Prosecution Insights
Last updated: September 19, 2026
Application No. 18/459,142

IL-15 PROCYTOKINE ANTIBODY FUSION PROTEINS

Non-Final OA §112
Filed
Aug 31, 2023
Priority
Aug 31, 2022 — provisional 63/402,639
Examiner
GUSTILO, ESTELLA M
Art Unit
1646
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Proviva Therapeutics (Hong Kong) Limited
OA Round
1 (Non-Final)
54%
Grant Probability
Moderate
1-2
OA Rounds
4m
Est. Remaining
89%
With Interview

Examiner Intelligence

Grants 54% of resolved cases
54%
Career Allowance Rate
35 granted / 65 resolved
-6.2% vs TC avg
Strong +35% interview lift
Without
With
+35.2%
Interview Lift
resolved cases with interview
Typical timeline
3y 5m
Avg Prosecution
41 currently pending
Career history
101
Total Applications
across all art units

Statute-Specific Performance

§101
4.1%
-35.9% vs TC avg
§103
31.3%
-8.7% vs TC avg
§102
13.8%
-26.2% vs TC avg
§112
27.0%
-13.0% vs TC avg
Black line = Tech Center average estimate • Based on career data from 65 resolved cases

Office Action

§112
Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Status of the Claims Claims 1 – 19, 22 – 26, 30 – 31, 33 and 35 – 44 were pending. Claims 1, 2, 4, 13 – 14, 18, 26, 33 have been amended, and claims 3, 5 – 12, 15 – 17, 22 – 24 have been canceled. Claims 1 – 2, 4, 13 – 14, 18, 25 – 26, 30 – 31, 33 and 35 – 44 are currently pending, with non-elected claims 39 and 41 – 43 withdrawn from consideration. Claims 1 – 2, 4, 13 – 14, 25 – 26, 30 – 31, 33, 35 – 38, 40, and 44 are the subject of this Office Action. This is the first Office Action on the merits of the claims. Election/Restrictions Applicant’s election of Group I (claims 1-19, 22-26, 30-31, 33 and 40; directed to an activatable proprotein homodimer) in the reply filed on 07/17/2026 is acknowledged. For the species, Applicant elects the following (see also claim 30): Fab: binds to PD-1, comprising CDRs of SEQ ID NOs: 3 (VH) and 4 (VL); Fc domain: SEQ ID NOs: 42 (IgGI hinge), 57 (IgGI CH2 domain with LALA-P329A mutations), and 58 (IgGI CH3 domain with delK); 1st linker: SEQ ID NO: 178, wherein x is 2 (stable linker) IL-15: SEQ ID NO: 79 (K86G and S162A mutations); linker: SEQ ID NO: 90 (cleavable linker); IL-15Ra: SEQ ID NO: 87 (sushi+ with T2A mutation); Homodimers: SEQ ID NOs: 146 and 147 (P53052037). Because applicant did not distinctly and specifically point out the supposed errors in the restriction requirement, the election has been treated as an election without traverse (MPEP § 818.01(a)). Claim Rejections - 35 USC § 112 The following is a quotation of 35 U.S.C. 112(b): (b) CONCLUSION.—The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the inventor or a joint inventor regards as the invention. The following is a quotation of 35 U.S.C. 112 (pre-AIA ), second paragraph: The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the applicant regards as his invention. Claims 1 – 2, 4, 13 – 14, 25 – 26, 30 – 31, 33, 35 – 38, 40, and 44 are rejected under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter which the inventor or a joint inventor (or for applications subject to pre-AIA 35 U.S.C. 112, the applicant), regards as the invention. Claim 1 recites “a heavy chain variable (VH) region comprising VHCDR1, VHCDR2, and VHCDR3 regions set forth in SEQ ID NO: 3; and a light chain variable (VL) region comprising VLCDR1, VLCDR2, and VLCDR3 regions set forth in SEQ ID NO: 4”; however, the claims do not disclose the sequence of each CDR. Although, the sequences of the CDRs are underlined in the VH or VL sequences listed in Table P1, p. 24 of the specification, each claimed CDR having four or more amino acids requires a sequence identifier. See MPEP 2412. Furthermore, claim 1 does not indicate the numbering system used to delineate the CDRs. Although the specification states that “[t]he structures and locations of immunoglobulin variable domains may be determined by reference to Kabat, E. A. et al., Sequences of Proteins of Immunological Interest. 4th Edition. US Department of Health and Human Services. 1987, and updates thereof” (p. 29, end of the second paragraph), the antibody numbering system or standardized frameworks used to label amino acid residues in the variable regions of antibodies should be expressly stated in claims reciting CDRs. However, this teaching is not considered a limiting definition for the numbering system encompassed by the claims. Thus, the CDRs encompassed by independent claim 1 could be according to Kabat, CDRs according to Chothia, or they could be numbered according to other CDR boundary definitions that may not strictly follow one of Kabat or Chothia, in which case, the CDRs would potentially encompass different amino acids within SEQ ID NOs: 3 and 4. See image, below. PNG media_image1.png 397 513 media_image1.png Greyscale Because it is unclear what numbering system is being used, it is unclear what amino acid residues are required by the CDRs of the claims. Claims 4 and 13 each depends from a canceled claim and thus the limitations are not clear. Claim 30 recites the terms “optionally”, and although the term is considered acceptable alternative language, there must be no ambiguity as to which alternatives are covered by the claim. See MPEP 2173.05(h)(II). In this case, however, the placement of two of the “optionally” terms in present claim 30 results in some ambiguity, and it is not necessarily clear which limitations are optional and which limitations are required. Claims 2, 14, 18, 25 – 26, 30 – 31, 33, 35 – 38, 40 and 44 depend from claim 1, either directly or indirectly, and thus inherit the deficiencies of claim 1. Conclusion No claim is allowed. The prior art made of record and not relied upon is considered pertinent to applicant's disclosure. WANG (WO 2021/032116 A1, published 02/25/2021; see PTO-892: Notice of References Cited) is cited to further show the general state of the art. WANG is directed to an immunocytokine of an antibody respectively fusing IL-15 and IL-15Ra on an antigen on the surface of a target cell, capable of effectively and specifically targeting a complex of IL-15 and IL-15Ra to a tumor microenvironment, activating relevant immune cells within or in the vicinity of a tumor, achieving the goal of specifically killing of the tumor, and at the same time, preventing immunotoxicity induced by the systemic hyperactivation of NK cells. See WANG (English translation) at the abstract. WANG teaches the anti-PD-1 sequences of SEQ ID NOs: 3 and 4 with 100% identity. WANG’s SEQ ID NO: 76 teaches present SEQ ID NO: 3, and WANG’s SEQ ID NO: 78 teaches present SEQ ID NO: 4. See Appendix. WANG also teaches the sequence of SEQ ID NO: 147 with 100% identity. See Appendix. WANG teaches that in the tumor microenvironment, the IL-15/IL15Ra complex formed by the immune cytokine can activate the relevant immune cells in or near the tumor, and exert the specific killing effect of T cells or NK cells in the tumor microenvironment on the tumor At the same time, it can avoid the immune toxicity induced by systemic excessive activation of T cells or NK cells. See WANG at p. 2, last sentence, of the English translation. However, WANG does not teach the sequence of present SEQ ID NO: 146 of present claim 1. Any inquiry concerning this communication or earlier communications from the examiner should be directed to Estella Gustilo whose telephone number is (703)756-1706. The examiner can normally be reached Monday - Friday 9:30 AM - 5:30 PM. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Gregory Emch can be reached at 571-272-8149. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /ESTELLA M. GUSTILO/Examiner, Art Unit 1646 /GREGORY S EMCH/Supervisory Patent Examiner, Art Unit 1678 APPENDIX Alignment with SEQ ID NO: 3 AC BJA05258; XX DT 15-APR-2021 (first entry) XX DE Anti-PD-1 antibody heavy chain variable region, SEQ ID 76 #2. XX KW PD-1 protein; antibody; antiinflammatory; cancer; cytostatic; KW heavy chain variable region; inflammatory disease; protein therapy; KW recombinant protein; therapeutic. XX OS Unidentified. XX FH Key Location/Qualifiers FT Region 30..35 FT /label= CDR1 FT Region 47..66 FT /label= CDR2 FT Region 97..102 FT /label= CDR3 XX CC PN WO2021032116-A1. XX CC PD 25-FEB-2021. XX CC PF 19-AUG-2020; 2020WO-CN109986. XX PR 19-AUG-2019; 2019CN-10764762. XX CC PA (SHAN-) SHANGHAI YICHEN BIOMED CO LTD. XX CC PI Wang F, Zheng H, Zhang Y; XX DR WPI; 2021-19445U/021. XX CC PT Immunocytokine in medicinal composition for treating inflammatory disease CC PT or cancer in subject in need, comprises interleukin-15, interleukin-15 CC PT receptor a subunit and antibodies targeting treatment of related cell CC PT surface antigens. XX CC PS Claim 11; SEQ ID NO 76; 39pp; Chinese. XX CC The present invention relates to a novel immunocytokine comprising an CC interleukin-15 (IL-15), interleukin-15 receptor alpha subunit (IL-15Ra) CC and antibodies targeting treatment of related cell surface antigens. The CC IL-15 is connected to the N-terminus of a heavy chain variable (VH) CC region of the antibody directly or through a connecting peptide, and the CC IL-15Ra is connected to the N-terminus of a light chain variable (VL) CC region of the antibody directly or through a connecting peptide or the IL CC -15 is connected to the N-terminus of the VL region of the antibody CC directly or through a connecting peptide, and the IL-15Ra is connected to CC the N-terminus of the VH region of the antibody directly or through a CC connecting peptide, or the IL-15 is connected to C-terminus of a light CC chain constant (CL) region of antibody directly or through a connecting CC peptide and the IL-15Ra is connected to C-terminus of a heavy chain CC constant (CH) region of the antibody directly or through a connecting CC peptide. The invention further claims: (1) a nucleic acid encoding the CC immunocytokine; (2) a vector comprising the nucleic acid; (3) a host cell CC comprising the vector; (4) a medicinal composition comprising the CC immunocytokine and a carrier; and (5) a method for treating inflammatory CC disease or cancer in a subject. The immunocytokine of the present CC invention is useful in a medicinal composition for treating inflammatory CC disease and cancer. Note: The present sequence is shown as SEQ ID NO: 76 CC in figure 5C of the specification, but it differs from the sequence CC described as SEQ ID NO: 76 (see BJA05203) in the sequence listing. XX SQ Sequence 113 AA; ALIGNMENT: Query Match 100.0%; Score 602; Length 113; Best Local Similarity 100.0%; Matches 113; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 QVQLVESGGGVVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSKRYY 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 QVQLVESGGGVVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAVIWYDGSKRYY 60 Qy 61 ADSVKGRFTISRDNSKNTLFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSS 113 ||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 ADSVKGRFTISRDNSKNTLFLQMNSLRAEDTAVYYCATNDDYWGQGTLVTVSS 113 Alignment with SEQ ID NO: 4 BJA05259 ID BJA05259 standard; protein; 107 AA. XX AC BJA05259; XX DT 15-APR-2021 (first entry) XX DE Anti-PD-1 antibody light chain variable region, SEQ ID 78 #2. XX KW PD-1 protein; antibody; antiinflammatory; cancer; cytostatic; KW inflammatory disease; light chain variable region; protein therapy; KW recombinant protein; therapeutic. XX OS Unidentified. XX FH Key Location/Qualifiers FT Region 24..36 FT /label= CDR1 FT Region 46..56 FT /label= CDR2 FT Region 89..97 FT /label= CDR3 XX CC PN WO2021032116-A1. XX CC PD 25-FEB-2021. XX CC PF 19-AUG-2020; 2020WO-CN109986. XX PR 19-AUG-2019; 2019CN-10764762. XX CC PA (SHAN-) SHANGHAI YICHEN BIOMED CO LTD. XX CC PI Wang F, Zheng H, Zhang Y; XX DR WPI; 2021-19445U/021. XX CC PT Immunocytokine in medicinal composition for treating inflammatory disease CC PT or cancer in subject in need, comprises interleukin-15, interleukin-15 CC PT receptor a subunit and antibodies targeting treatment of related cell CC PT surface antigens. XX CC PS Claim 11; SEQ ID NO 78; 39pp; Chinese. XX CC The present invention relates to a novel immunocytokine comprising an CC interleukin-15 (IL-15), interleukin-15 receptor alpha subunit (IL-15Ra) CC and antibodies targeting treatment of related cell surface antigens. The CC IL-15 is connected to the N-terminus of a heavy chain variable (VH) CC region of the antibody directly or through a connecting peptide, and the CC IL-15Ra is connected to the N-terminus of a light chain variable (VL) CC region of the antibody directly or through a connecting peptide or the IL CC -15 is connected to the N-terminus of the VL region of the antibody CC directly or through a connecting peptide, and the IL-15Ra is connected to CC the N-terminus of the VH region of the antibody directly or through a CC connecting peptide, or the IL-15 is connected to C-terminus of a light CC chain constant (CL) region of antibody directly or through a connecting CC peptide and the IL-15Ra is connected to C-terminus of a heavy chain CC constant (CH) region of the antibody directly or through a connecting CC peptide. The invention further claims: (1) a nucleic acid encoding the CC immunocytokine; (2) a vector comprising the nucleic acid; (3) a host cell CC comprising the vector; (4) a medicinal composition comprising the CC immunocytokine and a carrier; and (5) a method for treating inflammatory CC disease or cancer in a subject. The immunocytokine of the present CC invention is useful in a medicinal composition for treating inflammatory CC disease and cancer. Note: The present sequence is shown as SEQ ID NO: 78 CC in figure 5C of the specification, but it differs from the sequence CC described as SEQ ID NO: 78 (see BJA05205) in the sequence listing. XX SQ Sequence 107 AA; ALIGNMENT: Query Match 100.0%; Score 553; Length 107; Best Local Similarity 100.0%; Matches 107; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPA 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPA 60 Qy 61 RFSGSGSGTDFTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIK 107 ||||||||||||||||||||||||||||||||||||||||||||||| Db 61 RFSGSGSGTDFTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIK 107 Alignment with SEQ ID NO: 147 RESULT 16 BJA05213 ID BJA05213 standard; protein; 295 AA. XX AC BJA05213; XX DT 15-APR-2021 (first entry) XX DE IL-15Ra sushi-anti-PD-L1 antibody light chain fusion, SEQ ID 86. XX KW IL-15 receptor; IL-15Ra; Interleukin-15 receptor alpha subunit; KW PD-L1 protein; antibody; antiinflammatory; cancer; cytostatic; KW fusion protein; inflammatory disease; light chain; protein therapy; KW recombinant protein; therapeutic. XX OS Homo sapiens. OS Unidentified. OS Chimeric. OS Synthetic. XX CC PN WO2021032116-A1. XX CC PD 25-FEB-2021. XX CC PF 19-AUG-2020; 2020WO-CN109986. XX PR 19-AUG-2019; 2019CN-10764762. XX CC PA (SHAN-) SHANGHAI YICHEN BIOMED CO LTD. XX CC PI Wang F, Zheng H, Zhang Y; XX DR WPI; 2021-19445U/021. DR N-PSDB; BJA05212. XX CC PT Immunocytokine in medicinal composition for treating inflammatory disease CC PT or cancer in subject in need, comprises interleukin-15, interleukin-15 CC PT receptor a subunit and antibodies targeting treatment of related cell CC PT surface antigens. XX CC PS Claim 18; SEQ ID NO 86; 39pp; Chinese. XX CC The present invention relates to a novel immunocytokine comprising an CC interleukin-15 (IL-15), interleukin-15 receptor alpha subunit (IL-15Ra) CC and antibodies targeting treatment of related cell surface antigens. The CC IL-15 is connected to the N-terminus of a heavy chain variable (VH) CC region of the antibody directly or through a connecting peptide, and the CC IL-15Ra is connected to the N-terminus of a light chain variable (VL) CC region of the antibody directly or through a connecting peptide or the IL CC -15 is connected to the N-terminus of the VL region of the antibody CC directly or through a connecting peptide, and the IL-15Ra is connected to CC the N-terminus of the VH region of the antibody directly or through a CC connecting peptide, or the IL-15 is connected to C-terminus of a light CC chain constant (CL) region of antibody directly or through a connecting CC peptide and the IL-15Ra is connected to C-terminus of a heavy chain CC constant (CH) region of the antibody directly or through a connecting CC peptide. The invention further claims: (1) a nucleic acid encoding the CC immunocytokine; (2) a vector comprising the nucleic acid; (3) a host cell CC comprising the vector; (4) a medicinal composition comprising the CC immunocytokine and a carrier; and (5) a method for treating inflammatory CC disease or cancer in a subject. The immunocytokine of the present CC invention is useful in a medicinal composition for treating inflammatory CC disease and cancer. The present sequence represents a fusion protein CC (comprising a human IL-15Ra sushi-anti-PD-L1 antibody light chain) which CC is used for treating inflammatory disease and cancer. XX SQ Sequence 295 AA; Query Match 100.0%; Score 1106; Length 295; Best Local Similarity 100.0%; Matches 214; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPA 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 82 EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPA 141 Qy 61 RFSGSGSGTDFTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKRTVAAPSVFIFPP 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 142 RFSGSGSGTDFTLTISSLEPEDFAVYYCQQSSNWPRTFGQGTKVEIKRTVAAPSVFIFPP 201 Qy 121 SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 202 SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT 261 Qy 181 LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 214 |||||||||||||||||||||||||||||||||| Db 262 LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 295
Read full office action

Prosecution Timeline

Aug 31, 2023
Application Filed
Aug 26, 2026
Non-Final Rejection mailed — §112 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12735721
ENGINEERED ADENO-ASSOCIATED (AAV) VECTORS FOR TRANSGENE EXPRESSION
4y 11m to grant Granted Sep 15, 2026
Patent 12662543
ANTI-CD40 BINDING MOLECULES AND BI-SPECIFIC ANTIBODIES COMPRISING SUCH
4y 2m to grant Granted Jun 23, 2026
Patent 12655227
MODIFIED FC REGION
5y 0m to grant Granted Jun 16, 2026
Patent 12606605
ULTRA-LONG ACTING INSULIN-FC FUSION PROTEINS AND METHODS OF USE
3y 3m to grant Granted Apr 21, 2026
Patent 12595306
TREM2 STABILIZING ANTIBODIES
1y 3m to grant Granted Apr 07, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

Strategy Recommendation AI-generated — please review before filing

Get a prosecution strategy drawn from examiner precedents, rejection analysis, and claim mapping.
Typically takes 5-10 seconds — AI-generated, attorney review required before filing

Prosecution Projections

1-2
Expected OA Rounds
54%
Grant Probability
89%
With Interview (+35.2%)
3y 5m (~4m remaining)
Median Time to Grant
Low
PTA Risk
Based on 65 resolved cases by this examiner. Grant probability derived from career allowance rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month