTAATGTTCCACGACATAAAATTTAAATCCACAA 223915 Qy 481 ACATATTTTTAGTACATGAACAATTTTCTAATATAGGGCAAACATTTTTCATATACAAAC 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 223916 ACATATTTTTAGTACATGAACAATTTTCTAATATAGGGCAAACATTTTTCATATACAAAC 223975 Qy 541 CGATCATTTTAATATATGGTGAAAATCAGTGTAATATATGCTGAAATGTTTTCAAATACA 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 223976 CGATCATTTTAATATATGGTGAAAATCAGTGTAATATATGCTGAAATGTTTTCAAATACA 224035 Qy 601 TATTGAACATATTTATAATAAATGGTGAACATTTTTTTTAATAATTGATGACCATTTTTA 660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 224036 TATTGAACATATTTATAATAAATGGTGAACATTTTTTTTAATAATTGATGACCATTTTTA 224095 Qy 661 AAATGCATATTGAACATTTTATAATATACACTGTACAGTTTTATAATAATCGACGAACAT 720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 224096 AAATGCATATTGAACATTTTATAATATACACTGTACAGTTTTATAATAATCGACGAACAT 224155 Qy 721 CTTTTGGAGTTCTGAACATTTTTTTCAAAAACACAAGCCATTTTCCAGGAAGAATACAAA 780 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 224156 CTTTTGGAGTTCTGAACATTTTTTTCAAAAACACAAGCCATTTTCCAGGAAGAATACAAA 224215 Qy 781 TGCAAAAGAAATGAGATATCCAAAAAGCAAAAAAGAAAAACAAAACAAAACAGAGAAACC 840 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 224216 TGCAAAAGAAATGAGATATCCAAAAAGCAAAAAAGAAAAACAAAACAAAACAGAGAAACC 224275 Qy 841 TACAGGAAAATCCAAACAGAAAAGGCAAAGAAAGAACCCGAACTGGGCCAGGCAATGTTT 900 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 224276 TACAGGAAAATCCAAACAGAAAAGGCAAAGAAAGAACCCGAACTGGGCCAGGCAATGTTT 224335 Qy 901 CCAACGGCCTCGCTCTTCCTGAACAAGAAGGCCAGTCAGCCCATGGGCTGCTCCCAGTAC 960 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 224336 CCAACGGCCTCGCTCTTCCTGAACAAGAAGGCCAGTCAGCCCATGGGCTGCTCCCAGTAC 224395 Qy 961 TCGGGCCCCGCTGTGGCAGCACGCCATGTAATAGTTTTCGCGGGAATCCAACGCCGAAAT 1020 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 224396 TCGGGCCCCGCTGTGGCAGCACGCCATGTAATAGTTTTCGCGGGAATCCAACGCCGAAAT 224455 Qy 1021 CGCCCGCAGCGGGAACCCGACGTCGGTCTGGTGCGTTCTGGCGCCTTCCAGAACTCTCCA 1080 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 224456 CGCCCGCAGCGGGAACCCGACGTCGGTCTGGTGCGTTCTGGCGCCTTCCAGAACTCTCCA 224515 Qy 1081 CAGGCTCCCGCAGCCGTCCGATCAGATCAGCACGAAGCACGAACATTGGCGCGCGGCGAT 1140 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 224516 CAGGCTCCCGCAGCCGTCCGATCAGATCAGCACGAAGCACGAACATTGGCGCGCGGCGAT 224575 Qy 1141 ATTTTCTTTCCTCGCCCGACGACGGCCGCACTGCATTTCATTTTGAATTTCAAAATTCGG 1200 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 224576 ATTTTCTTTCCTCGCCCGACGACGGCCGCACTGCATTTCATTTTGAATTTCAAAATTCGG 224635 Qy 1201 AAACGGAAAAGCTTTCTCGCATCCCGAGGCGAGGCGGTTACGGGCGCCAGAGGGGCCACC 1260 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 224636 AAACGGAAAAGCTTTCTCGCATCCCGAGGCGAGGCGGTTACGGGCGCCAGAGGGGCCACC 224695 Qy 1261 CCACCCACCCACCCCCGCCCTCACGTGCCCCGCGCGGCCGCATCCGGGCCGTCCGCGCGG 1320 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 224696 CCACCCACCCACCCCCGCCCTCACGTGCCCCGCGCGGCCGCATCCGGGCCGTCCGCGCGG 224755 Qy 1321 ACAGCTGGCCGCGCCCAGCCCGAACCGACGCCCAGGATCGAGCGAGGGCGGCGCGCCCGG 1380 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 224756 ACAGCTGGCCGCGCCCAGCCCGAACCGACGCCCAGGATCGAGCGAGGGCGGCGCGCCCGG 224815 Qy 1381 GGCTTGGCTTAGCGTCCACGCCACCTCCGGCTATATAAGCCGCCCCACACCCGCTCCCCC 1440 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 224816 GGCTTGGCTTAGCGTCCACGCCACCTCCGGCTATATAAGCCGCCCCACACCCGCTCCCCC 224875 Qy 1441 TCCGGCATTCCATTCCGCCACCGCACCACCACCACCACCAAACCCTAGCGAGCGAGCGAG 1500 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 224876 TCCGGCATTCCATTCCGCCACCGCACCACCACCACCACCAAACCCTAGCGAGCGAGCGAG 224935 Qy 1501 GGAGAGAGAGACCGCCCCGCCGCGACGATGGAGAGATCCCGCGGGCTGCTGCTGGTGGCG 1560 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 224936 GGAGAGAGAGACCGCCCCGCCGCGACGATGGAGAGATCCCGCGGGCTGCTGCTGGTGGCG 224995 Qy 1561 GGGCTGCTGGCGGCGCTGCTGCCGGCGGCGGCGGCGCAGCCGGGGGCGCCGTGCGAGCCC 1620 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 224996 GGGCTGCTGGCGGCGCTGCTGCCGGCGGCGGCGGCGCAGCCGGGGGCGCCGTGCGAGCCC 225055 Qy 1621 GCGCTGCTGGCGACGCAGGTGGCGCTCTTCTGCGCGCCCGACATGCCGACGGCCCAGTGC 1680 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 225056 GCGCTGCTGGCGACGCAGGTGGCGCTCTTCTGCGCGCCCGACATGCCGACGGCCCAGTGC 225115 Qy 1681 TGCGAGCCCGTCGTCGCCGCCGTCGACCTCGGCGGCGGGGTGCCCTGCCTCTGCCGCGTC 1740 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 225116 TGCGAGCCCGTCGTCGCCGCCGTCGACCTCGGCGGCGGGGTGCCCTGCCTCTGCCGCGTC 225175 Qy 1741 GCCGCCGAGCCGCAGCTCGTCATGGCGGGCCTCAACGCCACCCACCTCCTCACGCTCTAC 1800 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 225176 GCCGCCGAGCCGCAGCTCGTCATGGCGGGCCTCAACGCCACCCACCTCCTCACGCTCTAC 225235 Qy 1801 AGCTCCTGCGGCGGCCTCCGCCCCGGCGGCGCCCACCTCGCCGCCGCCTGCGAAGGTACG 1860 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 225236 AGCTCCTGCGGCGGCCTCCGCCCCGGCGGCGCCCACCTCGCCGCCGCCTGCGAAGGTACG 225295 Qy 1861 TTGTCCGCCTCCTCCCCTCCCTCCCTCCCTCCCTCTCTCTCTACGTGCTCGCTTTCCTGC 1920 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 225296 TTGTCCGCCTCCTCCCCTCCCTCCCTCCCTCCCTCTCTCTCTACGTGCTCGCTTTCCTGC 225355 Qy 1921 TTACCTAGTAGTACGTAGTTTCCCATGCCTTCTTGACTCGCTAGAAGTGCTCCGGTTTGG 1980 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 225356 TTACCTAGTAGTACGTAGTTTCCCATGCCTTCTTGACTCGCTAGAAGTGCTCCGGTTTGG 225415 Qy 1981 GTCTGTTAATTTCCTCGCTGTACTACCGGATCTGTCGTCGGCACGGCGCGCGGCGTCGGG 2040 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 225416 GTCTGTTAATTTCCTCGCTGTACTACCGGATCTGTCGTCGGCACGGCGCGCGGCGTCGGG 225475 Qy 2041 TCCTCGCCTTCTCCCGTGGCGACCGACCTGCGCAGCGCGCGCGCGGCCTAGCTAGCTTCA 2100 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 225476 TCCTCGCCTTCTCCCGTGGCGACCGACCTGCGCAGCGCGCGCGCGGCCTAGCTAGCTTCA 225535 Qy 2101 TACCGCTGTACCTCGACATACACGGAGCGATCTATGGTCTACTCTGAGTATTTCCTCATC 2160 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 225536 TACCGCTGTACCTCGACATACACGGAGCGATCTATGGTCTACTCTGAGTATTTCCTCATC 225595 Qy 2161 GTAGAACGCATGCGCCGCTCGCGATTGTTTCGTCGATTCTAGATCCGTGCTTGTTCCCGC 2220 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 225596 GTAGAACGCATGCGCCGCTCGCGATTGTTTCGTCGATTCTAGATCCGTGCTTGTTCCCGC 225655 Qy 2221 GAGTTAGTATGCATCTGCGTGCATATGCCGTACGCACGCAGATGCAGAGTCTGTTGCTCG 2280 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 225656 GAGTTAGTATGCATCTGCGTGCATATGCCGTACGCACGCAGATGCAGAGTCTGTTGCTCG 225715 Qy 2281 AGTTATCTACTGTCGTTCGCTCGACCATATTTGCCTGTTAATTTCCTGTTCATCGTGCAT 2340 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 225716 AGTTATCTACTGTCGTTCGCTCGACCATATTTGCCTGTTAATTTCCTGTTCATCGTGCAT 225775 Qy 2341 GCAGTAGTAGTAGCCATGTCCACGCCTTCTTGTTTTGAGGCGATCATCGTCGAGATCCAT 2400 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 225776 GCAGTAGTAGTAGCCATGTCCACGCCTTCTTGTTTTGAGGCGATCATCGTCGAGATCCAT 225835 Qy 2401 GGCTTTGCTTTCTGCACTATCTTCTGCCTTGTTTTGTTCTCCGCAGTACGTACGTCTTGC 2460 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 225836 GGCTTTGCTTTCTGCACTATCTTCTGCCTTGTTTTGTTCTCCGCAGTACGTACGTCTTGC 225895 Qy 2461 TTGGTCAAAACTGAAAAACGCTTTGCTGTTTGTTTGATCGGCAAGAGCTGGCCGTGCTTT 2520 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 225896 TTGGTCAAAACTGAAAAACGCTTTGCTGTTTGTTTGATCGGCAAGAGCTGGCCGTGCTTT 225955 Qy 2521 TGGCACCGCAGTGCGTCGCCTCTGCCGCTTTTGCGAAACATTTCCATGTTGATCCTCTGG 2580 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 225956 TGGCACCGCAGTGCGTCGCCTCTGCCGCTTTTGCGAAACATTTCCATGTTGATCCTCTGG 226015 Qy 2581 CGGAACTACTTTTTCGCGTGCGGTTTGCGTGGCCTTCCTCTCTCGTGAAAAGAGGTCGGG 2640 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 226016 CGGAACTACTTTTTCGCGTGCGGTTTGCGTGGCCTTCCTCTCTCGTGAAAAGAGGTCGGG 226075 Qy 2641 TCAAACCAAATGGATCGCCTCTTGGCAGAGCAGCGGCAGCAGATAGCTGGCCGTCTCGCA 2700 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 226076 TCAAACCAAATGGATCGCCTCTTGGCAGAGCAGCGGCAGCAGATAGCTGGCCGTCTCGCA 226135 Qy 2701 GCTTTGGCAGAACCGGTCTGTGGCCATCTGTCGCCGCCTGCCACCGTTTCCCTGATGTTT 2760 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 226136 GCTTTGGCAGAACCGGTCTGTGGCCATCTGTCGCCGCCTGCCACCGTTTCCCTGATGTTT 226195 Qy 2761 GTTTCTCTCTCGCCTGCCACTGTTTCTTTTCTTGTTGCGCACGTACGTCGTCACCTCCTC 2820 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 226196 GTTTCTCTCTCGCCTGCCACTGTTTCTTTTCTTGTTGCGCACGTACGTCGTCACCTCCTC 226255 Qy 2821 CTACTTTTTTGCCAGTTTTGTTTACTTTTGATGAAATATACGGATGAATCGGCTGGTGAT 2880 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 226256 CTACTTTTTTGCCAGTTTTGTTTACTTTTGATGAAATATACGGATGAATCGGCTGGTGAT 226315 Qy 2881 TAACTTTGGCTGCTGCTGTTAATTACTGTGGATTTTGGATGCAGGACCCGCTCCCCCGGC 2940 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 226316 TAACTTTGGCTGCTGCTGTTAATTACTGTGGATTTTGGATGCAGGACCCGCTCCCCCGGC 226375 Qy 2941 CGCCGTCGTCAGCAGCCCCCCGCCCCCGCCTCCACCGTCCGCCGCACCTCGCCGCAAGCA 3000 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 226376 CGCCGTCGTCAGCAGCCCCCCGCCCCCGCCTCCACCGTCCGCCGCACCTCGCCGCAAGCA 226435 Qy 3001 GCCAGCGCGTAAGAACCTCTCCCTCTCCCTCTCTCTCTCCCTCTCGCCTGCATCTCGCTA 3060 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 226436 GCCAGCGCGTAAGAACCTCTCCCTCTCCCTCTCTCTCTCCCTCTCGCCTGCATCTCGCTA 226495 Qy 3061 TGTTTATCCATGTCCATATGTTGATCAGCCTTGTTTAGTTACTAACATGTGCACCGGATC 3120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 226496 TGTTTATCCATGTCCATATGTTGATCAGCCTTGTTTAGTTACTAACATGTGCACCGGATC 226555 Qy 3121 GGGTTCTCGCAGACGACGCACCACCGCCGCCACCGCCGTCGAGCGAGAAGCCGTCGTCCC 3180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 226556 GGGTTCTCGCAGACGACGCACCACCGCCGCCACCGCCGTCGAGCGAGAAGCCGTCGTCCC 226615 Qy 3181 CGCCGCCGTCCCAGGACCACGACGGCGCCGCCCCCCGCGCCAAGGCCGCGCCCGCCCAGG 3240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 226616 CGCCGCCGTCCCAGGACCACGACGGCGCCGCCCCCCGCGCCAAGGCCGCGCCCGCCCAGG 226675 Qy 3241 CGGCCACCTCCACGCTCGCGCCCGCCGCCGCCGCCACCGCCCCGCCGCCCCAGGCGCCGC 3300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 226676 CGGCCACCTCCACGCTCGCGCCCGCCGCCGCCGCCACCGCCCCGCCGCCCCAGGCGCCGC 226735 Qy 3301 ACTCCGCCGCGCCCACGGCGCCGTCCAAGGCGGCCTTCTTCTTCGTCGCCACGGCCATGC 3360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 226736 ACTCCGCCGCGCCCACGGCGCCGTCCAAGGCGGCCTTCTTCTTCGTCGCCACGGCCATGC 226795 Qy 3361 TCGGCCTCTACATCATCCTCTGAGTCGCGCGCCGACCCCGCGAGAGACCGTGGTCCGTCC 3420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 226796 TCGGCCTCTACATCATCCTCTGAGTCGCGCGCCGACCCCGCGAGAGACCGTGGTCCGTCC 226855 Qy 3421 AGTCGCAGTAGAGTAGAGCGCTCGTCGTCTCGTTCCGTTTCGTGCCTGTCGCCGTTCGAG 3480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 226856 AGTCGCAGTAGAGTAGAGCGCTCGTCGTCTCGTTCCGTTTCGTGCCTGTCGCCGTTCGAG 226915 Qy 3481 GTTCGTTTCTGCGTGCAGTCCGGTCGAAGAAGCCGGTGGGTTTTGAGTACTAGTGGTAGT 3540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 226916 GTTCGTTTCTGCGTGCAGTCCGGTCGAAGAAGCCGGTGGGTTTTGAGTACTAGTGGTAGT 226975 Qy 3541 AGTAGCAGCAGCTATCGTTTCTGTCCGCTCGTACGTGTTTGCGTGGTCGCGGAGAACAAT 3600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 226976 AGTAGCAGCAGCTATCGTTTCTGTCCGCTCGTACGTGTTTGCGTGGTCGCGGAGAACAAT 227035 Qy 3601 TAATTGGGTGTTTGCGAGTCCTCTGGTTAAGATGAACCACTGATGCTATGTGATCGATCG 3660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 227036 TAATTGGGTGTTTGCGAGTCCTCTGGTTAAGATGAACCACTGATGCTATGTGATCGATCG 227095 Qy 3661 ATCGGTATGATCTGAATGGAAATGGATCAAGTTTTGCGTTCTGCTGATGATGTGATCCAT 3720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 227096 ATCGGTATGATCTGAATGGAAATGGATCAAGTTTTGCGTTCTGCTGATGATGTGATCCAT 227155 Qy 3721 TTGGATCTGTGTGGGGCAACAGTTTCGCTTGCTTTTGCTCTGCGATGAACGAATGCTTCT 3780 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 227156 TTGGATCTGTGTGGGGCAACAGTTTCGCTTGCTTTTGCTCTGCGATGAACGAATGCTTCT 227215 Qy 3781 TGCATGCATCTTGTCTTTGCTTAATTTGAACTGTAGAACGGATGCAGTACTGATTTCTGC 3840 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 227216 TGCATGCATCTTGTCTTTGCTTAATTTGAACTGTAGAACGGATGCAGTACTGATTTCTGC 227275 Qy 3841 TTATGATGTGACGATTCGTCGTACGCATATCATCTCTTCAAATTTGTGTAGCAGCTGTTT 3900 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 227276 TTATGATGTGACGATTCGTCGTACGCATATCATCTCTTCAAATTTGTGTAGCAGCTGTTT 227335 Qy 3901 GTAGCTTCCATTCTGCTATGGACGAATGCCTGTTTTTCACGGAGAACCGCGCGCGGGGAC 3960 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 227336 GTAGCTTCCATTCTGCTATGGACGAATGCCTGTTTTTCACGGAGAACCGCGCGCGGGGAC 227395 Qy 3961 CGATGCGGCTTTGTGTTGCCATGTTGTTTTCCACGCCAGGACAAAATAGATGGTGCGGTT 4020 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 227396 CGATGCGGCTTTGTGTTGCCATGTTGTTTTCCACGCCAGGACAAAATAGATGGTGCGGTT 227455 Qy 4021 TTGATCCCCAATCCCACCATCACCATGTTCCGGAGAGCCACATGGAACTCACGTCAAGCG 4080 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 227456 TTGATCCCCAATCCCACCATCACCATGTTCCGGAGAGCCACATGGAACTCACGTCAAGCG 227515 Qy 4081 GTCACTTTTTGCAGAATCACTCTTACCATTTTACCCTTTTGTTGAAACCTCTCTCCTCAT 4140 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 227516 GTCACTTTTTGCAGAATCACTCTTACCATTTTACCCTTTTGTTGAAACCTCTCTCCTCAT 227575 Qy 4141 CCCCAAAAGTTGATGCAACAGTGCTATGCGCGCCCACCCATGCTTTTTCATATGATTGTA 4200 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 227576 CCCCAAAAGTTGATGCAACAGTGCTATGCGCGCCCACCCATGCTTTTTCATATGATTGTA 227635 Qy 4201 AAATTTGGATCGATTTTATCTTTTGAACCCTAAGTCCGGTTTACAATCTGTTTGCATGTT 4260 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 227636 AAATTTGGATCGATTTTATCTTTTGAACCCTAAGTCCGGTTTACAATCTGTTTGCATGTT 227695 Qy 4261 TATGTTCCTTGCGGCGAGGACCATTAAACAAGACTACTATTGGATATATTTCGACAGGCT 4320 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 227696 TATGTTCCTTGCGGCGAGGACCATTAAACAAGACTACTATTGGATATATTTCGACAGGCT 227755 Qy 4321 TTGAAATCCGAATTC 4335 ||||||||||||||| Db 227756 TTGAAATCCGAATTC 227770 Conclusion No claim is allowed. Any inquiry concerning this communication or earlier communications from the examiner should be directed to RUSSELL T BOGGS whose telephone number is (571)272-2805. The examiner can normally be reached Monday - Friday, 0800 to 1830 Mtn. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Amjad Abraham can be reached at 571-270-0708. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /RUSSELL T BOGGS/Examiner, Art Unit 1663
Read full office action

Prosecution Timeline

Jul 31, 2023
Application Filed
Apr 09, 2026
Non-Final Rejection mailed — §103, §112 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12662684
ENHANCING THE EFFECTIVENESS OF BLENDED REFUGE
4y 8m to grant Granted Jun 23, 2026
Patent 12653127
PLANTS AND SEEDS OF CORN VARIETY CV621819
2y 6m to grant Granted Jun 16, 2026
Patent 12642237
SOYBEAN CULTIVAR 20142104
2y 3m to grant Granted Jun 02, 2026
Patent 12635628
PLANTS AND SEEDS OF HYBRID CORN VARIETY CH010499
2y 5m to grant Granted May 26, 2026
Patent 12635629
CANOLA HYBRID 18GM0769N
2y 6m to grant Granted May 26, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

Strategy Recommendation AI-generated — please review before filing

Get a prosecution strategy drawn from examiner precedents, rejection analysis, and claim mapping.
Typically takes 5-10 seconds — AI-generated, attorney review required before filing

Prosecution Projections

1-2
Expected OA Rounds
73%
Grant Probability
88%
With Interview (+15.3%)
2y 10m (~0m remaining)
Median Time to Grant
Low
PTA Risk
Based on 664 resolved cases by this examiner. Grant probability derived from career allowance rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month