Prosecution Insights
Last updated: April 19, 2026
Application No. 18/465,802

INCREASING PLANT OIL CONTENT BY IMPROVING ACTIVITY OF ACETYL-COA CARBOXYLASE

Non-Final OA §112§DP
Filed
Sep 12, 2023
Examiner
ZHONG, WAYNESHAOBIN
Art Unit
1662
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
The Curators of the University of Missouri
OA Round
3 (Non-Final)
72%
Grant Probability
Favorable
3-4
OA Rounds
3y 0m
To Grant
94%
With Interview

Examiner Intelligence

Grants 72% — above average
72%
Career Allow Rate
377 granted / 524 resolved
+11.9% vs TC avg
Strong +22% interview lift
Without
With
+22.3%
Interview Lift
resolved cases with interview
Typical timeline
3y 0m
Avg Prosecution
28 currently pending
Career history
552
Total Applications
across all art units

Statute-Specific Performance

§101
8.0%
-32.0% vs TC avg
§103
29.4%
-10.6% vs TC avg
§102
13.6%
-26.4% vs TC avg
§112
34.3%
-5.7% vs TC avg
Black line = Tech Center average estimate • Based on career data from 524 resolved cases

Office Action

§112 §DP
DETAILED ACTION Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Continued Examination Under 37 CFR 1.114 A request for continued examination under 37 CFR 1.114, including the fee set forth in 37 CFR 1.17(e), was filed in this application after final rejection. Since this application is eligible for continued examination under 37 CFR 1.114, and the fee set forth in 37 CFR 1.17(e) has been timely paid, the finality of the previous Office action has been withdrawn pursuant to 37 CFR 1.114. Status of claims The applicant’s response filed 1/21/2026 has been entered. Claims 2-6, 9, 12 had/have been canceled. Claims 1, 10, 13 have been amended. Claim 22 is newly added. Note: On 12/5/2024, the applicant elects without traverse: Election 1. BADC1; Note: according to the specification ([0030]), SEQ ID NO: 2 is BADC1 full genomic nucleic acid sequence. Thus, in claim 11, SEQ ID NO: 2 is elected by the examiner. Election 2. SEQ ID NO: 134 (new claim 22), which is a Camelina sativa BADC1; and Election 3. Camelina sativa. Note: SEQ ID NO: 136 is optional in claim 1 and in new claim 22, and is examined in the office action along with SEQ ID NO: 131. In summary, claims 1, 7-8, 10-11, 13-22 are pending and examined in this office action. Non-elected species are withdrawn. Claim Objections Amended claim 1 is objected to because of the following informality: The “(SEQ ID NO: 136”, should be ---(SEQ ID NO: 136) ---. See the requirement of 37 CFR 1.71(a) for “full, clear, and exact terms”. Appropriate correction is required. Claim Rejections - 35 USC § 112 Failing to further limit parent claim(s) The following is a quotation of 35 U.S.C. 112(d): (d) REFERENCE IN DEPENDENT FORMS—Subject to subsection (e), a claim in dependent form shall contain a reference to a claim previously set forth and then specify a further limitation of the subject matter claimed. A claim in dependent form shall be construed to incorporate by reference all the limitations of the claim to which it refers. Claims 10-11 are rejected under 35 U.S.C. 112(d) or pre-AIA 35 U.S.C. 112, 4th paragraph, as being of improper dependent form for failing to further limit the subject matter of the claim upon which it depends, or for failing to include all the limitations of the claim upon which it depends. Amended Claim 1 is narrowed down to recite BADC gene(s) (BADC1 being the elected species) encodes a polypeptide comprising from about 34% to about 100% sequence identity to SEQ ID NO: 131 or to SEQ ID NO: 136. However, claim 10 is now amended to depend on claim 1, and recites gene orthologs of BADC1 (elected), or artificial genes containing essential BADC motifs. Gene orthologs are broader than the corresponding genes in scope; artificial genes containing essential BADC motifs also are broader than the corresponding genes in scope. Thus, claim 10 does not include all the limitations of claim 1, and does not further limit claim 1. Claim 11 does not cure the deficiency of claim 10, but also include additional items that are outside of the scope of claim 1 or claim 10. For example, “a complement thereof” refers to a complement sequence of a gene, that is outside of the corresponding gene in scope. Applicant may cancel the claim(s), amend the claim(s) to place the claim(s) in proper dependent form, rewrite the claim(s) in independent form, or present a sufficient showing that the dependent claim(s) complies with the statutory requirements. Lacking written description The following is a quotation of the first paragraph of 35 U.S.C. 112(a): (a) IN GENERAL.—The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor or joint inventor of carrying out the invention. Claims 1, 7-8, 10-11, 14-22 are rejected under 35 U.S.C. 112(a), as failing to comply with the written description requirement. The claim(s) contains subject matter which was not described in the specification in such a way as to reasonably convey to one skilled in the relevant art that the inventor or a joint inventor, or for pre-AIA the inventor(s), at the time the application was filed, had possession of the claimed invention. To claim a genus under the written description requirement, the applicant is required to describe a representative number of species to reflect the variation within the genus or structures sufficient to define the genus. The factors to be considered include disclosure of complete or partial structure, physical and/or chemical properties, functional characteristics, structure/function correlation, methods of making the claimed product, or any combinations thereof. By court’s statement in Regents of the Univ. of Cal. v. Eli Lilly, 119 F.3d 1559, 1566, 43 USPQ2d 1398, 1404 (Fed. Cir. 1997), a written description of an invention “requires a precise definition, such as a structure, formula, or chemical name, of the claimed subject matter sufficient to distinguish it from other materials”; further, a written description of a claimed genus requires a description of a representative number of species of the claimed genus, and one of skill in the art should be able to “visualize or recognize the identity of the members of the genus”. Claims are broadly drawn to methods of silencing genes encoding a genus of peptides comprising as low as 34% sequence identity to SEQ ID NO: 131, 136, silencing a genus of gene orthologs of BADC1 (elected) or a genus of artificial genes containing essential BADC motifs (claim 10), and silencing a genus of sequences 34% sequence identity to SEQ ID NO: 2 and a genus of complement sequences of 34% sequence identity to SEQ ID NO: 2 (elected species, claim 11). The claimed functions are to increase the activity level of ACCase, and increase production of fatty acids and/or triacylglycerols. The specification describes the structure of SEQ ID NOs: 131 (231 aa, from Camelina sativa), 134 (elected species in new claim 22, 276 aa, from Camelina sativa) and 2 (2613 bp, from Arabidopsis) by providing sequence information. According to the specification ([0036]), SEQ ID NOs: 131 and 134 are polypeptide sequences of each BADC ortholog across various organisms. Orthologous proteins were identified by performing a PSI-BLAST search using the protein sequence of each BADC from Arabidopsis thaliana as the query against known plant and algae proteomes. According to the specification ([0030]), SEQ ID NO: 2 is a BADC1 full genomic nucleic acid sequence. The specification provides example of identifying BADC1 in Arabidopsis (Example 1 in [00161]-[00167]). The specification also provides example of expressing recombinant BADC to inhibit ACCase activity in Arabidopsis extract (Example 9 in [00185]-[00186]), and provides example of silencing BADC1 gene using RNAi cassette SEQ ID NO: 7 to increase oil production in Arabidopsis (Example 11 in [00188]-[00191]). Silencing works on both strains-coding strain and complement strain. However, the specification fails to describe the common structure feature of the genus of sequences having as low as 34% sequence identity to SEQ ID NO: 131, 136, and to SEQ ID NO: 2, and the common structure feature of the genus of gene orthologs of BADC1 (elected) or a genus of artificial genes containing essential BADC motifs. The specification does not provide any example that as high as 60% amino acids or bases of a BADC sequence can be deleted and/or substituted, such truncated or mutated sequence is still a BADC protein or a BADC gene. Regarding SEQ ID NO: 136 recited in claim 1 and new claim 22, according to the specification ([0039]), and confirmed in the sequence listing, SEQ ID NO: 136 is 44 amino acids of BADC consensus motif 1, with identical amino acid residues at positions 1, 2, 11, 12, 28, 29, 36, 38, and 42 (9 amino acids in 9 positions): VGXXXXXXXXKGXXXXXXXXXXXXXXXGQXXXXXXQXGXXXPXX 35 “X” amino acids can be any amino acids. The specification does not provide any example of silencing any polynucleotide encoding a 44 aa sequence (please note that the BADC1 sequence SEQ ID NO: 131 is a 231 aa sequence) can increase the activity level of ACCase, and increase production of fatty acids and/or triacylglycerols, not to mention demonstrate the 35 X amino acids can be changed in SEQ ID NO: 136, the changed sequence is still a BADC1 or a BADC sequence. Furthermore, please note that the 34% sequence identity (66% can be changed) does not require the 9 amino acids (20% of 44) are maintained. 66% change encompasses deleting or changing all of the 9 amino acids! According to the specification ([0036]), BADC orthologous proteins were identified by performing a PSI-BLAST search using the protein sequence of each BADC from Arabidopsis thaliana as the query against known plant and algae proteomes. However, Friedberg (Automated protein function prediction--the genomic challenge. Brief. Bioinformatics. 7:225-242, 2006) teaches that homology-based transfer is not reliable for functional annotation even with high- alignment percentages (page 227, second column). Friedberg also teaches that identification of functionally significant sub-regions is critical to functional annotation, and that often addition, deletion, or re-shuffling of domains can lead to errors in annotation (page 227, second column; page 228, 1st paragraph). Friedberg teaches that sequence-based tools are just not sensitive enough to identify functional protein similarity as databases get larger, and diversity of sequences gets larger (page 228, first full paragraph). Thus, the sequences and percentage identical thereof obtained by algorisms of bioinformatics tools are not consistent or reliable. Wang et al (From Protein Sequence to Protein Function via Multi-Label Linear Discriminant Analysis. IEEE/ACM TRANSACTIONS ON COMPUTATIONAL BIOLOGY AND BIOINFORMATICS, VOL. 14, NO. 3, 503-513, 2017) teach that FASTA and Basic Local Alignment Search Tool (BLAST) are useful but have limitations. Because a duplicate of a gene could adopt a new function in response to selective pressure during evolution, function transfer by homology on such gene and its product could produce erroneous results (p503, left col, 2nd para). There is no literature addressing the issue which criterion and which algorithm is optimal for protein function prediction. Moreover, genes evolve at different rates due to both uneven selection pressure on their functions and the inherent mutation rate of different species, which means that it is difficult to establish a similarity measure that is reliable in all cases (p504, left col, 1st para). Computational approaches to predict protein function is to assist biologist to discover new functional roles of proteins for experimental verification (p508, right col, last para). Thus, the sequences and percentage identical thereof obtained by algorisms of bioinformatics tools are not consistent or reliable. Experimental data is the most reliable, specifically for new proteins and new functions. In this case, BADC proteins and genes including SEQ ID NOs: 131, 134 and 2 are newly disclosed and characterized by the applicant. See “Remarks” at the end of office action. Thus, the orthologs sequences and percentage identical thereof (34% or 90%, for example) obtained by algorisms of bioinformatics tools are not consistent or reliable. Experimental data is the most reliable, specifically for the new proteins and the new functions. Regarding the description of a representative number of species, SEQ ID NO: 131 is a polypeptide sequence of 231 amino acids. For at least 34% sequence identity, up to 66%, or 152 amino acids, can be substituted, deleted, or added. Thus, (152+151+150+ ...... +3+2+1) x 20 amino acids can be substituted, deleted, or added, in all 231 positions. Even for at least 90% sequence identity, up to 10%, or 23 amino acids, can be substituted, deleted, or added. Thus, (23+22+21+ ...... +3+2+1) x 20 amino acids can be substituted, deleted, or added, in all 231 positions. In addition, and each peptide species of the genus can be 79-383 amino acids long. Thus, applicant claims an extremely large number of species. In addition, since the deletions, substitutions and insertions are random, the genus is also heterologous in structure. The same analysis can be applied to SEQ ID NO: 134 and SEQ ID NO: 2. The genus of gene orthologs of BADC1 (elected) or a genus of artificial genes containing essential BADC motifs have extremely large numbers and include sequences have yet to be found and can be found in the future. Thus, SEQ ID NOs: 131, 134 and 2 do not demonstrate the common structure feature of the huge genus as claimed, and are not sufficient to represent the huge genus as claimed. Therefore, the application has not met either of the two elements of the written description requirement as set forth in the court’s decision in Eli Lilly, and has not shown her/his possession of the claimed genus at the time of the application. Claim 13 recites a specific RNAi sequence, thus is deemed described, and is excluded from the rejection. Other dependent claims do not cure the deficiency thus are included. Double Patenting The nonstatutory double patenting rejection is based on a judicially created doctrine grounded in public policy (a policy reflected in the statute) so as to prevent the unjustified or improper timewise extension of the “right to exclude” granted by a patent and to prevent possible harassment by multiple assignees. A nonstatutory double patenting rejection is appropriate where the claims at issue are not identical, but at least one examined application claim is not patentably distinct from the reference claim(s) because the examined application claim is either anticipated by, or would have been obvious over, the reference claim(s). See, e.g., In re Berg, 140 F.3d 1428, 46 USPQ2d 1226 (Fed. Cir. 1998); In re Goodman, 11 F.3d 1046, 29 USPQ2d 2010 (Fed. Cir. 1993); In re Longi, 759 F.2d 887, 225 USPQ 645 (Fed. Cir. 1985); In re Van Ornum, 686 F.2d 937, 214 USPQ 761 (CCPA 1982); In re Vogel, 422 F.2d 438, 164 USPQ 619 (CCPA 1970); and In re Thorington, 418 F.2d 528, 163 USPQ 644 (CCPA 1969). A timely filed terminal disclaimer in compliance with 37 CFR 1.321(c) or 1.321(d) may be used to overcome an actual or provisional rejection based on a nonstatutory double patenting ground provided the reference application or patent either is shown to be commonly owned with this application, or claims an invention made as a result of activities undertaken within the scope of a joint research agreement. A terminal disclaimer must be signed in compliance with 37 CFR 1.321(b). The USPTO internet Web site contains terminal disclaimer forms which may be used. Please visit http://www.uspto.gov/forms/. The filing date of the application will determine what form should be used. A web-based eTerminal Disclaimer may be filled out completely online using web-screens. An eTerminal Disclaimer that meets all requirements is auto-processed and approved immediately upon submission. For more information about eTerminal Disclaimers, refer to http://www.uspto.gov/patents/process/file/efs/guidance/eTD-info-I.jsp. There are multiple rejections. The US Patents and instant application share inventors and the same applicant of University of Missouri. Claims 1, 7-8, 10-11, 13-15, 21-22 are rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1, 3-6, 8 of US Patent 11802286. The US Patent claims: Claim 1. A method of altering fatty acid and/or triacylglycerol production in plants and/or algae, comprising the step of altering activity levels of the committed step for de novo fatty acid biosynthesis, acetyl-CoA carboxylase (ACCase), wherein said altering step comprises increasing the activity level of ACCase by increasing expression of α-carboxyltransferase (α-CT) or a catalytic portion thereof, and total or partial silencing of one or more biotin/lipoyl attachment domain containing (BADC) gene, wherein said BADC gene comprises from about 90% to 100% sequence identity to a nucleotide sequence selected from the group consisting of SEQ ID NOs: 2, 4, or 6, or a complement thereof, in said plant and/or algae, and wherein said increased activity level of ACCase and said increased expression of α-CT is compared to a control plant and/or algae prior to altering activity levels of ACCase. Although the claims at issue are not identical, they are not patentably distinct from each other because: By sequence alignments, SEQ ID NOs: 2, 4, 6, 7 and 138 are identical in the USP and instant application. In fact, SEQ ID NOs: 2, 4, 6 are the species of instant sequences encoding SEQ ID NO: 136 or sequences at least 34% identical to SEQ ID NO: 136. Accordingly, the USP (reference) claims 1, 6 and 8 claim the same subject matter of instant claim 11 and therefore the parent claims of claim 11—claims 1 and 10, and instant claim 13 and 22 (also reciting SEQ ID NO: 136), in a narrower and more specific manner (higher % sequence identity in reference claims than in instant claims). The USP claim 3 teach the limitation of instant claim 7. The USP claims 4-5 teach the limitation of instant 8. Regarding claims 14-15 and 21, Ohlrogge et al (WO 1998005758; published 2/12/1998, filed 8/1/1997) teach that heterologous overexpressing (thus increased over control) ACCase and/or α-CT increases oil content of rapeseed (Brassica napus), and soybean/Glycine max (p5, lines 23-28). Particularly, Ohlrogge et al teach a method for increasing ACCase activity and for increasing oil by introducing/transforming into plant a heterologous construct comprising a heterologous α-CT gene, and growing said plant (p5, lines 23-28, claims 7 and 14). Ohlrogge et al teach and emphasize that the nucleic acid sequence encoding the alpha-carboxyltransferase (alpha-CT) subunit of acetyl-CoA carboxylase and its deduced amino acid sequence are provided (the first sentence of the Abstract). Ohlrogge et al teach (disclose and characterize) the α-CT sequences from Pisum sativum, that are 100% identical to instant SEQ ID NOs: 164. See “Sequence Matches” at the end of office action. Thus, although Ohlrogge et al do not use the exact term of catalytic portion of a-CT, the sequence of Ohlrogge et al is the same as instant SEQ ID NO: 164 and from Pisum sativum, the catalytic portion of a-CT. Thus, Ohlrogge et al discovered SEQ ID NO: 164 and characterized it as a a-CT subunit. Ohlrogge et al further teach and claim introducing a DNA construct comprising an isolated nucleic acid molecule encoding an a-carboxyltransferase (a-CT) subunit into a plant cell; and growing the cell into a plant (claim 7), and teach and claim a seed comprising the nucleic acid molecule encoding an a-carboxyltransferase (a-CT) subunit of acetyl-CoA carboxylase (claim 5). Thus, in view of Ohlrogge et al, instant claims 14-15 and 21 are deemed obvious, thus, are included. Therefore, the reference and instant claims are obvious over each other. Product claims 16-20 are excluded because during the prosecution of 16315140/ US Patent 11802286, the product claims were restricted and not rejoined. Claims 1, 7-8, 10-11, 14-22 are rejected on the ground of nonstatutory double patenting as being unpatentable over claim 3 of US Patent 10883113. The US Patent claims: Claim 3. A method of obtaining a transgenic plant comprising: (i) transforming plants with a recombinant nucleic acid molecule comprising a synthetic RNAi expression cassette that targets endogenous BADC1 gene in said transgenic plants to reduce or eliminate expression of a BADC1 protein encoded by said endogenous BADC1 gene, wherein said synthetic RNAi expression cassette comprises a heterologous promoter operably linked to an inverted repeat of at least 260 bp in size corresponding to a nucleotide sequence encoding said BADC1 protein, wherein said BADC1 protein has at least 95% amino acid sequence identity to SEQ ID NO: 1, and wherein said BADC1 protein lacks the conserved biotinylation motif and biotinyl lysine residue of a BCCP1 protein; and (ii) selecting a transgenic plant from the transgenic plants of step (i) that exhibits increase in the activity levels of the committed step for de novo fatty acid biosynthesis, acetyl-CoAcarboxylase (ACCase) and (ii) increase in fatty acid and/or triacylglycerol production in said transgenic plant as compared to a control plant of the same species lacking said recombinant nucleic acid molecule and grown under identical growth conditions. Although the claims at issue are not identical, they are not patentably distinct from each other because: By sequence alignments, SEQ ID NO: 1 (not instantly claimed) is identical in the USP (reference) and instant application. According to instant specification ([0029], [0030]), SEQ ID NO: 1 is the BADC1 polypeptide sequence, AT3G56130, biotin/lipoyl attachment domain-containing protein. SEQ ID NO: 2 is the BADC1 full genomic nucleic acid sequence, AT3G56130, biotin/lipoyl attachment domain-containing protein. In fact, sequences encoding SEQ ID NO: 1 are the species of instant sequences encoding SEQ ID NO: 136 or sequences at least 34% identical to SEQ ID NO: 136. Thus, SEQ ID NO: 1 is a species of instant claims 10 and parent claim 1. Thus, transforming plants with RNAi to inhibit BADC1 as claimed in reference claim 3 teach instant claims 1, and 10, 22 (reciting SEQ ID NO: 136 as in claim 1) in a narrower and more specific manner, except do not explicitly claim over-expressing catalytic portion of a-CT. As analyzed above, in view of Ohlrogge et al, over-expressing heterologous catalytic portion of a-CT is deemed obvious. Claim 11 is included because SEQ ID NO: 2 encodes SEQ ID NO: 1, and is a species of BADC1 gene of claim 10. Reference claims 1-2 teach instant claims 16-20. Also as analyzed above, the subject matter of alpha-CT including instant SEQ ID NO: 164 is taught by Ohlrogge et al. Thus, in view of Ohlrogge et al, instant claims 7-8, 14-15 and 21 are deemed obvious, thus, are included. Therefore, the reference and instant claims are obvious over each other. Claims 1, 7-8, 10-11, 13-22 are rejected on the ground of nonstatutory double patenting as being unpatentable over claim 1-11 of US Patent 11959087. The US Patent claims: Claim 1. A transgenic plant transformed with a recombinant nucleic acid molecule comprising an expression cassette which comprises a heterologous promoter operably linked to an inhibitory polynucleotide that targets an endogenous BADC1 gene in the transgenic plant to reduce or eliminate expression of a BADC1 protein encoded by the endogenous BADC1 gene, wherein the inhibitory polynucleotide encodes an antisense RNA or an RNAi directed towards said endogenous BADC1 gene, wherein said BADC1 protein has at least 95% amino acid sequence identity to SEQ ID NO: 1, wherein said BADC1 protein lacks the conserved biotinylation motif and biotinyl lysine residue of a BCCP1 protein, and wherein said transgenic plant expresses said inhibitory polynucleotide and exhibits (i) increase in the activity levels of the committed step for de novo fatty acid biosynthesis, acetyl-CoA carboxylase (ACCase) and (ii) increase in fatty acid and/or triacylglycerol production in said transgenic plant as compared to a control plant of the same species lacking said recombinant nucleic acid molecule and grown under identical growth conditions. Claim 9. A method of obtaining a transgenic plant comprising: (i) transforming plants with a recombinant nucleic acid molecule comprising an expression cassette which comprises a heterologous promoter operably linked to an inhibitory polynucleotide that targets an endogenous BADC1 gene in the transgenic plant to reduce or eliminate expression of a BADC1 protein encoded by the endogenous BADC1 gene, wherein the inhibitory polynucleotide encodes an anti-sense RNA or an RNAi directed towards said endogenous BADC1 gene, wherein said BADC1 protein has at least 95% amino acid sequence identity to SEQ ID NO: 1, wherein said BADC1 protein lacks the conserved biotinylation motif and biotinyl lysine residue of a BCCP1 protein; and (ii) selecting a transgenic plant from the transgenic plants of step (i) that exhibits increase in the activity levels of the committed step for de novo fatty acid biosynthesis, acetyl-CoA carboxylase (ACCase) and increase in fatty acid and/or triacylglycerol production in said transgenic plant as compared to a control plant of the same species lacking said recombinant nucleic acid molecule and grown under identical growth conditions. Although the claims at issue are not identical, they are not patentably distinct from each other because: By sequence alignments, SEQ ID NO: 1 is identical in the USP and instant application. In fact, sequences encoding SEQ ID NO: 1 are the species of instant sequences encoding SEQ ID NO: 136 or sequences at least 34% identical to SEQ ID NO: 136. As analyzed above, according to instant specification, SEQ ID NO: 2 encodes SEQ ID NO: 1, and is a species of BADC1 gene of claim 10. Thus, transforming plants with antisense or RNAi to inhibit BADC1 as claimed in USP claims 9-10 teach instant claims 10 and parent claim 1, and claim 22 (reciting SEQ ID NO: 136 as in claim 1) in a narrower and more specific manner (95% sequence identity to SEQ ID NO: 1), including the functional limitation of increase in seed oil content. Reference claim 1-5, 11 teach the subject matter of instant claims 14-20. As analyzed above, the subject matter of alpha-CT including instant SEQ ID NO: 164 is taught by Ohlrogge et al. Thus, in view of Ohlrogge et al, instant claims 7-8, 21 are deemed obvious, thus, are included. Therefore, the reference and instant claims are obvious over each other. Claims 1, 7-8, 10-11, 14-22 are rejected on the ground of nonstatutory double patenting as being unpatentable over claim 1-6, 9-16 of US Patent 12286649. The US patent claims: Claim 1. A method of increasing fatty acid and/or triacylglycerol production in plants and/or algae, comprising genetically modifying the plants and/or algae to increase activity levels of alpha-carboxyltransferase (α-CT) comprising the step of decreasing intracellular concentrations of one or more carboxyl transferase interactor (CTI) proteins with a polypeptide sequence having at least 95% sequence identity to a polypeptide sequence selected from the group consisting of SEQ ID NOs: 2, 4, and 6, and wherein the one or more CTI proteins inhibit activity levels of α-CT, wherein α-CT comprises a catalytic subunit of acetyl-CoA carboxylase (ACCase). Claim 10. A genetically modified plant having an increased activity level of alpha-carboxyltransferase (α-CT) and a decreased expression of one or more CTI genes in comparison to a wild-type plant of the same species grown under the same conditions, wherein α-CT comprises a catalytic subunit of acetyl-CoA carboxylase (ACCase), wherein the one or more CTI genes comprise a sequence having at least 95% sequence identity to a nucleotide sequence selected from the group consisting of SEQ ID NOs: 1, 3, 5, or a complement thereof, or wherein the one or more CTI genes encode a CTI protein with a polypeptide sequence having at least 95% sequence identity to a polypeptide sequence selected from the group consisting of SEQ ID NOs: 2, 4, and 6. Although the claims at issue are not identical, they are not patentably distinct from each other because: By Sequence alignment by the examiner, SEQ ID NOs: 1-6 are identical in the USP and instant application. In fact, sequences encoding SEQ ID NO: 1, 3, 5, and SEQ ID NOs: 2, 4, 6, are the species of instant sequences encoding SEQ ID NO: 136 or sequences at least 34% identical to SEQ ID NO: 136. Accordingly, reference claim 1-3 claims the same subject matter of instant claim 11 and the parent claims 10 and 1, and new claim 22 (reciting SEQ ID NO: 136 as claim 1 does) in a narrower and more specific manner (95% sequence identity vs 34%). Reference claims 2-5 teach the subject matter of instant claims 7-8. Reference claim 6 teaches the limitation of instant claims 14-15. Reference claims 10-16 teach the subject matter of instant claims 16-20. As analyzed above, the subject matter of alpha-CT including instant SEQ ID NO: 164 is taught by Ohlrogge et al. Thus, in view of Ohlrogge et al, instant claim 21 is deemed obvious, thus, is included. Therefore, the reference and instant claims are obvious over each other. Remarks According to the specification ([0007]), biotin/lipoyl attachment domain containing is abbreviated as (BADC). Prior art does not teach or suggest the combination structures and steps of the claimed method, particularly, does not teach or suggest total or partial silencing of one or more biotin/lipoyl attachment domain containing (BADC) gene in plant and/or algae to increase activity level of ACCase, and productions of fatty acids and/or triacylglycerol in plants or algae. Biotin/lipoyl attachment domain containing (BADC) protein and BADC1, BADC2 and BADC3 are recently disclosed. See Salie et al (A Family of Negative Regulators Targets the Committed Step of de Novo Fatty Acid Biosynthesis. The Plant Cell, Vol. 28: 2312–2325, September 2016). The reference was published after the instant filing date by University of Missouri. Besides the applicant, Keereetaweep (Biotin Attachment Domain-Containing Proteins Irreversibly Inhibit Acetyl CoA Carboxylase. Plant Physiology, Vol. 177, pp. 208–215, 2018, not prior art) also disclosed and described biotin attachment domain containing (BADC) protein and BADC1, BADC2 and BADC3 (p208, Abstract; p210-212, whole pages). In addition, applicant provides working example of silencing BADC1 gene (Examples 11- 12, [0188]-[0192]). Thus, claims 9-13, 17 are excluded from art rejections. Response to Arguments Claims particularly the independent claim 1 is significantly amended subject matter wise and language wise. Accordingly, all of the rejections are re-written by the examiner, including the 4 DP rejections. Thus, the arguments to the previous rejections are no longer applicable. Sequence Matches Against instant SEQ ID NO: 131 RESULT 1 A0ABM0W4G3_CAMSA ID A0ABM0W4G3_CAMSA Unreviewed; 263 AA. AC A0ABM0W4G3; DT 08-OCT-2025, integrated into UniProtKB/TrEMBL. DT 08-OCT-2025, sequence version 1. DT 08-OCT-2025, entry version 1. DE SubName: Full=Uncharacterized protein LOC104745878 {ECO:0000313|RefSeq:XP_010465548.1}; GN Name=LOC104745878 {ECO:0000313|RefSeq:XP_010465548.1}; OS Camelina sativa (False flax) (Myagrum sativum). OC Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; OC Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; OC rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina. OX NCBI_TaxID=90675 {ECO:0000313|Proteomes:UP000694864, ECO:0000313|RefSeq:XP_010465548.1}; RN [1] {ECO:0000313|Proteomes:UP000694864} RP NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. RC STRAIN=r\DH55 {ECO:0000313|Proteomes:UP000694864}; RX PubMed=9023104; RA Lowe T.M., Eddy S.R.; RT "tRNAscan-SE: a program for improved detection of transfer RNA genes in RT genomic sequence."; RL Nucleic Acids Res. 25:955-964(1997). RN [2] {ECO:0000313|Proteomes:UP000694864} RP NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. RC STRAIN=r\DH55 {ECO:0000313|Proteomes:UP000694864}; RX PubMed=24759634; RA Kagale S., Koh C., Nixon J., Bollina V., Clarke W.E., Tuteja R., RA Spillane C., Robinson S.J., Links M.G., Clarke C., Higgins E.E., RA Huebert T., Sharpe A.G., Parkin I.A.; RT "The emerging biofuel crop Camelina sativa retains a highly RT undifferentiated hexaploid genome structure."; RL Nat. Commun. 5:3706-3706(2014). RN [3] {ECO:0000313|RefSeq:XP_010465548.1} RP IDENTIFICATION. RC TISSUE=Leaf {ECO:0000313|RefSeq:XP_010465548.1}; RG RefSeq; RL Submitted (MAY-2025) to UniProtKB. CC --------------------------------------------------------------------------- CC Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms CC Distributed under the Creative Commons Attribution (CC BY 4.0) License CC --------------------------------------------------------------------------- DR RefSeq; XP_010465548.1; XM_010467246.2. DR Proteomes; UP000694864; Chromosome 15. PE 4: Predicted; KW Reference proteome {ECO:0000313|Proteomes:UP000694864}. SQ SEQUENCE 263 AA; 28049 MW; C1C61985DBEB8741 CRC64; Query Match 97.7%; Score 1117; Length 263; Best Local Similarity 87.8%; Matches 231; Conservative 0; Mismatches 0; Indels 32; Gaps 1; Qy 1 MASCSLGVPKIKISAVDLSRVSSGSLLIPFSQRSLLGQRPVKYLSLRTTFGSVKAVQVST 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MASCSLGVPKIKISAVDLSRVSSGSLLIPFSQRSLLGQRPVKYLSLRTTFGSVKAVQVST 60 Qy 61 VPTAETSATIEVEDSEETKSSPLNAQLVPKPSEVEALVTEICDSSSIAEFELKLGGFRLY 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 VPTAETSATIEVEDSEETKSSPLNAQLVPKPSEVEALVTEICDSSSIAEFELKLGGFRLY 120 Qy 121 VARDLTDKSSPQPHPVPAVAAASETTKSPDSNGSTPSTSLAITRPASSAADHGLMILQSP 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 VARDLTDKSSPQPHPVPAVAAASETTKSPDSNGSTPSTSLAITRPASSAADHGLMILQSP 180 Qy 181 KVGFFRRSKTIKGKRMPSSCKEKDQVKE-------------------------------- 208 |||||||||||||||||||||||||||| Db 181 KVGFFRRSKTIKGKRMPSSCKEKDQVKEGQILCYIEQLGGQFPIESDVSGEVVKILREDG 240 Qy 209 EPVGYNDALISILPSFPGIKKLQ 231 ||||||||||||||||||||||| Db 241 EPVGYNDALISILPSFPGIKKLQ 263 Against instant SEQ ID NO: 136 RESULT 20 A0A0D2VCK6_GOSRA ID A0A0D2VCK6_GOSRA Unreviewed; 168 AA. AC A0A0D2VCK6; DT 29-APR-2015, integrated into UniProtKB/TrEMBL. DT 29-APR-2015, sequence version 1. DT 08-OCT-2025, entry version 20. DE RecName: Full=Lipoyl-binding domain-containing protein {ECO:0000259|Pfam:PF00364}; GN ORFNames=B456_010G193700 {ECO:0000313|EMBL:KJB67495.1}; OS Gossypium raimondii (Peruvian cotton) (Gossypium klotzschianum subsp. OS raimondii). OC Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; OC Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; OC rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium. OX NCBI_TaxID=29730 {ECO:0000313|EMBL:KJB67495.1, ECO:0000313|Proteomes:UP000032304}; RN [1] {ECO:0000313|EMBL:KJB67495.1, ECO:0000313|Proteomes:UP000032304} RP NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. RX PubMed=23257886; DOI=10.1038/nature11798; RA Paterson A.H., Wendel J.F., Gundlach H., Guo H., Jenkins J., Jin D., RA Llewellyn D., Showmaker K.C., Shu S., Udall J., Yoo M.J., Byers R., RA Chen W., Doron-Faigenboim A., Duke M.V., Gong L., Grimwood J., Grover C., RA Grupp K., Hu G., Lee T.H., Li J., Lin L., Liu T., Marler B.S., Page J.T., RA Roberts A.W., Romanel E., Sanders W.S., Szadkowski E., Tan X., Tang H., RA Xu C., Wang J., Wang Z., Zhang D., Zhang L., Ashrafi H., Bedon F., RA Bowers J.E., Brubaker C.L., Chee P.W., Das S., Gingle A.R., Haigler C.H., RA Harker D., Hoffmann L.V., Hovav R., Jones D.C., Lemke C., Mansoor S., RA ur Rahman M., Rainville L.N., Rambani A., Reddy U.K., Rong J.K., RA Saranga Y., Scheffler B.E., Scheffler J.A., Stelly D.M., Triplett B.A., RA Van Deynze A., Vaslin M.F., Waghmare V.N., Walford S.A., Wright R.J., RA Zaki E.A., Zhang T., Dennis E.S., Mayer K.F., Peterson D.G., Rokhsar D.S., RA Wang X., Schmutz J.; RT "Repeated polyploidization of Gossypium genomes and the evolution of RT spinnable cotton fibres."; RL Nature 492:423-427(2012). CC --------------------------------------------------------------------------- CC Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms CC Distributed under the Creative Commons Attribution (CC BY 4.0) License CC --------------------------------------------------------------------------- DR EMBL; CM001749; KJB67495.1; -; Genomic_DNA. DR AlphaFoldDB; A0A0D2VCK6; -. DR Gramene; KJB67495; KJB67495; B456_010G193700. DR Proteomes; UP000032304; Chromosome 10. DR Gene3D; 2.40.50.100; -; 1. DR InterPro; IPR053217; ACC_Biotin_Carrier. DR InterPro; IPR000089; Biotin_lipoyl. DR InterPro; IPR011053; Single_hybrid_motif. DR PANTHER; PTHR47597; IS A MEMBER OF THE PF|00364 BIOTIN-REQUIRING ENZYMES FAMILY-RELATED; 1. DR PANTHER; PTHR47597:SF2; LIPOYL-BINDING DOMAIN-CONTAINING PROTEIN; 1. DR Pfam; PF00364; Biotin_lipoyl; 1. DR SUPFAM; SSF51230; Single hybrid motif; 1. PE 4: Predicted; KW Reference proteome {ECO:0000313|Proteomes:UP000032304}. FT DOMAIN 101..158 FT /note="Lipoyl-binding" FT /evidence="ECO:0000259|Pfam:PF00364" FT REGION 14..55 FT /note="Disordered" FT /evidence="ECO:0000256|SAM:MobiDB-lite" SQ SEQUENCE 168 AA; 17821 MW; 95F764E680426C2F CRC64; Query Match 100.0%; Score 85; Length 168; Best Local Similarity 20.5%; Matches 9; Conservative 35; Mismatches 0; Indels 0; Gaps 0; Qy 1 VGXXXXXXXXKGXXXXXXXXXXXXXXXGQXXXXXXQXGXXXPXX 44 ||::::::::||:::::::::::::::||::::::|:|:::|:: Db 90 VGTFRRGRTVKGKKQPPICREGDLIKEGQVIGFLDQFGIELPVK 133 Against instant SEQ ID NO: 2 AL163763 LOCUS AL163763 99492 bp DNA linear PLN 14-NOV-2006 DEFINITION Arabidopsis thaliana DNA chromosome 3, BAC clone F18O21. ACCESSION AL163763 VERSION AL163763.1 KEYWORDS . SOURCE Arabidopsis thaliana (thale cress) ORGANISM Arabidopsis thaliana Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis. REFERENCE 1 (bases 1 to 99492) AUTHORS Benes,V., Wurmbach,E., Drzonek,H., Ansorge,W., Mewes,H.W., Rudd,S., Lemcke,K., Mayer,K.F.X., Quetier,F. and Salanoubat,M. JOURNAL Unpublished REFERENCE 2 (bases 1 to 99492) AUTHORS EU Arabidopsis sequencing,project. TITLE Direct Submission JOURNAL Submitted (12-APR-2000) MIPS, at the Max-Planck-Institut fuer Biochemie, Am Klopferspitz 18a, D-82152 Martinsried, FRG, E-mail: lemcke@mips.biochem.mpg.de,mayer@mips.biochem.mpg.de Project Coordinator: Marcel Salanoubat and Francis Quetier, Groupement d'Interet Public, Centre National de Sequencage - GENOSCOPE; 2 rue Gaston Cremieux, BP191, 91006 Evry Cedex, France; http://www.genoscope.cns.fr COMMENT Information on performance of analysis and a more detailed annotation of this entry and other sequences of chromosomes 3, 4 and 5 can be viewed at: http://www.mips.biochem.mpg.de/proj/thal/ FEATURES Location/Qualifiers source 1..99492 /organism="Arabidopsis thaliana" /mol_type="genomic DNA" /db_xref="taxon:3702" /chromosome="3" /ecotype="Columbia" Query Match 100.0%; Score 2613; DB 357; Length 99492; Best Local Similarity 100.0%; Matches 2613; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 ACGGACCGTAGTGTAGTAGTAGATGCGGCGGACGGAGTTACCAAAGAAGAAGGCCGCTCA 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 29598 ACGGACCGTAGTGTAGTAGTAGATGCGGCGGACGGAGTTACCAAAGAAGAAGGCCGCTCA 29657 Qy 61 AAATAATTAAATTTGTTCAACCGTCATCTTCTTCAACTGATCTTAGCTCAACTAACACAC 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 29658 AAATAATTAAATTTGTTCAACCGTCATCTTCTTCAACTGATCTTAGCTCAACTAACACAC 29717 Qy 121 TCTTTCTTCTTGGCGTCAATTCAATCAACCAAAACCTTTTTCTCCTATCTAGCTCACGCT 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 29718 TCTTTCTTCTTGGCGTCAATTCAATCAACCAAAACCTTTTTCTCCTATCTAGCTCACGCT 29777 Qy 181 TTCTTCTTCTTCCAATGGCGTCTTCTGCAGCTCTCGGATCTCTCCATCGTGAGTCTCTTG 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 29778 TTCTTCTTCTTCCAATGGCGTCTTCTGCAGCTCTCGGATCTCTCCATCGTGAGTCTCTTG 29837 Qy 241 CTCTCTCACTCTCTGCGTTTTACTTATTCTGTTGATTTCATGAGGATAGGAAAACTAGAA 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 29838 CTCTCTCACTCTCTGCGTTTTACTTATTCTGTTGATTTCATGAGGATAGGAAAACTAGAA 29897 Qy 301 ATGGAGGACCATGAGTAAAATTTCGGAAATGAAAGGCATAGATTGGAGCTATCCGTTAGT 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 29898 ATGGAGGACCATGAGTAAAATTTCGGAAATGAAAGGCATAGATTGGAGCTATCCGTTAGT 29957 Qy 361 GACGTTGTTGCTTCTTAGAGTGTAATTTAGCGACTTAATTAAGTTTCAATCTCGGATCTT 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 29958 GACGTTGTTGCTTCTTAGAGTGTAATTTAGCGACTTAATTAAGTTTCAATCTCGGATCTT 30017 Qy 421 GTGTGTCTAATTTGTATCAAGAGATGTTTCAGCTAGAAAAAGTGAATTTTATTTGTTCCA 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 30018 GTGTGTCTAATTTGTATCAAGAGATGTTTCAGCTAGAAAAAGTGAATTTTATTTGTTCCA 30077 Qy 481 TTTTACAGAGACTTTAGGGTCAGCCATTAATTCACAGAGTGAGGTTCACTCGCTTTCTGG 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 30078 TTTTACAGAGACTTTAGGGTCAGCCATTAATTCACAGAGTGAGGTTCACTCGCTTTCTGG 30137 Qy 541 AAACTGGTCTGCCTCTGGTAATTCATGTGTGCCACGGTGGAGATTATCCAACAGGAACAG 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 30138 AAACTGGTCTGCCTCTGGTAATTCATGTGTGCCACGGTGGAGATTATCCAACAGGAACAG 30197 Qy 601 CAACTACAGGCTCGTGTTACGTGCTAAGGCCGCTAAATCTTCGACAACAACCATAAGTGA 660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 30198 CAACTACAGGCTCGTGTTACGTGCTAAGGCCGCTAAATCTTCGACAACAACCATAAGTGA 30257 Qy 661 TGGTGAGTTTATCTTCCACAATTCTTCTTCATGTTCATTTTGCTGGTTAATGCCTTTTTT 720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 30258 TGGTGAGTTTATCTTCCACAATTCTTCTTCATGTTCATTTTGCTGGTTAATGCCTTTTTT 30317 Qy 721 TACTATCAGGCTTGTCTCATCACTTTGCTAATACGATCCATTGGCCAAAGATGGTATTAA 780 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 30318 TACTATCAGGCTTGTCTCATCACTTTGCTAATACGATCCATTGGCCAAAGATGGTATTAA 30377 Qy 781 TCTGTTTTGCTCTTAAAGGAACTGGAACTGAAATTCTTAGTCTCGTTTGCTCTTAAAGGA 840 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 30378 TCTGTTTTGCTCTTAAAGGAACTGGAACTGAAATTCTTAGTCTCGTTTGCTCTTAAAGGA 30437 Qy 841 ACTAGAAATGTAACTGTAAGCCTCGGTCTTTTACCAGCTGTCTTGGAACCAGGAGATACA 900 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 30438 ACTAGAAATGTAACTGTAAGCCTCGGTCTTTTACCAGCTGTCTTGGAACCAGGAGATACA 30497 Qy 901 GTGATGTGATATTGGAACATTTTTCTTTTATTTCCTATGACTTTTGCTTATTTTTGGCTT 960 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 30498 GTGATGTGATATTGGAACATTTTTCTTTTATTTCCTATGACTTTTGCTTATTTTTGGCTT 30557 Qy 961 TGCAGGTTCATCTGATGCTAGTGTGTCAGACGGGAAGAAAACAGTTCGACGGATAACTTT 1020 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 30558 TGCAGGTTCATCTGATGCTAGTGTGTCAGACGGGAAGAAAACAGTTCGACGGATAACTTT 30617 Qy 1021 CCCGAAAGAAGTGGAGGTTTCTTCCTTGCCTTTCATGGGTCTTAGATATTAGGTTCTTTA 1080 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 30618 CCCGAAAGAAGTGGAGGTTTCTTCCTTGCCTTTCATGGGTCTTAGATATTAGGTTCTTTA 30677 Qy 1081 ATTTATAAGTTTGGTAGGTGATGATATGACGATTTCCTCAAATATGCACTTTCTAGATCG 1140 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 30678 ATTTATAAGTTTGGTAGGTGATGATATGACGATTTCCTCAAATATGCACTTTCTAGATCG 30737 Qy 1141 TCAGGATTTTGGATGCATAACTTCAGGCAATCTACTCTTATAATTTTTAATCATGACGTA 1200 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 30738 TCAGGATTTTGGATGCATAACTTCAGGCAATCTACTCTTATAATTTTTAATCATGACGTA 30797 Qy 1201 TGGATGTACCTTTCTTTATATGTTGTTAGATGAAATGTTGCAGGCACTGGTTCACGAGAT 1260 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 30798 TGGATGTACCTTTCTTTATATGTTGTTAGATGAAATGTTGCAGGCACTGGTTCACGAGAT 30857 Qy 1261 GTGTGATGAAACTGAGGTTGCTGTGCTGCAACTTAAGGCAAGTCTCTCTGCCATTAGTTT 1320 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 30858 GTGTGATGAAACTGAGGTTGCTGTGCTGCAACTTAAGGCAAGTCTCTCTGCCATTAGTTT 30917 Qy 1321 TAACTTCATTATTATTATTATTTGTAAACTTTCTTTGAGGCTACTACAAAGACGAGTGCA 1380 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 30918 TAACTTCATTATTATTATTATTTGTAAACTTTCTTTGAGGCTACTACAAAGACGAGTGCA 30977 Qy 1381 TTTTACTCAACCAACAATATGGGGCTAAATATCACTGATTTGAGATAATAGAATGTAGGT 1440 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 30978 TTTTACTCAACCAACAATATGGGGCTAAATATCACTGATTTGAGATAATAGAATGTAGGT 31037 Qy 1441 TCCAACAATTAGACTCTTCTGAAGCTTTCTTTTGCTACAGGTTGGAGATTTCGAGATGAA 1500 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 31038 TCCAACAATTAGACTCTTCTGAAGCTTTCTTTTGCTACAGGTTGGAGATTTCGAGATGAA 31097 Qy 1501 CCTAAAACGGAAGATTGGAGCAGCCACAAACCCCATTCCCGTGGCGGATATATCTCCAAC 1560 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 31098 CCTAAAACGGAAGATTGGAGCAGCCACAAACCCCATTCCCGTGGCGGATATATCTCCAAC 31157 Qy 1561 TGTAGCGCCTCCTATTCCTTCTGAACCTATGAATAAATCTGCTTCTTCGGCTCCTAGCCC 1620 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 31158 TGTAGCGCCTCCTATTCCTTCTGAACCTATGAATAAATCTGCTTCTTCGGCTCCTAGCCC 31217 Qy 1621 ATCTCAAGCAAAGCCTTCCTCTGAGAAAGTGTCTCCATTTAAGAATACATCATATGGGAA 1680 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 31218 ATCTCAAGCAAAGCCTTCCTCTGAGAAAGTGTCTCCATTTAAGAATACATCATATGGGAA 31277 Qy 1681 ACCAGCAAAGTTGGCTGCTTTGGAGGCATCTGGATCCACCAACTATGTGTTAGTCACATC 1740 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 31278 ACCAGCAAAGTTGGCTGCTTTGGAGGCATCTGGATCCACCAACTATGTGTTAGTCACATC 31337 Qy 1741 TCCCGCAGTATGAGATCCATTTCCTAATTAGTGGTTGCTTTCATATCCCTTAATTTCTCT 1800 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 31338 TCCCGCAGTATGAGATCCATTTCCTAATTAGTGGTTGCTTTCATATCCCTTAATTTCTCT 31397 Qy 1801 GCAGTTTTCTTGTTTGATTTGATCTTGTTTCTTCTCTTACCAAAAGGTGGGCAAGTTTCA 1860 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 31398 GCAGTTTTCTTGTTTGATTTGATCTTGTTTCTTCTCTTACCAAAAGGTGGGCAAGTTTCA 31457 Qy 1861 GAGGAGCAGAACTGTAAAAGGAAAGAAACAATCTCCTAGCTGCAAAGAGGTAAACGACTC 1920 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 31458 GAGGAGCAGAACTGTAAAAGGAAAGAAACAATCTCCTAGCTGCAAAGAGGTAAACGACTC 31517 Qy 1921 TAAATTCTTTTGCATCTCTTAGAACAAAAGAACAGAAATAAGATCAAAGAGCTAAGTGAA 1980 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 31518 TAAATTCTTTTGCATCTCTTAGAACAAAAGAACAGAAATAAGATCAAAGAGCTAAGTGAA 31577 Qy 1981 AAAAACTCCTTAGGGTGATGCAATAAAGGAAGGCCAAGTTATTGGATACTTACATCAGTT 2040 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 31578 AAAAACTCCTTAGGGTGATGCAATAAAGGAAGGCCAAGTTATTGGATACTTACATCAGTT 31637 Qy 2041 GGGAACAGAACTTCCAGTGACGGTAATATCTTAACTAATATATCCATCTCTTCTTTGAAA 2100 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 31638 GGGAACAGAACTTCCAGTGACGGTAATATCTTAACTAATATATCCATCTCTTCTTTGAAA 31697 Qy 2101 CTATCTAATCAGACTCATCGATCTTGCTATTTGTCGAGCAGTCAGATGTAGCTGGAGAAG 2160 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 31698 CTATCTAATCAGACTCATCGATCTTGCTATTTGTCGAGCAGTCAGATGTAGCTGGAGAAG 31757 Qy 2161 TCCTTAAGCTTCTTTCAGATGACGGAGGTAAACATTTGAGTATTCAAACCGTTTCATTTA 2220 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 31758 TCCTTAAGCTTCTTTCAGATGACGGAGGTAAACATTTGAGTATTCAAACCGTTTCATTTA 31817 Qy 2221 GTATGAACATTCAGAAATTATATAAGTGAATTGATATGAACTCATGCTTCGTGTGCAAAC 2280 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 31818 GTATGAACATTCAGAAATTATATAAGTGAATTGATATGAACTCATGCTTCGTGTGCAAAC 31877 Qy 2281 AGACTCCGTAGGTTATGGAGATCCTCTGGTTGCAGTCTTGCCATCTTTCCACGACATCAA 2340 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 31878 AGACTCCGTAGGTTATGGAGATCCTCTGGTTGCAGTCTTGCCATCTTTCCACGACATCAA 31937 Qy 2341 CATCCAGTGATGATGGTTTCTTCAGCCCAATTCCATAGCAAATGAATAGTCTTTCATCCG 2400 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 31938 CATCCAGTGATGATGGTTTCTTCAGCCCAATTCCATAGCAAATGAATAGTCTTTCATCCG 31997 Qy 2401 GAGACTGTACTATTCATCTTCTCCTGTGTTTGTTCAATGAAGATTTGTAATCTGTTTAGT 2460 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 31998 GAGACTGTACTATTCATCTTCTCCTGTGTTTGTTCAATGAAGATTTGTAATCTGTTTAGT 32057 Qy 2461 TGCAAAGAGTCTACTTTGATCTTGCTCTCATCATTTGTCACGTAATGTGGATTTTCTGCA 2520 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 32058 TGCAAAGAGTCTACTTTGATCTTGCTCTCATCATTTGTCACGTAATGTGGATTTTCTGCA 32117 Qy 2521 CCAGAGAAAAAAAACAATTGTGGAATTTTTATAGAAATGACGTGGCTATCTTATCTTCTC 2580 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 32118 CCAGAGAAAAAAAACAATTGTGGAATTTTTATAGAAATGACGTGGCTATCTTATCTTCTC 32177 Qy 2581 CGATCATCAAATAAAATCAAGGCTCAAAAATTC 2613 ||||||||||||||||||||||||||||||||| Db 32178 CGATCATCAAATAAAATCAAGGCTCAAAAATTC 32210 Against instant SEQ ID NO: 7 US-13-322-299-8/c ; Sequence 8, Application US/13322299 ; Publication No. US20120102600A1 ; GENERAL INFORMATION ; APPLICANT: Nadolska-Orczyk, Anna ; APPLICANT:Galuszka, Petr ; APPLICANT:Zalewski, Wojciech ; APPLICANT:Orczyk, Waclaw ; TITLE OF INVENTION: A DNA cassette, binary vector, and strain of A. tumefaciens and a ; TITLE OF INVENTION:method of producing cereal plant with increased productivity ; TITLE OF INVENTION:and/or root mass ; FILE REFERENCE: 36021-0002US1 ; CURRENT APPLICATION NUMBER: US/13/322,299 ; CURRENT FILING DATE: 2011-11-23 ; PRIOR APPLICATION NUMBER: PCT/PL2010/050019 ; PRIOR FILING DATE: 2010-05-27 ; PRIOR APPLICATION NUMBER: PL 388118 ; PRIOR FILING DATE: 2009-05-27 ; NUMBER OF SEQ ID NOS: 36 ; SOFTWARE: PatentIn version 3.3 ; SEQ ID NO 8 ; LENGTH: 5431 ; TYPE: DNA ; ORGANISM: artificial sequence ; FEATURE: ; OTHER INFORMATION: silencing cassette for gene TaCKX1 US-13-322-299-8 Query Match 68.3%; Score 1145.2; DB 42; Length 5431; Best Local Similarity 99.3%; Matches 1150; Conservative 0; Mismatches 8; Indels 0; Gaps 0; Qy 268 GAGCTCCACTGAATTGAATTGTTTAAGGTTTGGTGAGCCTAAAAGAATTTGAACTGGTTT 327 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3892 GAGCTCCACTGAATTGAATTGTTTAAGGTTTGGTGAGCCTAAAAGAATTTGAACTGGTTT 3833 Qy 328 TCAAATAAATGAATTAAGATGTTAATTAGGAGAATTGAAGTTTATTACAATTTGGATTGG 387 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3832 TCAAATAAATGAATTAAGATGTTAATTAGGAGAATTGAAGTTTATTACAATTTGGATTGG 3773 Qy 388 GGATTAGAATTTGAAGCTACATTTAAAATTCGAAAAAAAAAGACAGTGAAACTTAAAACG 447 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3772 GGATTAGAATTTGAAGCTACATTTAAAATTCGAAAAAAAAAGACAGTGAAACTTAAAACG 3713 Qy 448 TTCATAAAAAGGACCAAAAGTTTTTAAAAAAATTGTCGCTAAAACTCAAACATATATATT 507 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3712 TTCATAAAAAGGACCAAAAGTTTTTAAAAAAATTGTCGCTAAAACTCAAACATATATATT 3653 Qy 508 ACAATGCCATATGTGCTTATAAGGACTTAAGGAGCAGTTTCTTGGGTGGCTAGGGGATAT 567 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3652 ACAATGCCATATGTGCTTATAAGGACTTAAGGAGCAGTTTCTTGGGTGGCTAGGGGATAT 3593 Qy 568 GACATTTTTTTACTGCACAATAAATATCCTGGCCGTTGCACCCGGAGATGCACAGAGCTT 627 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3592 GACATTTTTTTACTGCACAATAAATATCCTGGCCGTTGCACCCGGAGATGCACAGAGCTT 3533 Qy 628 TGAGCAGATCAGATGAATGATTAAATTGTTTTGAAGAGAATCTATTCCTTCACACTGAAT 687 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3532 TGAGCAGATCAGATGAATGATTAAATTGTTTTGAAGAGAATCTATTCCTTCACACTGAAT 3473 Qy 688 TCTTGCACAAAACCTTGACACTGAATTTAATTGTGCCAAATCAACAATTCTTTTAGCCCA 747 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3472 TCTTGCACAAAACCTTGACACTGAATTTAATTGTGCCAAATCAACAATTCTTTTAGCCCA 3413 Qy 748 GGAAATATAATCCATTTTTTAATTTTCTGCTACTTATTTTCATCTTCTTAATACAAAGAT 807 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3412 GGAAATATAATCCATTTTTTAATTTTCTGCTACTTATTTTCATCTTCTTAATACAAAGAT 3353 Qy 808 ATACAAGTATTTTGCATATTCAGATTTTTTTTTGCCAAAACAATAAATCTAGCTATATAC 867 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3352 ATACAAGTATTTTGCATATTCAGATTTTTTTTTGCCAAAACAATAAATCTAGCTATATAC 3293 Qy 868 ATTTTCCTTTGACCAACTCGGCTACTAAAATTGGTTGGATTCTGATTTTACTATTTGTGA 927 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3292 ATTTTCCTTTGACCAACTCGGCTACTAAAATTGGTTGGATTCTGATTTTACTATTTGTGA 3233 Qy 928 ATTTCAATCTTAGCTTTGACCTATACCCAAAATAAACCCTCCTGATCTGTTTCTCCAGTG 987 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3232 ATTTCAATCTTAGCTTTGACCTATACCCAAAATAAACCCTCCTGATCTGTTTCTCCAGTG 3173 Qy 988 GCGAGAGACATGATTTAACGAGAGTTGAACACAAGATCTAGACTCTAGAATAAAAAAAGA 1047 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3172 GCGAGAGACATGATTTAACGAGAGTTGAACACAAGATCTAGACTCTAGAATAAAAAAAGA 3113 Qy 1048 CACGAATATTAGAAAATGATCTAATATAAAATAATTATAAGGAGTGAGACTTCAAATCTA 1107 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3112 CACGAATATTAGAAAATGATCTAATATAAAATAATTATAAGGAGTGAGACTTCAAATCTA 3053 Qy 1108 GGTCAGCTAGCCCACCATCTTGTGGAGCTAGTTGGAAAACCCCTGGGTGTGTTTCTCTAG 1167 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3052 GGTCAGCTAGCCCACCATCTTGTGGAGCTAGTTGGAAAACCCCTGGGTGTGTTTCTCTAG 2993 Qy 1168 ACTCTAGAATAACATTGATCAGCCTAACCAAACATAACGAACGAAGATTTAATATCAGGA 1227 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2992 ACTCTAGAATAACATTGATCAGCCTAACCAAACATAACGAACGAAGATTTAATATCAGGA 2933 Qy 1228 CATATATATGGATCTTGGCAAGTCAATTAATTAATTAATTAATTTCCAGCCCAACACCTT 1287 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2932 CATATATATGGATCTTGGCAAGTCAATTAATTAATTAATTAATTTCCAGCCCAACACCTT 2873 Qy 1288 ACAGAAATTAGCATGTATGAGACTACTTGTAAGGAAAAACGAGCAATGAAAGATGCATGT 1347 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2872 ACAGAAATTAGCATGTATGAGACTACTTGTAAGGAAAAACGAGCAATGAAAGATGCATGT 2813 Qy 1348 GATCGATCTGAATAAGAGGGGAAACAAAGAATTATAAACATATATGTATACCTTCCTAGG 1407 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2812 GATCGATCTGAATAAGAGGGGAAACAAAGAATTATAAACATATATGTATACCTTCCTAGG 2753 Qy 1408 GATGTTGATGTCGTGGAA 1425 ||||| | | || | Db 2752 GATGTCCTGGCCTGGGGA 2735 Against instant SEQ ID NO: 138 RESULT 2 US-10-966-482-18/c (NOTE: this sequence has 1 duplicate in the database searched. See complete list at the end of this report) Sequence 18, US/10966482 Publication No. US20050081261A1 GENERAL INFORMATION APPLICANT: Pennell, Roger I. APPLICANT: Dang, Van Dinh TITLE OF INVENTION: Methods and Compositions for Altering TITLE OF INVENTION: Seed Phenotypes FILE REFERENCE: 18207-002001 CURRENT APPLICATION NUMBER: US/10/966,482 CURRENT FILING DATE: 2004-10-14 PRIOR APPLICATION NUMBER: US 60/510,924 PRIOR FILING DATE: 2003-10-14 NUMBER OF SEQ ID NOS: 50 SEQ ID NO 18 LENGTH: 1951 TYPE: DNA ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: Synthetically generated FEATURE: NAME/KEY: misc_feature LOCATION: (0)...(0) OTHER INFORMATION: 5'-UTR p524d05p3_gDNA Query Match 68.5%; Score 1130.2; Length 1951; Best Local Similarity 98.9%; Matches 1138; Conservative 0; Mismatches 13; Indels 0; Gaps 0; Qy 244 TAGATTTAAAACTTGCTGGCACTGAATTGAATTGTTTAAGGTTTGGTGAGCCTAAAAGAA 303 | | | | || | |||||||||||||||||||||||||||||||||||||||||| Db 1935 TTGCTGTGGAAGATCTCTGCACTGAATTGAATTGTTTAAGGTTTGGTGAGCCTAAAAGAA 1876 Qy 304 TTTGAACTGGTTTTCAAATAAATGAATTAAGATGTTAATTAGGAGAATTGAAGTTTATTA 363 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1875 TTTGAACTGGTTTTCAAATAAATGAATTAAGATGTTAATTAGGAGAATTGAAGTTTATTA 1816 Qy 364 CAATTTGGATTGGGGATTAGAATTTGAAGCTACATTTAAAATTCGAAAAAAAAAGACAGT 423 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1815 CAATTTGGATTGGGGATTAGAATTTGAAGCTACATTTAAAATTCGAAAAAAAAAGACAGT 1756 Qy 424 GAAACTTAAAACGTTCATAAAAAGGACCAAAAGTTTTTAAAAAAATTGTCGCTAAAACTC 483 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1755 GAAACTTAAAACGTTCATAAAAAGGACCAAAAGTTTTTAAAAAAATTGTCGCTAAAACTC 1696 Qy 484 AAACATATATATTACAATGCCATATGTGCTTATAAGGACTTAAGGAGCAGTTTCTTGGGT 543 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1695 AAACATATATATTACAATGCCATATGTGCTTATAAGGACTTAAGGAGCAGTTTCTTGGGT 1636 Qy 544 GGCTAGGGGATATGACATTTTTTTACTGCACAATAAATATCCTGGCCGTTGCACCCGGAG 603 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1635 GGCTAGGGGATATGACATTTTTTTACTGCACAATAAATATCCTGGCCGTTGCACCCGGAG 1576 Qy 604 ATGCACAGAGCTTTGAGCAGATCAGATGAATGATTAAATTGTTTTGAAGAGAATCTATTC 663 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1575 ATGCACAGAGCTTTGAGCAGATCAGATGAATGATTAAATTGTTTTGAAGAGAATCTATTC 1516 Qy 664 CTTCACACTGAATTCTTGCACAAAACCTTGACACTGAATTTAATTGTGCCAAATCAACAA 723 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1515 CTTCACACTGAATTCTTGCACAAAACCTTGACACTGAATTTAATTGTGCCAAATCAACAA 1456 Qy 724 TTCTTTTAGCCCAGGAAATATAATCCATTTTTTAATTTTCTGCTACTTATTTTCATCTTC 783 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1455 TTCTTTTAGCCCAGGAAATATAATCCATTTTTTAATTTTCTGCTACTTATTTTCATCTTC 1396 Qy 784 TTAATACAAAGATATACAAGTATTTTGCATATTCAGATTTTTTTTTGCCAAAACAATAAA 843 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1395 TTAATACAAAGATATACAAGTATTTTGCATATTCAGATTTTTTTTTGCCAAAACAATAAA 1336 Qy 844 TCTAGCTATATACATTTTCCTTTGACCAACTCGGCTACTAAAATTGGTTGGATTCTGATT 903 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1335 TCTAGCTATATACATTTTCCTTTGACCAACTCGGCTACTAAAATTGGTTGGATTCTGATT 1276 Qy 904 TTACTATTTGTGAATTTCAATCTTAGCTTTGACCTATACCCAAAATAAACCCTCCTGATC 963 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1275 TTACTATTTGTGAATTTCAATCTTAGCTTTGACCTATACCCAAAATAAACCCTCCTGATC 1216 Qy 964 TGTTTCTCCAGTGGCGAGAGACATGATTTAACGAGAGTTGAACACAAGATCTAGACTCTA 1023 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1215 TGTTTCTCCAGTGGCGAGAGACATGATTTAACGAGAGTTGAACACAAGATCTAGACTCTA 1156 Qy 1024 GAATAAAAAAAGACACGAATATTAGAAAATGATCTAATATAAAATAATTATAAGGAGTGA 1083 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1155 GAATAAAAAAAGACACGAATATTAGAAAATGATCTAATATAAAATAATTATAAGGAGTGA 1096 Qy 1084 GACTTCAAATCTAGGTCAGCTAGCCCACCATCTTGTGGAGCTAGTTGGAAAACCCCTGGG 1143 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1095 GACTTCAAATCTAGGTCAGCTAGCCCACCATCTTGTGGAGCTAGTTGGAAAACCCCTGGG 1036 Qy 1144 TGTGTTTCTCTAGACTCTAGAATAACATTGATCAGCCTAACCAAACATAACGAACGAAGA 1203 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1035 TGTGTTTCTCTAGACTCTAGAATAACATTGATCAGCCTAACCAAACATAACGAACGAAGA 976 Qy 1204 TTTAATATCAGGACATATATATGGATCTTGGCAAGTCAATTAATTAATTAATTAATTTCC 1263 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 975 TTTAATATCAGGACATATATATGGATCTTGGCAAGTCAATTAATTAATTAATTAATTTCC 916 Qy 1264 AGCCCAACACCTTACAGAAATTAGCATGTATGAGACTACTTGTAAGGAAAAACGAGCAAT 1323 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 915 AGCCCAACACCTTACAGAAATTAGCATGTATGAGACTACTTGTAAGGAAAAACGAGCAAT 856 Qy 1324 GAAAGATGCATGTGATCGATCTGAATAAGAGGGGAAACAAAGAATTATAAACATATATGT 1383 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 855 GAAAGATGCATGTGATCGATCTGAATAAGAGGGGAAACAAAGAATTATAAACATATATGT 796 Qy 1384 ATACCTTCCAG 1394 ||| ||| ||| Db 795 ATAACTTGCAG 785 Against instant SEQ ID NO: 164 RESULT 3 AAV17622 ID AAV17622 standard; cDNA; 3274 BP. XX AC AAV17622; XX DT 03-AUG-1998 (first entry) XX DE Pisum sativum ACCase alpha-carboxyltransferase subunit gene. XX KW alpha-carboxyltransferase; acetyl-CoA carboxylase; alpha-CT; ACCase; KW malonyl-CoA; fatty acid; synthesis; elongation; oil content; increase; KW rapeseed; soybean; oilseed crop; low-fat; peanuts; polyhydroxybutyrate; KW medicinal; use; protection; plant pathogens; ds. XX OS Pisum sativum. XX FH Key Location/Qualifiers FT CDS 259..2886 FT /*tag= a FT /function= "malonyl-CoA synthesis from acetyl-CoA" FT /product= "ACCase alpha-carboxyltransferase subunit" XX CC PN WO9805758-A1. XX CC PD 12-FEB-1998. XX CC PF 01-AUG-1997; 97WO-US013532. XX PR 02-AUG-1996; 96US-0023384P. XX CC PA (UNMS ) UNIV MICHIGAN STATE. XX CC PI Ohlrogge JB, Shorrosh BS; XX DR WPI; 1998-145601/13. DR P-PSDB; AAW48309. XX CC PT Alpha-carboxyltransferase enzyme is subunit of plant acetyl-CoA CC PT carboxylase - useful for modifying fatty acid content of seed and CC PT producing herbicide-resistant plants. XX CC PS Claim 3; Page 19-23; 38pp; English. XX CC The sequence is that encoding the alpha-carboxyltransferase (ACT) subunit CC of plant acetyl-CoA carboxylase (ACCase). The ACT subunit can be used to CC control carboxylation of acetyl-CoA to produce malonyl-CoA. By CC introducing constructs of the gene in sense or anti-sense orientation, CC carboxylation of acetyl-CoA to produce malonyl-CoA may be increased or CC decreased. Consequently, fatty acid synthesis and elongation in plants CC and seeds which is dependent on malonyl-CoA may also be controlled. CC Increasing seed fatty acid synthesis by overexpressing the gene is useful CC in increasing oil content of rapeseed, soybean, or other oilseed crops. CC Decreasing seed fatty acid synthesis by decreasing gene expression is CC also useful in producing low-fat seeds such as low-fat peanuts. Altering CC expression of the gene may favourably alter the amount of acetyl-CoA or CC malonyl-CoA available for production of secondary plant products, many of CC which have value in plant protection against pathogens or for medicinal CC or other uses. Inhibition of the fatty acid synthesis pathway may be CC desirable to allow diversion of more carbon into products other than CC fatty acids, e.g. increasing the acetyl-CoA to malonyl-CoA ratio by CC decreasing ACC gene expression may allow more carbon flux into CC polyhydroxybutyrate production thereby resulting in higher yields of CC polyhydroxybutyrate or other acetyl-CoA derived products XX SQ Sequence 3274 BP; 997 A; 605 C; 767 G; 905 T; 0 U; 0 Other; Query Match 100.0%; Score 1215; Length 3274; Best Local Similarity 100.0%; Matches 1215; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 ATGGCTTCCTCTTCTGCAACTCTTGTTGGTTCTACTGCTTCTGATCTTCTCAGGAGTTCA 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 259 ATGGCTTCCTCTTCTGCAACTCTTGTTGGTTCTACTGCTTCTGATCTTCTCAGGAGTTCA 318 Qy 61 ACTACTGGTTTCACTGGTGTCCCTTTGAGAACCTTGGGAAGGGCAGGGTTGGTCTTGAAA 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 319 ACTACTGGTTTCACTGGTGTCCCTTTGAGAACCTTGGGAAGGGCAGGGTTGGTCTTGAAA 378 Qy 121 AGAAGGGATTTAACTGTTAGTGTTACTGCTAAGTTGAGGAAGGTGAAGAGGCGTGAATAT 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 379 AGAAGGGATTTAACTGTTAGTGTTACTGCTAAGTTGAGGAAGGTGAAGAGGCGTGAATAT 438 Qy 181 CCATGGTCAAGTAACCCTGATCCCAATATGAAAGGTGGGCGGTTGCGTCATCTCTCAACG 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 439 CCATGGTCAAGTAACCCTGATCCCAATATGAAAGGTGGGCGGTTGCGTCATCTCTCAACG 498 Qy 241 TTCCAGCCACTCAAACAGCCGCCAAAGCCTGTTATTTTGGAGTTTGAAAAGCCTCTTATT 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 499 TTCCAGCCACTCAAACAGCCGCCAAAGCCTGTTATTTTGGAGTTTGAAAAGCCTCTTATT 558 Qy 301 AATATGGAAAAGAAGATTAATGATTTTCGGAAGGTGGCAGAAAAAACTGGTGTGGATTTA 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 559 AATATGGAAAAGAAGATTAATGATTTTCGGAAGGTGGCAGAAAAAACTGGTGTGGATTTA 618 Qy 361 AGTGATCAGATTCTCGCATTGGAGGCTAAGTACCAAAAGGCTTTGGTGGAATTGTATACA 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 619 AGTGATCAGATTCTCGCATTGGAGGCTAAGTACCAAAAGGCTTTGGTGGAATTGTATACA 678 Qy 421 AATCTAACTCCTATACAGCGGGTCACCGTTGCACGGCATCCTAACAGGCCTACTTTCCTG 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 679 AATCTAACTCCTATACAGCGGGTCACCGTTGCACGGCATCCTAACAGGCCTACTTTCCTG 738 Qy 481 GATCACATGTATAACATGACTGAAAAGTTTGTGGAACTCCATGGTGATCGTGAAGGATAC 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 739 GATCACATGTATAACATGACTGAAAAGTTTGTGGAACTCCATGGTGATCGTGAAGGATAC 798 Qy 541 GATGATCCTGCTATTGCCGCTGGTCTAGGGAGTATAGATGGTAAAACCTACATGTTCATC 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 799 GATGATCCTGCTATTGCCGCTGGTCTAGGGAGTATAGATGGTAAAACCTACATGTTCATC 858 Qy 601 GGCCACCAAAAGGGTAGAGATACTAAAGAAAATATTAAGCGTAACTTTGCGATGCCAACT 660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 859 GGCCACCAAAAGGGTAGAGATACTAAAGAAAATATTAAGCGTAACTTTGCGATGCCAACT 918 Qy 661 CCACACGGTTATAGGAAAGCTCTGCGCTTGATGGAATATGCAGATCATCACGGGTTCCCG 720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 919 CCACACGGTTATAGGAAAGCTCTGCGCTTGATGGAATATGCAGATCATCACGGGTTCCCG 978 Qy 721 ATAGTTACTTTCATTGACACCCCTGGGGCATTTGCTGACCTCAAATCCGAGCAACTTGGT 780 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 979 ATAGTTACTTTCATTGACACCCCTGGGGCATTTGCTGACCTCAAATCCGAGCAACTTGGT 1038 Qy 781 CAAGGTGAAGCAATTGCTCATAATTTGAGATCCATGTTTGCTCTGAAGGTGCCAGTTATT 840 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1039 CAAGGTGAAGCAATTGCTCATAATTTGAGATCCATGTTTGCTCTGAAGGTGCCAGTTATT 1098 Qy 841 TCTATAGTTATTGGCGAAGGTGGATCTGGCGGTGCCCTTGCCATTGGATGTGCTAATAAA 900 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1099 TCTATAGTTATTGGCGAAGGTGGATCTGGCGGTGCCCTTGCCATTGGATGTGCTAATAAA 1158 Qy 901 TTACTCATGCTTGAAAATTCAGTGTTCTTTGTTGCCATGCCAGAGGCATGCGGTGCAATC 960 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1159 TTACTCATGCTTGAAAATTCAGTGTTCTTTGTTGCCATGCCAGAGGCATGCGGTGCAATC 1218 Qy 961 TTGTGGAAGAGTAATAAAGCTGCTCCAAAGGCTGCTGAGCGACTGAAGATTACAGCATCT 1020 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1219 TTGTGGAAGAGTAATAAAGCTGCTCCAAAGGCTGCTGAGCGACTGAAGATTACAGCATCT 1278 Qy 1021 GCATTGTTGGATTTGGAAATTGCAGATGGCATTATACCGGAGCCCCTGGCTGGTGCACAT 1080 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1279 GCATTGTTGGATTTGGAAATTGCAGATGGCATTATACCGGAGCCCCTGGCTGGTGCACAT 1338 Qy 1081 ACTGATCCAAGTTGGATGTCTCAACAGATTAAAATTGCAATCAATGAAGCTATGGATGAA 1140 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1339 ACTGATCCAAGTTGGATGTCTCAACAGATTAAAATTGCAATCAATGAAGCTATGGATGAA 1398 Qy 1141 CTCACCAAGTTGAGCACAGAAGACCTAATAAAAGATCGCATGCATAAGTTCCGAAAACTC 1200 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1399 CTCACCAAGTTGAGCACAGAAGACCTAATAAAAGATCGCATGCATAAGTTCCGAAAACTC 1458 Qy 1201 GGTGTTGATGGGATC 1215 ||||||||||||||| Db 1459 GGTGTTGATGGGATC 1473 Against instant SEQ ID NO: 134 RESULT 1 A0A8T1ZNN9_9BRAS (NOTE: this sequence has 1 duplicate in the database searched. See complete list at the end of this report) ID A0A8T1ZNN9_9BRAS Unreviewed; 281 AA. AC A0A8T1ZNN9; DT 12-OCT-2022, integrated into UniProtKB/TrEMBL. DT 12-OCT-2022, sequence version 1. DT 03-MAY-2023, entry version 4. DE SubName: Full=Biotin/lipoyl attachment {ECO:0000313|EMBL:KAG7561052.1}; GN ORFNames=ISN45_Aa05g025110 {ECO:0000313|EMBL:KAG7561052.1}; OS Arabidopsis thaliana x Arabidopsis arenosa. OC Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; OC Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; OC rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis. OX NCBI_TaxID=1240361 {ECO:0000313|EMBL:KAG7561052.1, ECO:0000313|Proteomes:UP000694240}; RN [1] {ECO:0000313|EMBL:KAG7561052.1} RP NUCLEOTIDE SEQUENCE. RC STRAIN=Allo738 {ECO:0000313|EMBL:KAG7561052.1}; RC TISSUE=Leaf {ECO:0000313|EMBL:KAG7561052.1}; RA Chen Z.; RT "Concerted genomic and epigenomic changes stabilize Arabidopsis RT allopolyploids."; RL Submitted (DEC-2020) to the EMBL/GenBank/DDBJ databases. CC -!- CAUTION: The sequence shown here is derived from an EMBL/GenBank/DDBJ CC whole genome shotgun (WGS) entry which is preliminary data. CC {ECO:0000313|EMBL:KAG7561052.1}. CC --------------------------------------------------------------------------- CC Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms CC Distributed under the Creative Commons Attribution (CC BY 4.0) License CC --------------------------------------------------------------------------- DR EMBL; JAEFBK010000010; KAG7561052.1; -; Genomic_DNA. DR Proteomes; UP000694240; Chromosome 10. DR CDD; cd06850; biotinyl_domain; 1. DR InterPro; IPR000089; Biotin_lipoyl. DR PANTHER; PTHR47597; IS A MEMBER OF THE PF|00364 BIOTIN-REQUIRING ENZYMES FAMILY-RELATED; 1. DR PANTHER; PTHR47597:SF2; LIPOYL-BINDING DOMAIN-CONTAINING PROTEIN; 1. DR Pfam; PF00364; Biotin_lipoyl; 1. PE 4: Predicted; FT DOMAIN 196..271 FT /note="Lipoyl-binding" FT /evidence="ECO:0000259|Pfam:PF00364" FT REGION 140..173 FT /note="Disordered" FT /evidence="ECO:0000256|SAM:MobiDB-lite" FT COMPBIAS 147..172 FT /note="Polar residues" FT /evidence="ECO:0000256|SAM:MobiDB-lite" SQ SEQUENCE 281 AA; 29787 MW; B6AFB680E6C90364 CRC64; Query Match 89.9%; Score 1259.5; Length 281; Best Local Similarity 88.6%; Matches 249; Conservative 14; Mismatches 13; Indels 5; Gaps 2; Qy 1 MASSAALGSLHQTLG----SQSELHLLSGNWSASGTSCVPRWRLSNRSSNYTLVLRAKAS 56 ||||||||||||||| ||||:| |||||||| |||||||||||:| |||||||||: Db 1 MASSAALGSLHQTLGFAINSQSEVHSFSGNWSASGNSCVPRWRLSNRNSKYTLVLRAKAA 60 Qy 57 KTSTTTKSDDSSDATVSNGKKSVRRTTFPKEVEALVHEMCDETEVAVLKLKVGDFEMNLK 116 |:|| |||||||:|:||||||:||| ||||||||||||||||||||||:||||||||||| Db 61 KSSTATKSDDSSEASVSNGKKTVRRITFPKEVEALVHEMCDETEVAVLQLKVGDFEMNLK 120 Qy 117 RKIGAATNPIPVEDISPTVAPPIPSEPMDKSVSSAPSPSKAKP-SEKVSPFMNTSYGKPA 175 |||||||||||: |||||:|||||||||:|||||||||||||| ||||||| |||||||| Db 121 RKIGAATNPIPMADISPTIAPPIPSEPMNKSVSSAPSPSKAKPSSEKVSPFKNTSYGKPA 180 Qy 176 KLVALEASGSNNYVLVKSPSVGEFHRSRTVKGKKLSPSCKEGDEIKEGQVIGYLHQLGTE 235 || ||||||||||||| ||:||:| ||||||||| |||||||| |||||||||||||||| Db 181 KLAALEASGSNNYVLVTSPAVGKFQRSRTVKGKKQSPSCKEGDAIKEGQVIGYLHQLGTE 240 Qy 236 LPVTSDVAGEVLKLLSDDGDSVGYGDPLVAVLPSFHDINIQ 276 ||||||||||||||||||||||||||||||:|||||||||| Db 241 LPVTSDVAGEVLKLLSDDGDSVGYGDPLVAILPSFHDINIQ 281 Conclusion No claim is allowed. Contact information Any inquiry concerning this communication or earlier communications from the examiner should be directed to WAYNE ZHONG whose telephone number is (571)270-0311. The examiner can normally be reached 8:30am to 5:00pm EST. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Bratislav Stankovic, can be reached on 571-270-0305. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /Wayne Zhong/ Primary Examiner, Art Unit 1662
Read full office action

Prosecution Timeline

Sep 12, 2023
Application Filed
Dec 25, 2024
Non-Final Rejection — §112, §DP
Jun 02, 2025
Response Filed
Aug 20, 2025
Final Rejection — §112, §DP
Oct 21, 2025
Response after Non-Final Action
Nov 12, 2025
Examiner Interview Summary
Nov 12, 2025
Applicant Interview (Telephonic)
Jan 21, 2026
Request for Continued Examination
Jan 27, 2026
Response after Non-Final Action
Mar 16, 2026
Non-Final Rejection — §112, §DP (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12600978
PROCESS FOR PRODUCING LIPIDS
2y 5m to grant Granted Apr 14, 2026
Patent 12599072
PLANTS AND SEEDS OF HYBRID CORN VARIETY CH010552
2y 5m to grant Granted Apr 14, 2026
Patent 12600976
MAIZE GENE KRN2 AND USES THEREOF
2y 5m to grant Granted Apr 14, 2026
Patent 12593767
PROTOPLAST ISOLATION AND REGENERATION OF PLANTS
2y 5m to grant Granted Apr 07, 2026
Patent 12593793
SOYBEAN VARIETY 01094778
2y 5m to grant Granted Apr 07, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

AI Strategy Recommendation

Get an AI-powered prosecution strategy using examiner precedents, rejection analysis, and claim mapping.
Powered by AI — typically takes 5-10 seconds

Prosecution Projections

3-4
Expected OA Rounds
72%
Grant Probability
94%
With Interview (+22.3%)
3y 0m
Median Time to Grant
High
PTA Risk
Based on 524 resolved cases by this examiner. Grant probability derived from career allow rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month