Prosecution Insights
Last updated: April 19, 2026
Application No. 18/407,958

Extreme Polyvalency Induces Potent Cross-Clade Cellular and Humoral Responses in Rabbits and Non-human Primates

Non-Final OA §102§103§112§DP
Filed
Jan 09, 2024
Examiner
LI, BAO Q
Art Unit
1671
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
The Wistar Institute
OA Round
3 (Non-Final)
76%
Grant Probability
Favorable
3-4
OA Rounds
2y 11m
To Grant
99%
With Interview

Examiner Intelligence

Grants 76% — above average
76%
Career Allow Rate
676 granted / 891 resolved
+15.9% vs TC avg
Strong +26% interview lift
Without
With
+26.5%
Interview Lift
resolved cases with interview
Typical timeline
2y 11m
Avg Prosecution
29 currently pending
Career history
920
Total Applications
across all art units

Statute-Specific Performance

§101
4.2%
-35.8% vs TC avg
§103
19.3%
-20.7% vs TC avg
§102
27.7%
-12.3% vs TC avg
§112
28.0%
-12.0% vs TC avg
Black line = Tech Center average estimate • Based on career data from 891 resolved cases

Office Action

§102 §103 §112 §DP
DETAILED ACTION Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . RCE The request filed on 3/30/2026 for a request for continued examination (RCE) under 37 CFR 1.114 (d) is acceptable and a RCE has been established. An action on the RCE follows. Status of claims Claims 1-22 are pending. Claims 1-10 are considered withing the elected species of SEQ ID NOS: 35-36. Claims 11-20 are withdrawn from consideration. Terminal Disclaimer The Terminal Disclaimers The Terminal Disclaimers filed on 3/30/2026 has been acknowledged and accepted. Double Patenting The rejection of Claim 1-10 on the ground of nonstatutory double patenting as being unpatentable over claims 9 and 12 of U.S. Patent No. 10, 828,363 has been removed because the terminal Disclaimer has been filed and accepted, The rejection is removed.. The rejection Claim 1-10 on the ground of nonstatutory double patenting as being unpatentable over claims 9 and 12 of U.S. Patent No. 11, 883, 484 because the terminal Disclaimer has been filed and accepted, The rejection is removed.. Examiner’s note: It is noted that the nucleic acid sequence of SEQC ID NO: 35 encodes the amino acid sequence of SEQ ID NO; 36. Hence the claimed composition comprising more than two nucleic acid sequences can be considered more than two same kinds of nucleic acid sequences in same or different length. The citation of optional mean something can be available to be choses but it not mandatory or required in the claimed nucleic acid sequence. New ground of objection and rejections: Claim Objections Claim 1 is objected to because of the following informalities: please correct the typographic error of “like to” as link to. Appropriate correction is required. Claim Rejections - 35 USC § 112 The following is a quotation of 35 U.S.C. 112(b): (b) CONCLUSION.—The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the inventor or a joint inventor regards as the invention. The following is a quotation of 35 U.S.C. 112 (pre-AIA ), second paragraph: The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the applicant regards as his invention. Claim 1 is rejected under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter which the inventor or a joint inventor (or for applications subject to pre-AIA 35 U.S.C. 112, the applicant), regards as the invention. Claim 1 is vague and indefinite because it is confusing and unclear how the claimed nucleic acid sequence is optionally like to a nucleic acid sequence encoding an IgE signal peptide? Claim Rejections - 35 USC § 102 The following is a quotation of the appropriate paragraphs of 35 U.S.C. 102 that form the basis for the rejections under this section made in this Office action: A person shall be entitled to a patent unless – (a)(1) the claimed invention was patented, described in a printed publication, or in public use, on sale, or otherwise available to the public before the effective filing date of the claimed invention. Claim Rejections - 35 USC § 103 The following is a quotation of 35 U.S.C. 103 which forms the basis for all obviousness rejections set forth in this Office action: A patent for a claimed invention may not be obtained, notwithstanding that the claimed invention is not identically disclosed as set forth in section 102, if the differences between the claimed invention and the prior art are such that the claimed invention as a whole would have been obvious before the effective filing date of the claimed invention to a person having ordinary skill in the art to which the claimed invention pertains. Patentability shall not be negated by the manner in which the invention was made. Claims 1-8 and 10 are rejected under 35 U.S.C. 102(a) (2) as anticipated by or, in the alternative, under 35 U.S.C. 103 as obvious over US Patent No. 10,953,108 to Ertl et al. and further in view of Yan et al. (Vaccine 2011, Vol. 29, pp. 7173-7181). Claims 1-8 are directed to A composition comprising two or more nucleic acid molecules encoding an HIV immunogen, wherein each nucleic acid molecule comprises a sequence independently selected from the group consisting of: a nucleic acid sequence encoding protein or fragment thereof to a sequence with at least 90% homology to SEQ ID NO: 36 or a nucleic acid sequence with at least 90% homology to SEQ ID NO: 35, wherein the nucleic acid sequence is “optional” linked a nucleic acid sequence encoding an IgE sequence. Ertl et al. disclose a nucleotide (FIGS. 24A-24H) and amino acid sequences (FIGS. 24I-43K) encoded by the nucleic acid encoding the same,, wherein the nucleic acid sequence can be carried or expressed by an expression vector , wherein the expression vector can be a carrier AdC6 vector expressing gp160, construct DU172 (SEQ ID NOs: 5 and 13 respectively) or the amino acid sequence of SEQ ID NOS: 13 and 15) see FIGS. 26A-26K are a list of the nucleotide (FIGS. 26A-26H) and amino acid (FIGS. 26I-26K) sequences of the AdC7 vector expressed gp160, construct DU172 . Prior to the HIV antigen is expressed by the adenovirus vector, they are (See FIGS. 19A-19C) are carried by Shuttle plasmids containing gp140 (DU172 and DU422). In addition, Ertl et al. also teach that the composition of the “nucleic acid molecule’ carried by any expression vector“ is operably linked” sequences include both expression control sequences that are contiguous with the gene of interest and expression control sequences that act in trans or at a distance to control the gene of interest. Expression control sequences include appropriate transcription initiation, termination, promoter and enhancer sequences; efficient RNA processing signals such as splicing and polyadenylation (polyA) signals; sequences that stabilize cytoplasmic mRNA; sequences that enhance translation efficiency (i.e., Kozak consensus sequence); sequences that enhance protein stability; and when desired, sequences that enhance secretion of the encoded product. There are numerous expression control sequences, including promoters which are native, constitutive, inducible and/or tissue-specific, are known in the art that may be used in the compositions of the invention. “Operably linked” should be construed to include RNA expression and control sequences in addition to DNA expression and control sequences. Ertl et al. also teach in one embodiment , the immunogenic composition further comprising an adjuvant (Column 19-column 40). (Please see the SEQ ID NO: 15 and 13 homology alignment Query Match 100.0%; Score 4574; Length 11142; Best Local Similarity 100.0%; Matches 860; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MRVMGILRSYQQWWIWGILGFWMLMICNVWGNLWVTVYYGVPVWKEAKTTLFCASDAKAH 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 404 MRVMGILRSYQQWWIWGILGFWMLMICNVWGNLWVTVYYGVPVWKEAKTTLFCASDAKAH 463 Qy 61 KEEVHNIWATHACVPTDPNPQEIVLKNVTENFNMWKNDMVDQMHEDIISLWDQSLKPCVK 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 464 KEEVHNIWATHACVPTDPNPQEIVLKNVTENFNMWKNDMVDQMHEDIISLWDQSLKPCVK 523 Qy 121 LTPLCVTLNCSDVKIKGTNATYNNATYNNNNTISDMKNCSFNTTTEITDKKKKEYALFYK 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 524 LTPLCVTLNCSDVKIKGTNATYNNATYNNNNTISDMKNCSFNTTTEITDKKKKEYALFYK 583 Qy 181 LDVVALDGKETNSTNSSEYRLINCNTSAVTQACPKVSFDPIPIHYCAPAGYAILKCNNKT 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 584 LDVVALDGKETNSTNSSEYRLINCNTSAVTQACPKVSFDPIPIHYCAPAGYAILKCNNKT 643 Qy 241 FNGTGPCNNVSTVQCTHGIKPVVSTQLLLNGSLAEEEVVIRFENLTNNAKIIIVHLNESV 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 644 FNGTGPCNNVSTVQCTHGIKPVVSTQLLLNGSLAEEEVVIRFENLTNNAKIIIVHLNESV 703 Qy 301 EINCTRPSNNTRKSVRIGPGQTFFATGDIIGDIRQAHCNISRKKWNTTLQRVKEKLKEKF 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 704 EINCTRPSNNTRKSVRIGPGQTFFATGDIIGDIRQAHCNISRKKWNTTLQRVKEKLKEKF 763 Qy 361 PNKTIQFAPSSGGDLEITTHSFNCRGEFFYCYTSDLFNSTYMSNNTGGANITLQCRIKQI 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 764 PNKTIQFAPSSGGDLEITTHSFNCRGEFFYCYTSDLFNSTYMSNNTGGANITLQCRIKQI 823 Qy 421 IRMWQGVGQAMYAPPIAGNITCKSNITGLLLTRDGGKEKNDTETFRPGGGDMRDNWRSEL 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 824 IRMWQGVGQAMYAPPIAGNITCKSNITGLLLTRDGGKEKNDTETFRPGGGDMRDNWRSEL 883 Qy 481 YKYKVVEIKPLGIAPDKAKRRVVEREKRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARQ 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 884 YKYKVVEIKPLGIAPDKAKRRVVEREKRAVGIGAVFLGFLGAAGSTMGAASMTLTVQARQ 943 Qy 541 LLSGIVQQQSNLLRAIEAQQHMLQLTVWGIKQLQTRVLAIERYLKDQQLLGIWGCSGKLI 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 944 LLSGIVQQQSNLLRAIEAQQHMLQLTVWGIKQLQTRVLAIERYLKDQQLLGIWGCSGKLI 1003 Qy 601 CTTAVPWNASWSNKSYEEIWGNMTWMQWDREINNYTNTIYSLLEESQNQQEKNEKDLLAL 660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1004 CTTAVPWNASWSNKSYEEIWGNMTWMQWDREINNYTNTIYSLLEESQNQQEKNEKDLLAL 1063 Qy 661 DSWESLWSWFNITNWLWYIRIFIIIVGGLIGLRIIFAVLSIVNRVRQGYSPLSFQTLTPS 720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1064 DSWESLWSWFNITNWLWYIRIFIIIVGGLIGLRIIFAVLSIVNRVRQGYSPLSFQTLTPS 1123 Qy 721 PREPDRLGRIEEEGGEQDRARSVRLVNGFLALAWEDLRSLCLFSYHRLRDLILIAARAAA 780 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1124 PREPDRLGRIEEEGGEQDRARSVRLVNGFLALAWEDLRSLCLFSYHRLRDLILIAARAAA 1183 Qy 781 LLGRSSLWGLQKGWEALKYLGSLVQYWGLELKKSAISLFDAIA ITVAEGTDRIINIVQRI 840 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1184 LLGRSSLWGLQKGWEALKYLGSLVQYWGLELKKSAISLFDAIA ITVAEGTDRIINIVQRI 1243 Qy 841 SRAFYNIPRRIRQGFEATLQ 860 |||||||||||||||||||| Db 1244 SRAFYNIPRRIRQGFEATLQ 1263 Or Qy 1 ATGAGAGTGATGGGGATTCTGAGGTCCTATCAGCAGTGGTGGATCTGGGGGATTCTGGGA 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 404 MetArgValMetGlyIleLeuArgSerTyrGlnGlnTrpTrpIleTrpGlyIleLeuGly 423 Qy 61 TTCTGGATGCTGATGATTTGTAATGTCTGGGGCAACCTGTGGGTGACCGTCTACTATGGG 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 424 PheTrpMetLeuMetIleCysAsnValTrpGlyAsnLeuTrpValThrValTyrTyrGly 443 Qy 121 GTGCCTGTCTGGAAGGAGGCCAAAACCACACTGTTCTGCGCTTCCGACGCCAAGGCTCAT 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 444 ValProValTrpLysGluAlaLysThrThrLeuPheCysAlaSerAspAlaLysAlaHis 463 Qy 181 AAAGAGGAAGTCCATAACATCTGGGCAACACACGCCTGTGTGCCAACTGATCCAAACCCC 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 464 LysGluGluValHisAsnIleTrpAlaThrHisAlaCysValProThrAspProAsnPro 483 Qy 241 CAGGAGATTGTGCTGAAGAATGTCACCGAAAACTTCAACATGTGGAAGAACGACATGGTG 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 484 GlnGluIleValLeuLysAsnValThrGluAsnPheAsnMetTrpLysAsnAspMetVal 503 Qy 301 GATCAGATGCATGAGGACATCATTTCTCTGTGGGATCAGAGTCTGAAGCCTTGCGTGAAA 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 504 AspGlnMetHisGluAspIleIleSerLeuTrpAspGlnSerLeuLysProCysValLys 523 Qy 361 CTGACACCACTGTGCGTCACTCTGAACTGTTCTGACGTGAAGATCAAAGGCACAAATGCC 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 524 LeuThrProLeuCysValThrLeuAsnCysSerAspValLysIleLysGlyThrAsnAla 543 Qy 421 ACTTACAACAACGCTACCTACAACAACAACAACACAATCAGTGACATGAAGAACTGTTCA 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 544 ThrTyrAsnAsnAlaThrTyrAsnAsnAsnAsnThrIleSerAspMetLysAsnCysSer 563 Qy 481 TTCAATACTACCACAGAGATCACCGATAAGAAAAAGAAAGAATACGCACTGTTTTATAAG 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 564 PheAsnThrThrThrGluIleThrAspLysLysLysLysGluTyrAlaLeuPheTyrLys 583 Qy 541 CTGGACGTGGTCGCCCTGGATGGAAAAGAGACCAACAGCACAAATAGCTCCGAATACCGG 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 584 LeuAspValValAlaLeuAspGlyLysGluThrAsnSerThrAsnSerSerGluTyrArg 603 Qy 601 CTGATCAACTGCAATACTAGTGCAGTCACCCAGGCCTGTCCCAAGGTGTCATTCGATCCT 660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 604 LeuIleAsnCysAsnThrSerAlaValThrGlnAlaCysProLysValSerPheAspPro 623 Qy 661 ATCCCAATTCACTACTGCGCACCTGCCGGCTATGCCATCCTGAAGTGTAACAACAAGACC 720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 624 IleProIleHisTyrCysAlaProAlaGlyTyrAlaIleLeuLysCysAsnAsnLysThr 643 Qy 721 TTCAACGGGACTGGACCATGCAACAATGTGAGCACCGTCCAGTGTACACATGGGATCAAG 780 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 644 PheAsnGlyThrGlyProCysAsnAsnValSerThrValGlnCysThrHisGlyIleLys 663 Qy 781 CCCGTGGTCTCCACCCAGCTGCTGCTGAACGGATCTCTGGCTGAGGAAGAGGTGGTCATT 840 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 664 ProValValSerThrGlnLeuLeuLeuAsnGlySerLeuAlaGluGluGluValValIle 683 Qy 841 AGGTTCGAGAATCTGACAAACAATGCCAAGATCATTATCGTGCACCTGAACGAGTCCGTC 900 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 684 ArgPheGluAsnLeuThrAsnAsnAlaLysIleIleIleValHisLeuAsnGluSerVal 703 Qy 901 GAAATCAATTGCACTCGCCCAAGCAACAATACCAGAAAATCCGTGAGGATTGGCCCCGGG 960 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 704 GluIleAsnCysThrArgProSerAsnAsnThrArgLysSerValArgIleGlyProGly 723 Qy 961 CAGACTTTCTTTGCTACCGGCGACATTATCGGGGATATCAGACAGGCACATTGTAACATT 1020 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 724 GlnThrPhePheAlaThrGlyAspIleIleGlyAspIleArgGlnAlaHisCysAsnIle 743 Qy 1021 TCTAGGAAGAAATGGAACACTACCCTGCAGCGGGTGAAGGAGAAACTGAAGGAAAAATTC 1080 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 744 SerArgLysLysTrpAsnThrThrLeuGlnArgValLysGluLysLeuLysGluLysPhe 763 Qy 1081 CCCAACAAGACTATCCAGTTTGCCCCTTCTAGTGGCGGGGACCTGGAGATTACAACTCAC 1140 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 764 ProAsnLysThrIleGlnPheAlaProSerSerGlyGlyAspLeuGluIleThrThrHis 783 Qy 1141 AGCTTCAATTGCAGAGGCGAATTCTTTTACTGTTATACATCCGATCTGTTTAACAGCACA 1200 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 784 SerPheAsnCysArgGlyGluPhePheTyrCysTyrThrSerAspLeuPheAsnSerThr 803 Qy 1201 TACATGTCCAACAATACTGGAGGCGCTAATATCACCCTGCAGTGCCGGATTAAGCAGATT 1260 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 804 TyrMetSerAsnAsnThrGlyGlyAlaAsnIleThrLeuGlnCysArgIleLysGlnIle 823 Qy 1261 ATCAGAATGTGGCAGGGAGTGGGCCAGGCTATGTATGCACCCCCTATCGCCGGAAACATT 1320 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 824 IleArgMetTrpGlnGlyValGlyGlnAlaMetTyrAlaProProIleAlaGlyAsnIle 843 Qy 1321 ACCTGTAAATCCAATATCACCGGACTGCTGCTGACACGCGACGGAGGAAAGGAGAAAAAC 1380 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 844 ThrCysLysSerAsnIleThrGlyLeuLeuLeuThrArgAspGlyGlyLysGluLysAsn 863 Qy 1381 GATACTGAAACCTTTCGACCAGGAGGAGGAGACATGCGAGATAATTGGCGATCTGAGCTG 1440 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 864 AspThrGluThrPheArgProGlyGlyGlyAspMetArgAspAsnTrpArgSerGluLeu 883 Qy 1441 TACAAGTATAAAGTGGTCGAAATCAAGCCACTGGGCATTGCTCCCGACAAGGCAAAACGG 1500 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 884 TyrLysTyrLysValValGluIleLysProLeuGlyIleAlaProAspLysAlaLysArg 903 Qy 1501 AGAGTGGTCGAGCGGGAAAAAAGAGCAGTGGGGATCGGAGCCGTCTTCCTGGGCTTTCTG 1560 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 904 ArgValValGluArgGluLysArgAlaValGlyIleGlyAlaValPheLeuGlyPheLeu 923 Qy 1561 GGAGCAGCTGGATCTACCATGGGAGCAGCCAGTATGACACTGACTGTGCAGGCCAGGCAG 1620 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 924 GlyAlaAlaGlySerThrMetGlyAlaAlaSerMetThrLeuThrValGlnAlaArgGln 943 Qy 1621 CTGCTGTCAGGGATCGTGCAGCAGCAGAGCAACCTGCTGCGCGCCATTGAGGCTCAGCAG 1680 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 944 LeuLeuSerGlyIleValGlnGlnGlnSerAsnLeuLeuArgAlaIleGluAlaGlnGln 963 Qy 1681 CATATGCTGCAGCTGACAGTGTGGGGGATCAAGCAGCTGCAGACTAGGGTGCTGGCCATT 1740 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 964 HisMetLeuGlnLeuThrValTrpGlyIleLysGlnLeuGlnThrArgValLeuAlaIle 983 Qy 1741 GAACGCTACCTGAAGGACCAGCAGCTGCTGGGCATCTGGGGGTGCTCTGGAAAACTGATT 1800 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 984 GluArgTyrLeuLysAspGlnGlnLeuLeuGlyIleTrpGlyCysSerGlyLysLeuIle 1003 Qy 1801 TGTACCACAGCTGTGCCTTGGAACGCATCCTGGTCTAATAAGAGTTATGAAGAGATCTGG 1860 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1004 CysThrThrAlaValProTrpAsnAlaSerTrpSerAsnLysSerTyrGluGluIleTrp 1023 Qy 1861 GGCAACATGACCTGGATGCAGTGGGATAGGGAGATCAACAATTACACCAATACAATCTAC 1920 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1024 GlyAsnMetThrTrpMetGlnTrpAspArgGluIleAsnAsnTyrThrAsnThrIleTyr 1043 Qy 1921 TCACTGCTGGAAGAGAGCCAGAACCAGCAGGAGAAGAATGAAAAAGACCTGCTGGCTCTG 1980 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1044 SerLeuLeuGluGluSerGlnAsnGlnGlnGluLysAsnGluLysAspLeuLeuAlaLeu 1063 Qy 1981 GATAGTTGGGAGTCACTGTGGAGCTGGTTCAACATCACAAATTGGCTGTGGTACATCAGG 2040 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1064 AspSerTrpGluSerLeuTrpSerTrpPheAsnIleThrAsnTrpLeuTrpTyrIleArg 1083 Qy 2041 ATCTTCATCATCATTGTGGGCGGGCTGATCGGACTGCGCATCATTTTCGCCGTGCTGTCA 2100 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1084 IlePheIleIleIleValGlyGlyLeuIleGlyLeuArgIleIlePheAlaValLeuSer 1103 Qy 2101 ATTGTGAACCGAGTCCGGCAGGGCTATTCCCCTCTGTCTTTTCAGACTCTGACCCCCAGC 2160 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1104 IleValAsnArgValArgGlnGlyTyrSerProLeuSerPheGlnThrLeuThrProSer 1123 Qy 2161 CCTAGAGAGCCAGACAGGCTGGGGCGCATCGAAGAGGAAGGAGGCGAACAGGATAGAGCC 2220 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1124 ProArgGluProAspArgLeuGlyArgIleGluGluGluGlyGlyGluGlnAspArgAla 1143 Qy 2221 AGGAGCGTGCGGCTGGTCAATGGATTCCTGGCTCTGGCATGGGAGGACCTGAGATCCCTG 2280 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1144 ArgSerValArgLeuValAsnGlyPheLeuAlaLeuAlaTrpGluAspLeuArgSerLeu 1163 Qy 2281 TGCCTGTTTTCTTACCACCGCCTGCGAGATCTGATCCTGATTGCTGCACGAGCCGCTGCA 2340 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1164 CysLeuPheSerTyrHisArgLeuArgAspLeuIleLeuIleAlaAlaArgAlaAlaAla 1183 Qy 2341 CTGCTGGGACGGTCAAGCCTGTGGGGACTGCAGAAGGGCTGGGAGGCCCTGAAATACCTG 2400 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1184 LeuLeuGlyArgSerSerLeuTrpGlyLeuGlnLysGlyTrpGluAlaLeuLysTyrLeu 1203 Qy 2401 GGGAGTCTGGTGCAGTATTGGGGACTGGAACTGAAGAAAAGTGCCATCTCACTGTTCGAC 2460 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1204 GlySerLeuValGlnTyrTrpGlyLeuGluLeuLysLysSerAlaIleSerLeuPheAsp 1223 Qy 2461 GCCATCGCTATTACTGTGGCTGAGGGCACCGATCGGATCATTAACATCGTGCAGCGAATT 2520 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1224 AlaIleAlaIleThrValAlaGluGlyThrAspArgIleIleAsnIleValGlnArgIle 1243 Qy 2521 AGCCGGGCATTCTACAATATCCCCAGGCGCATTAGACAGGGGTTTGAAGCCACCCTGCAG 2580 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1244 SerArgAlaPheTyrAsnIleProArgArgIleArgGlnGlyPheGluAlaThrLeuGln 1263 Because the nucleic acid molecule encoding an IgE signal peptide is only cited as an optional , the cited reference anticipates claims 1-8 and 10. who teach incorporating an IgE leader sequence into the new DNA vaccine construct, In this study, they designed a clade C env gene (EY3E1-C) to decrease the genetic distances of virus isolates within clade C and focus the induced T cell responses to conserved clade C epitopes. After generating a consensus sequence by analyzing full-length clade C env early transmitter sequences, several modifications were performed to increase the expression of the EY3E1-C, including codon/RNA optimization, addition of Kozak sequence and addition of an IgE leader sequence. The cellular immune responses of pEY3E1-C could be further enhanced when the DNA was delivered by using electroporation (EP). Thus, the synthetic engineered consensus EY3E1-C gene is capable of elicit ing stronger and broader CTL responses than primary clade C envelopes. This finding suggests that such synthetic immunogens could be important for examination of their potential as part of an efficient HIV DNA vaccine. Or alternately, in light of teaching by Yan et al. described above to be motivated by combining the teaching from Ertl et al. and Yan tet al to make a better HIV immunogenic composition comprising the more optimal DNA expression construct via cooperating the IgE signal peptide for further enhance the recombinant antigen expression and also suitable for DNA plasmid delivered by electroporation (EP) with a reasonable expectation of success. As there are no unexpected results have been provided, hence the claimed invention as a whole is prima facie obvious absence unexpected results. PNG media_image1.png 478 895 media_image1.png Greyscale Conclusion Any inquiry concerning this communication or earlier communications from the examiner should be directed to BAO Q LI whose telephone number is (571)272-0904. The examiner can normally be reached M-F 8 am to 8 pm EST. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Michael Allen can be reached at 571-270-3497. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. BAO Q. LI Examiner Art Unit 1671 /BAO Q LI/Primary Examiner, Art Unit 1671
Read full office action

Prosecution Timeline

Jan 09, 2024
Application Filed
Jun 04, 2025
Non-Final Rejection — §102, §103, §112
Nov 06, 2025
Response Filed
Dec 24, 2025
Final Rejection — §102, §103, §112
Mar 24, 2026
Examiner Interview Summary
Mar 24, 2026
Applicant Interview (Telephonic)
Mar 30, 2026
Request for Continued Examination
Apr 01, 2026
Response after Non-Final Action
Apr 02, 2026
Non-Final Rejection — §102, §103, §112 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12589149
METHOD OF MODULATING MUCOSAL IMMUNOGENICITY
2y 5m to grant Granted Mar 31, 2026
Patent 12589141
DNA VACCINE CAPABLE OF EFFECTIVELY TREATING AND/OR PREVENTING TYPE 1 DIABETES AND USE THEREOF
2y 5m to grant Granted Mar 31, 2026
Patent 12589147
MULTIVALENT HVT VECTOR VACCINE
2y 5m to grant Granted Mar 31, 2026
Patent 12582725
AAV VECTORS WITH MYELIN PROTEIN ZERO PROMOTER AND USES THEREOF FOR TREATING SCHWANN CELL-ASSOCIATED DISEASES LIKE CHARCOT-MARIE-TOOTH DISEASE
2y 5m to grant Granted Mar 24, 2026
Patent 12576146
METHOD FOR PRODUCING REASSORTANT INFLUENZA VIRUSES
2y 5m to grant Granted Mar 17, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

AI Strategy Recommendation

Get an AI-powered prosecution strategy using examiner precedents, rejection analysis, and claim mapping.
Powered by AI — typically takes 5-10 seconds

Prosecution Projections

3-4
Expected OA Rounds
76%
Grant Probability
99%
With Interview (+26.5%)
2y 11m
Median Time to Grant
High
PTA Risk
Based on 891 resolved cases by this examiner. Grant probability derived from career allow rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month