Prosecution Insights
Last updated: July 17, 2026
Application No. 18/439,897

COMPOSITIONS AND METHODS FOR IMPROVING THE EFFICACY OF CAS9-BASED KNOCK-IN STRATEGIES

Non-Final OA §102§103
Filed
Feb 13, 2024
Priority
Nov 16, 2017 — provisional 62/587,029 +4 more
Examiner
COLLINS, CYNTHIA E
Art Unit
1662
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Astrazeneca AB
OA Round
1 (Non-Final)
82%
Grant Probability
Favorable
1-2
OA Rounds
0m
Est. Remaining
91%
With Interview

Examiner Intelligence

Grants 82% — above average
82%
Career Allowance Rate
1088 granted / 1320 resolved
+22.4% vs TC avg
Moderate +9% lift
Without
With
+8.7%
Interview Lift
resolved cases with interview
Typical timeline
2y 4m
Avg Prosecution
24 currently pending
Career history
1345
Total Applications
across all art units

Statute-Specific Performance

§101
1.8%
-38.2% vs TC avg
§103
22.7%
-17.3% vs TC avg
§102
15.6%
-24.4% vs TC avg
§112
48.6%
+8.6% vs TC avg
Black line = Tech Center average estimate • Based on career data from 1320 resolved cases

Office Action

§102 §103
DETAILED ACTION Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Election/Restrictions Applicant's election with traverse of group V, claim 21, and the species SEQ ID NO: 71, in the reply filed on February 4, 2026 is acknowledged. Claim 1 links inventions I-III, V-XI and XV. The traversal is on the ground(s) that the Office has provided no explanation as to why claim 1 is indicated as non-allowable. This is not found persuasive because the outstanding restriction requirement does not assert that claim 1 is non-allowable. The outstanding restriction requirement asserts that the restriction requirement among the linked inventions is subject to the nonallowance of the linking claim(s), claim 1, and that upon the indication of allowability of the linking claim(s), the restriction requirement as to the linked inventions shall be withdrawn and any claim(s) depending from or otherwise requiring all the limitations of the allowable linking claim(s) will be rejoined and fully examined for patentability in accordance with 37 CFR 1.104. See MPEP 809. The traversal is on also the ground(s) that since all the inventions of Groups I-X and XV share a technical feature of the non-naturally occurring CRISPR-Cas system, their restriction is improper. This is not found persuasive because the instant application was not filed under 37 USC 371. According, the restriction requirement is not predicated on unity of invention standards. The requirement is still deemed proper and is therefore made FINAL. Claims 2, 5-6, 8, 26-27, 31, 35, 42, 44, 46, 70, 128, 157, 160-161 and 171-172 are withdrawn. Improper Markush Grouping Claim 21 is rejected on the judicially-created basis that it contains an improper Markush grouping of alternatives. See In re Harnisch, 631 F.2d 716, 721-22 (CCPA 1980) and Ex parte Hozumi, 3 USPQ2d 1059, 1060 (Bd. Pat. App. & Int. 1984). The improper Markush grouping includes species of the claimed invention that do not share both a substantial structural feature and a common use that flows from the substantial structural feature. The members of the improper Markush grouping do not share a substantial feature and/or a common use that flows from the substantial structural feature for the following reasons: Claim 21 is drawn to the CRISPR-Cas system of claim 1, wherein the stiCas9 comprises a domain having at least 95% identity to any one of SEQ ID Nos: 10-97 or 192-195. Cas9 proteins are known to be composed of multiple domains that differ in both structure and function. See, e.g., Chylinski et al. Classification and evolution of type II CRISPR-Cas systems. Nucleic Acids Res. 2014 Apr 11;42(10):6091–6105. There is nothing of record to indicate that domains corresponding to SEQ ID Nos: 10-97 or 192-195 all share a substantial structural feature as well as a common use that flows from the substantial structural feature. In response to this rejection, Applicant should either amend the claim(s) to recite only individual species or grouping of species that share a substantial structural feature as well as a common use that flows from the substantial structural feature, or present a sufficient showing that the species recited in the alternative of the claims(s) in fact share a substantial structural feature as well as a common use that flows from the substantial structural feature. This is a rejection on the merits and may be appealed to the Board of Patent Appeals and Interferences in accordance with 35 U.S.C. §134 and 37 CFR 41.31(a)(1) (emphasis provided). Claim Rejections - 35 USC § 102 In the event the determination of the status of the application as subject to AIA 35 U.S.C. 102 and 103 (or as subject to pre-AIA 35 U.S.C. 102 and 103) is incorrect, any correction of the statutory basis for the rejection will not be considered a new ground of rejection if the prior art relied upon, and the rationale supporting the rejection, would be the same under either status. The following is a quotation of the appropriate paragraphs of 35 U.S.C. 102 that form the basis for the rejections under this section made in this Office action: A person shall be entitled to a patent unless – (a)(1) the claimed invention was patented, described in a printed publication, or in public use, on sale, or otherwise available to the public before the effective filing date of the claimed invention. Claim(s) 1 is/are rejected under 35 U.S.C. 102(a)(1) as being anticipated by Bassett et al. Highly efficient targeted mutagenesis of Drosophila with the CRISPR/Cas9 system. Cell Rep. 2013 Jul 11;4(1):220-8. Epub 2013 Jul 1. Claim 1 is drawn to a non-naturally occurring CRISPR-Cas system comprising: a) a Cas9 effector protein capable of generating cohesive ends (stiCas9); and b) a guide polynucleotide that forms a complex with the stiCas9 and comprises a guide sequence, wherein the guide sequence is capable of hybridizing with a target sequence in a eukaryotic cell but does not hybridize to a sequence in a bacterial cell; wherein the complex does not occur in nature. Bassett et al. teach a Streptococcus pyrogenes Cas9 effector protein and a guide polynucleotide that forms a complex with the Cas9 (page 220 column 2 first full paragraph). The Streptococcus pyrogenes Cas9 effector protein is inherently capable of generating staggered (cohesive) ends as evidenced by Zuo et al. Cas9-catalyzed DNA Cleavage Generates Staggered Ends: Evidence from Molecular Dynamics Simulations. Sci. Rep. 2016 Nov 22;5:37584. The guide sequence is capable of hybridizing with a target sequence in a eukaryotic cell but does not hybridize to a sequence in a bacterial cell because the guide sequence is engineered to specifically hybridize to a Drosophila gene. The Cas9/guide polynucleotide complex is non-naturally occurring (does not occur in nature) because it is produced in vitro. Bassett et al. also teach that the Streptococcus pyrogenes Cas9 effector protein is guided to its target site by complementary base pairing of CRISPR RNAs (crRNAs) with the target DNA sequence, and requires a third component, the tracrRNA, which recruits the crRNA into the Cas9 complex (page 220 paragraph spanning columns 1 and 2), and that they have modified a two component system in which the crRNA and the tracrRNA are fused into a single synthetic guide RNA to create targeted mutations in the Drosophila yellow and white genes (page 220 column 2 first full paragraph). Accordingly, Bassett et al. anticipate claim 1. Claim Rejections - 35 USC § 103 In the event the determination of the status of the application as subject to AIA 35 U.S.C. 102 and 103 (or as subject to pre-AIA 35 U.S.C. 102 and 103) is incorrect, any correction of the statutory basis (i.e., changing from AIA to pre-AIA ) for the rejection will not be considered a new ground of rejection if the prior art relied upon, and the rationale supporting the rejection, would be the same under either status. The following is a quotation of 35 U.S.C. 103 which forms the basis for all obviousness rejections set forth in this Office action: A patent for a claimed invention may not be obtained, notwithstanding that the claimed invention is not identically disclosed as set forth in section 102, if the differences between the claimed invention and the prior art are such that the claimed invention as a whole would have been obvious before the effective filing date of the claimed invention to a person having ordinary skill in the art to which the claimed invention pertains. Patentability shall not be negated by the manner in which the invention was made. This application currently names joint inventors. In considering patentability of the claims the examiner presumes that the subject matter of the various claims was commonly owned as of the effective filing date of the claimed invention(s) absent any evidence to the contrary. Applicant is advised of the obligation under 37 CFR 1.56 to point out the inventor and effective filing dates of each claim that was not commonly owned as of the effective filing date of the later invention in order for the examiner to consider the applicability of 35 U.S.C. 102(b)(2)(C) for any potential 35 U.S.C. 102(a)(2) prior art against the later invention. Claim(s) 1 and 21 is/are rejected under 35 U.S.C. 103 as being unpatentable over Doudna et al. U.S. Patent Application No. 2014/0068797, published Mar. 6, 2014. Claim 1 is drawn to a non-naturally occurring CRISPR-Cas system comprising: a) a Cas9 effector protein capable of generating cohesive ends (stiCas9); and b) a guide polynucleotide that forms a complex with the stiCas9 and comprises a guide sequence, wherein the guide sequence is capable of hybridizing with a target sequence in a eukaryotic cell but does not hybridize to a sequence in a bacterial cell; wherein the complex does not occur in nature. Claim 21 is drawn to the CRISPR-Cas system of claim 1, wherein the stiCas9 comprises a domain having at least 95% identity to any one of SEQ ID Nos: 10-97 or 192-195. Doudna et al. teach a Cas9 effector protein obtained from Francisella cf. novicida 3523 that has at least 95% identity to SEQ ID NO: 194 – see the sequence alignment below between SEQ ID NO:194 and SEQ ID NO: 962 of Doudna et al. Cas9 effector proteins are known to be capable of generating cohesive ends as evidenced by Zuo et al. Cas9-catalyzed DNA Cleavage Generates Staggered Ends: Evidence from Molecular Dynamics Simulations. Sci. Rep. 2016 Nov 22;5:37584. Doudna et al. teach that a DNA-targeting RNA (i.e. a guide polynucleotide) that comprises a targeting sequence can form a complex with a Cas9 effector protein and can be used to provide for site-specific modification of a target DNA, including a target DNA in a eukaryotic cell (in which case the guide sequence would not hybridize to a sequence in a bacterial cell and the complex would not occur in nature because the target is eukaryotic rather than prokaryotic) (paragraphs [0017], [0135]). Doudna et al. do not teach a specific embodiment exemplifying a complex comprising the Cas9 effector protein obtained from Francisella cf. novicida 3523 that has at least 95% identity to SEQ ID NO: 194 and a guide polynucleotide. Given the teachings of Doudna et al. that a Cas9 effector protein, including a Cas9 effector protein obtained from Francisella cf. novicida 3523 that has at least 95% identity to SEQ ID NO: 194, can be used with a DNA-targeting RNA (i.e. a guide polynucleotide) that comprises a targeting sequence that forms a complex with a Cas9 effector protein to provide for site-specific modification of a target DNA, including a target DNA in a eukaryotic cell, it would have been prima facie obvious to a person having ordinary skill in the art before the effective filing date of the claimed invention to make a non-naturally occurring CRISPR-Cas system comprising a Cas9 effector protein obtained from Francisella cf. novicida 3523 that has at least 95% identity to SEQ ID NO: 194 and a guide polynucleotide that comprises a guide sequence capable of hybridizing with a target sequence in a eukaryotic cell One skilled in the art could readily combine prior art elements such as a Cas9 effector protein obtained from Francisella cf. novicida 3523 that has at least 95% identity to SEQ ID NO: 194 and a DNA-targeting RNA (i.e. a guide polynucleotide) that comprises a targeting sequence that forms a complex with a Cas9 effector protein to yield predictable results, i.e. site-specific modification of a target DNA, since the elements were already known in the art to be useful for this purpose. Thus, the claimed invention would have been prima facie obvious as a whole to a person having ordinary skill in the art before the effective filing date of the claimed invention. Sequence alignment between SEQ ID NO:194 and SEQ ID NO: 962 of Doudna et al.: RESULT 2 US-13-842-859A-962 (NOTE: this sequence has 212 duplicates in the database searched. See complete list at the end of this report) Sequence 962, US/13842859A Publication No. US20140068797A1 GENERAL INFORMATION APPLICANT: Jinek, Martin APPLICANT: Doudna, Jennifer A. APPLICANT: Charpentier, Emmanuelle APPLICANT: Chylinski, Krzysztof APPLICANT: Doudna Cate, James H. APPLICANT: Lim, Wendell APPLICANT: Qi, Lei TITLE OF INVENTION: METHODS AND COMPOSITIONS FOR RNA-DIRECTED TARGET DNA MODIFICATION TITLE OF INVENTION: AND FOR RNA-DIRECTED MODULATION OF TRANSCRIPTION FILE REFERENCE: BERK-187 CURRENT APPLICATION NUMBER: US/13/842,859A CURRENT FILING DATE: 2013-03-15 PRIOR APPLICATION NUMBER: US 61/652,086 PRIOR FILING DATE: 2012-05-25 PRIOR APPLICATION NUMBER: US 61/716,256 PRIOR FILING DATE: 2012-10-19 PRIOR APPLICATION NUMBER: US 61/757,640 PRIOR FILING DATE: 2013-01-28 PRIOR APPLICATION NUMBER: US 61/765,576 PRIOR FILING DATE: 2013-02-15 NUMBER OF SEQ ID NOS: 1360 SEQ ID NO 962 LENGTH: 1646 TYPE: PRT ORGANISM: Unknown FEATURE: OTHER INFORMATION: Francisella cf. novicida 3523 Query Match 97.3%; Score 8328.5; Length 1646; Best Local Similarity 96.9%; Matches 1595; Conservative 22; Mismatches 22; Indels 7; Gaps 2; Qy 1 MNIKILPIAIDLGAKNTGVFSAFYQKGTSLESLDNKNGKVYELSKDSYTLLMNNRTARRH 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MNIKILPIAIDLGAKNTGVFSAFYQKGTSLESLDNKNGKVYELSKDSYTLLMNNRTARRH 60 Qy 61 QRRGIDRKQLVKRLFKLIWTKQLNLEWNKDTQQTISFLLNRRGFSFITDGYSPEYLNIAP 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 QRRGIDRKQLVKRLFKLIWTKQLNLEWNKDTQQTISFLLNRRGFSFITDGYSPEYLNIAP 120 Qy 121 EPVKVILMSILDDYNGEDDLDSYLQSATENDSKIDELYNKLLQKTLEFKLRKLCIDIKED 180 | || ||||||||||||||||||||||||||||||||||||||| ||||||||||||||| Db 121 EAVKAILMSILDDYNGEDDLDSYLQSATENDSKIDELYNKLLQKALEFKLRKLCIDIKED 180 Qy 181 KVTTKTLKELSNTEFKLLANYLVDYDRILRTQKFSYTDKQGNLRELNYYHHDKYNIQEFL 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 KVTTKTLKELSNTEFKLLANYLVDYDRILRTQKFSYTDKQGNLRELNYYHHDKYNIQEFL 240 Qy 241 KRNIIINDVILEKLTDDLDIWNLNFDKFDFEKNLEKLENQEDKDYLQTHLHHFVFAVNKI 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 KRNIIINDVILEKLTDDLDIWNLNFDKFDFEKNLEKLENQEDKDYLQTHLHHFVFAVNKI 300 Qy 301 KSEMASGGRHRSQYFQEITNVLVENNHQEGYLKNFCENLHNKKYSNLSVKNLVNLIGNLS 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 KSEMASGGRHRSQYFQEITNVLVENNHQEGYLKNFCENLHNKKYSNLSVKNLVNLIGNLS 360 Qy 361 NLELKPLRKYFNDKIHAKADYWDEQKFAETYSDWILGEWRVGAKDKDKKDGAKYSYKILC 420 ||||||||||||||||||||||||||||||||||||||||||||||||||||||||| || Db 361 NLELKPLRKYFNDKIHAKADYWDEQKFAETYSDWILGEWRVGAKDKDKKDGAKYSYKNLC 420 Qy 421 DELKQKVGINQDGIINQTKGDFVGFLLELDPCRTIPPYLDNNNRKPPKCQSLILNPKFLD 480 ||||||||||||||||||| ||| |||||||||||||||||||||||||||||||||||| Db 421 DELKQKVGINQDGIINQTKSDFVDFLLELDPCRTIPPYLDNNNRKPPKCQSLILNPKFLD 480 Qy 481 NKYPNWQQYLQELKKLQTVQNYLGNFEIDLKDLKSSKEQPYFVKYKSSNQQIASGQRDYK 540 ||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||| Db 481 NKYPNWQQYLQELKKLQTVQNYLGNFEIDLKDLKSSKEQPYFVKYKSLNQQIASGQRDYK 540 Qy 541 DLDARVLQFIFDRVKASDELLLNEIYSHAKKLKQNISSELEKLELCKKLDKIIANSQLSQ 600 ||||||||||||||||||||||||||||||||||| ||||||||||||||::|||||||| Db 541 DLDARVLQFIFDRVKASDELLLNEIYSHAKKLKQNTSSELEKLELCKKLDEVIANSQLSQ 600 Qy 601 ILKSQHINGIFEQGTFLHLVCKYYKQRQRARDSRLYIMPEYRYDKKLDKYNNTGRFDDDN 660 ||||||:||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 601 ILKSQHVNGIFEQGTFLHLVCKYYKQRQRARDSRLYIMPEYRYDKKLDKYNNTGRFDDDN 660 Qy 661 QLLTYCNHKPRQKRYQLLNDLAGVLQVSPNFLKDKIGSDDDLFISKWLVEHIRGFKKACE 720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 661 QLLTYCNHKPRQKRYQLLNDLAGVLQVSPNFLKDKIGSDDDLFISKWLVEHIRGFKKACE 720 Qy 721 DSLKIQKDNRGLLNHKINIARNTKGKCEKEIFNLICKIEGSEDKKGNYKHGLAYELGVLL 780 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 721 DSLKIQKDNRGLLNHKINIARNTKGKCEKEIFNLICKIEGSEDKKGNYKHGLAYELGVLL 780 Qy 781 FGEPNQASKLEFDRKIKKFNSIYSFAQIQQIAFAERKGNANTCAVCSADNAHRMQQIKVA 840 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 781 FGEPNQASKLEFDRKIKKFNSIYSFAQIQQIAFAERKGNANTCAVCSADNAHRMQQIKVA 840 Qy 841 KPVEGNKDNIILSAKAQRLPAIPTRIVDGAVKKMATILARNIVDDNWDNIKQALSNNQQL 900 |||||||||||||||||||||||||||||||||:|||||||||||||||||||||||||| Db 841 KPVEGNKDNIILSAKAQRLPAIPTRIVDGAVKKIATILARNIVDDNWDNIKQALSNNQQL 900 Qy 901 HVPIITESNAFEFEPALADVKGKSLKDKRKKALERINPENTFKDKNNRIKEFAKGISAYS 960 |||||||||||||||||||:||||||||||||||||:||| ||||||||||||||||||| Db 901 HVPIITESNAFEFEPALADIKGKSLKDKRKKALERIDPENVFKDKNNRIKEFAKGISAYS 960 Qy 961 GDNLANGDFDGAKEELDHIIPRAHKKYGTLNDEANLICVTREDNQNRGNKAVFLYDLKPN 1020 ||||||||||||||||||||:||||||||||||||||||||||||||||||||||||| Db 961 DANLANGDFDGAKEELDHIIPRSHKKYGTLNDEANLICVTREDNQNRGNKAVFLYDLKPN 1020 Qy 1021 YKLKQFDTTDDLEIEKKIADTIWDASKQDFKFGNYRSFINLTPQEQKAFRHALFLADENP 1080 ||||||:||||||||||||||||||||||||||||||||||||||| ||||||||||:|| Db 1021 YKLKQFNTTDDLEIEKKIADTIWDASKQDFKFGNYRSFINLTPQEQIAFRHALFLADKNP 1080 Qy 1081 IKKAVIRAINNRNRTFVNGTQRYFAEVLANNIYLRAKKENLATNRITFDYFGIETTNSNG 1140 |||||||||:|||||||||||||||||||||||||||||||||||||||||||||||||| Db 1081 IKKAVIRAIDNRNRTFVNGTQRYFAEVLANNIYLRAKKENLATNRITFDYFGIETTNSNG 1140 Qy 1141 RGVADVRKLYEKVDSDIQAYAKGDKPQDSYSHLIDAMIAFCVAADEHKNGGSIGLEIDKN 1200 ||:|||||||||||||||||||||||||||||||||||||||||||||| |||||:: Db 1141 RGIADVRKLYEKVDSDIQAYAKGDKPQDSYSHLIDAMIAFCVAADEHKNEGSIGLKMGNQ 1200 Qy 1201 YSLYP----LDKNTGEVFS---KDIFSQIKIADNEFSDKKLVRKKATEGFNTHRQMTRDG 1253 | |:| |:||||: | ||| :||::||:||||||||||||||||||||||||| Db 1201 YGLFPTPDKYDENTGEIISWHNDDIFRKIKVSDNQFSDKKLVRKKATEGFNTHRQMTRDG 1260 Qy 1254 IYGESYLPILIHKNLNEVRKGYNWENSEEIKIFKGKKYDIQQLNNLVYCLKFVDKPISID 1313 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1261 IYGESYLPILIHKNLNEVRKGYNWENSEEIKIFKGKKYDIQQLNNLVYCLKFVDKPISID 1320 Qy 1314 IQITTLEELRNILETNNISTTAEYYYINLKTQKLHEYYIENYNTALGYKKYTKEMEFLRS 1373 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1321 IQITTLEELRNILETNNISTTAEYYYINLKTQKLHEYYIENYNTALGYKKYTKEMEFLRS 1380 Qy 1374 LAYRTERVKIKSIDDVSMILAKDSNFKAGKIELPFKTEWQRLYLEWQNTTIKDNYEFLKS 1433 ||||||||||||||||||||||||||||||||||||||||||||||||||||||:||||| Db 1381 LAYRTERVKIKSIDDVSMILAKDSNFKAGKIELPFKTEWQRLYLEWQNTTIKDNHEFLKS 1440 Qy 1434 YFSVKNATKQHKKVRKDFSLPISTNEGKLLVKRKTWDNNFIYQILNDSDSRADGTKPFIP 1493 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1441 YFSVKNATKQHKKVRKDFSLPISTNEGKLLVKRKTWDNNFIYQILNDSDSRADGTKPFIP 1500 Qy 1494 AFDISKNEIVETIIKSFTSKNIFWLPKNIKLQKVDNKSIFAIDTSRWFEVETPKDLIEIG 1553 |||||||||||||||||||||||||||||:|||||||||||||||||||||||||||||| Db 1501 AFDISKNEIVETIIKSFTSKNIFWLPKNIELQKVDNKSIFAIDTSRWFEVETPKDLIEIG 1560 Qy 1554 VSTIQYKIDNNSRPKVRVKLDYVMDDDSKINYFMNHSLLKSRYPDKVLEILKQSTIIEFE 1613 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1561 VSTIQYKIDNNSRPKVRVKLDYVMDDDSKINYFMNHSLLKSRYPDKVLEILKQSTIIEFE 1620 Qy 1614 SSGFNKTIKEMLGMTLAGIYNETLNN 1639 ||||||||||||||||||||||| || Db 1621 SSGFNKTIKEMLGMTLAGIYNETSNN 1646 Remarks Any inquiry concerning this communication or earlier communications from the examiner should be directed to CYNTHIA E COLLINS whose telephone number is (571)272-0794. The examiner can normally be reached M-F 8:30 am - 5:00 pm. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Bratislav Stankovic can be reached at 571-270-0305. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /CYNTHIA E COLLINS/Primary Examiner, Art Unit 1662
Read full office action

Prosecution Timeline

Feb 13, 2024
Application Filed
Jun 10, 2026
Non-Final Rejection mailed — §102, §103 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12667070
SOYBEAN VARIETY
2y 5m to grant Granted Jun 30, 2026
Patent 12668808
COMPOSITIONS AND METHODS FOR SITE DIRECTED GENOMIC MODIFICATION
2y 3m to grant Granted Jun 30, 2026
Patent 12660786
SOYBEAN VARIETY 5PYYV54
2y 3m to grant Granted Jun 23, 2026
Patent 12660787
SOYBEAN VARIETY 5PKYP02
2y 3m to grant Granted Jun 23, 2026
Patent 12653133
SOYBEAN VARIETY 5PPLE95
2y 3m to grant Granted Jun 16, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

Strategy Recommendation AI-generated — please review before filing

Get a prosecution strategy drawn from examiner precedents, rejection analysis, and claim mapping.
Typically takes 5-10 seconds — AI-generated, attorney review required before filing

Prosecution Projections

1-2
Expected OA Rounds
82%
Grant Probability
91%
With Interview (+8.7%)
2y 4m (~0m remaining)
Median Time to Grant
Low
PTA Risk
Based on 1320 resolved cases by this examiner. Grant probability derived from career allowance rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month