Prosecution Insights
Last updated: July 17, 2026
Application No. 18/468,515

HIV VACCINES AND METHODS OF MAKING AND USING

Non-Final OA §102§103
Filed
Sep 15, 2023
Priority
Jul 16, 2019 — provisional 62/874,712 +1 more
Examiner
ALSOMAIRY, SARAH ABDOALATIF
Art Unit
1646
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Gilead Sciences Inc.
OA Round
1 (Non-Final)
59%
Grant Probability
Moderate
1-2
OA Rounds
5m
Est. Remaining
86%
With Interview

Examiner Intelligence

Grants 59% of resolved cases
59%
Career Allowance Rate
83 granted / 141 resolved
-1.1% vs TC avg
Strong +27% interview lift
Without
With
+27.2%
Interview Lift
resolved cases with interview
Typical timeline
3y 3m
Avg Prosecution
41 currently pending
Career history
185
Total Applications
across all art units

Statute-Specific Performance

§101
0.7%
-39.3% vs TC avg
§103
51.1%
+11.1% vs TC avg
§102
8.3%
-31.7% vs TC avg
§112
13.0%
-27.0% vs TC avg
Black line = Tech Center average estimate • Based on career data from 141 resolved cases

Office Action

§102 §103
Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . DETAILED ACTION Claims 1, 5, 8, 9, 10, 11, 15, 18, 19, 23, 34, 40, 46, 47, and 130 are pending. Claim Rejections - 35 USC § 102 The following is a quotation of the appropriate paragraphs of 35 U.S.C. 102 that form the basis for the rejections under this section made in this Office action: A person shall be entitled to a patent unless – (a)(1) the claimed invention was patented, described in a printed publication, or in public use, on sale, or otherwise available to the public before the effective filing date of the claimed invention. (a)(2) the claimed invention was described in a patent issued under section 151, or in an application for patent published or deemed published under section 122(b), in which the patent or application, as the case may be, names another inventor and was effectively filed before the effective filing date of the claimed invention. Claim(s) 1, 5, 10-11, 15, 18-19, 23, 34, 40, 46, 47, and 130 are rejected under 35 U.S.C. 102(a)(1) and (a)(2) as being anticipated by Feinberg et al (WO2005028634 A1; Published 3/31/2005), Feinberg teaches a fusion polypeptide comprising an amino acid sequence of instantly claimed SEQ ID NO: 359. [see sequence alignments below], Feinberg teaches that the full-length of the fusion polypeptide comprises polypeptide segments encoded by HIV-1 genes Pol and Env, is at least 335 amino acids and up to 970 amino acids, wherein the fusion polypeptide is capable of inducing, promoting or stimulating proliferation and/or activation of one or more cell types selected from monocyte-derived dendritic cells (DCs), CD8+ T cells, and CD4+ T-cells. [pg 8, lines 16-19, claim 29; pg 40 lines 16-25-pg 41] Regarding claim 5, Feinberg teaches that the fusion polypeptide does not comprise an HIV-1 Pol polypeptide segment comprising amino acid sequence YMDD (SEQ ID NO: 462) or YVDD (SEQ ID NO: 463). Regarding claim 10, Feinberg teaches a polynucleotide encoding one or more fusion polypeptides of claim 1 Regarding claim 11, Feinberg teaches that the polynucleotide comprises cDNA or MRNA. [pg 16, lines 21-25 – pg 17 lines 1-10; pg 31] Regarding claim 15, Feinberg teaches an expression cassette comprising a polynucleotide of claim 10 operably linked to one or more regulatory sequences. [pg 28, lines 4-10] Regarding claims 18 and 19, Feinberg teaches a vector comprising one or more polynucleotides of claim 10, wherein the vector is a plasmid vector, a bacterial vector or a viral vector. Regarding claim 23, Feinberg Viral vector is from a virus from the family of poxvirdiae. [pg 43] Regarding claim 34, Feinberg teaches a host cell comprising one or more polynucleotides. Regarding claim 40, Feinberg teaches an immunogenic composition comprising one or more of the fusion polypeptides and a pharmaceutically acceptable carrier (40) Regarding claim 46, Feinberg teaches A pharmaceutical composition comprising one or more fusion polypeptides of claim 1 and a carrier. [pg 14, lines 1-14; pg 50] Regarding claim 130, Feinberg teaches that the fusion polypeptide comprises an amino acid sequence of instantly claimed SEQ ID NO: 364. [see sequence alignment below] SEQUENCE ALIGNMENT: SEQ ID NO: 359 RESULT 7 ADY99929 ID ADY99929 standard; protein; 2602 AA. XX AC ADY99929; XX DT 16-JUN-2005 (first entry) XX DE Human codon-optmized HIV B Gag-Pol-Env-Nef fusion protein. XX KW gag; pol; env; nef; fusion protein; viral replication; recombinant DNA; KW vector; vaccine; cancer; infectious disease; HIV; hepatitis; KW variola virus infection; immune stimulation; antimicrobial; virucide; KW anti-HIV; cytostatic; antiinflammatory; hepatotropic; immunogenicity. XX OS Homo sapiens. OS Human immunodeficiency virus 1. XX CC PN WO2005028634-A2. XX CC PD 31-MAR-2005. XX CC PF 20-SEP-2004; 2004WO-US030849. XX PR 18-SEP-2003; 2003US-0504030P. XX CC PA (UYEM-) UNIV EMORY. XX CC PI Feinberg MMD, Garber D; XX DR WPI; 2005-254126/26. DR N-PSDB; ADY99928. XX CC PT New recombinant modified vaccinia Ankara virus comprising first null CC PT mutation in vaccinia gene, useful for treating or preventing viral CC PT infection (e.g. HIV, hepatitis and smallpox), and cancer. XX CC PS Claim 69; SEQ ID NO 57; 324pp; English. XX CC This invention relates to a novel recombinant modified vaccinia Ankara CC virus (rMVA). Specifically, it refers to the use of rMVA vectors in the CC development of vaccines to protect against cancer or infectious viral CC diseases such as HIV, hepatitis and smallpox. The present invention CC describes introducing a null mutation (preferably a deletion) into a CC vaccinia gene that is necessary for replication of the rMVA, in CC particular an exemplary gene is the vaccinia uracil DNA glycosylase gene. CC Additional vaccinia genes that can contain null mutations include, but CC are not limited to, IL1 beta receptor, A46R, IL-18BP, A41L and E3L. CC Accordingly, it provides a system for producing an appropriate vaccine CC that involves an immortalized, non-transformed avian fibroblast cell CC infected with the rMVA, where the cell is from a complementing cell line CC that is engineered to express the gene necessary for viral replication, CC such that the virus is able to propagate. Furthermore, the rMVA may CC include a heterologous nucleic acid sequence encoding an antigen or a CC fragment thereof derived from viral, animal or plant polynucleotides, for CC example this may include an antigen from the HIV virus, measles virus, CC SARS virus, influenza virus, malaria plasmodium, tuberculosis Bacillus, CC yellow fever virus, dengue flavivirus or the river blindness nematode. CC The rMVA also comprises a second heterologous nucleic acid sequence CC encoding a pro-apoptotic, anti-apoptotic or an immunomodulator operably CC linked to an early stage viral promoter. As such, the developed vaccine CC can be administered in a sufficient amount to effect an immune response CC in a host and exhibits antimicrobial, virucide, anti-HIV, cytostatic, CC antiinflammatory and hepatotropic activities. This polypeptide sequence CC is a human codon-optimized HIV-1 consensus fusion protein sequence, CC encoded by an antigenic sequence of an MVA-based vector given in an CC exemplification of the invention. XX SQ Sequence 2602 AA; Query Match 60.2%; Score 1524; Length 2602; Best Local Similarity 27.1%; Matches 404; Conservative 1; Mismatches 0; Indels 1086; Gaps 3; Qy 1 GTVLVGPTPVNIIGRNLLTQIGCTLNFPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKA 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 636 GTVLVGPTPVNIIGRNLLTQIGCTLNFPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKA 695 Qy 61 LVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLG 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 696 LVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLG 755 Qy 121 IPHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGW 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 756 IPHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGW 815 Qy 181 KGSPAIFQSSM------------------------------------------------- 191 ||||||||||| Db 816 KGSPAIFQSSMTKILEPFRKQNPDIVIYQYMNDLYVGSDLEIGQHRTKIEELRQHLLRWG 875 Qy 192 ------------------------------------------------------------ 191 Db 876 FTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAG 935 Qy 192 ------------------------------------------------------------ 191 Db 936 IKVKQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQG 995 Qy 192 ------------------------------------------------------------ 191 Db 996 QGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKIATESIVIWGKTPKFKLPI 1055 Qy 192 ------------------------------------------------------------ 191 Db 1056 QKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLG 1115 Qy 192 ------------------------------------------------------------ 191 Db 1116 KAGYVTDRGRQKVVSLTDTTNQKTELQAIHLALQDSGLEVNIVTDSQYALGIIQAQPDKS 1175 Qy 192 ------------------------------------------------------------ 191 Db 1176 ESELVSQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVLFLDGIDKAQEEHE 1235 Qy 192 ------------------------------------------------------------ 191 Db 1236 KYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKII 1295 Qy 192 --------------------------------------------------TTVKAACWWA 201 |||||||||| Db 1296 LVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWA 1355 Qy 202 GIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGG 261 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1356 GIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGG 1415 Qy 262 YSAGERIVDII------------------------------------------------- 272 ||||||||||| Db 1416 YSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQD 1475 Qy 273 ------------------------------------------------------------ 272 Db 1476 NSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDEDQLLNFDLLKLAGDVESNPGPGWATM 1535 Qy 273 ------------------------------------------------------------ 272 Db 1536 RVKGIRKNYQHLWRWGTMLLGMLMICSAAEQLWVTVYYGVPVWKEATTTLFCASDAKAYD 1595 Qy 273 ------------------------------------------------------------ 272 Db 1596 TEVHNVWATHACVPTDPNPQEVVLENVTENFNMWKNNMVEQMHEDIISLWDQSLKPCVKL 1655 Qy 273 ------------------------------------------------------------ 272 Db 1656 TPLCVTLNCTDLRNATNTTSSSWETMEKGEIKNCSFNITTSIRDKVQKEYALFYNLDVVP 1715 Qy 273 -------------------------------------------------------NVSTV 277 ||||| Db 1716 IDNASYRLISCNTSVITQACPKVSFEPIPIHYCAPAGFAILKCNDKKFNGTGPCTNVSTV 1775 Qy 278 QCTHGIRPVVSTQLLLNGSLAEE------------------------------------- 300 ||||||||||||||||||||||| Db 1776 QCTHGIRPVVSTQLLLNGSLAEEEVVIRSENFTDNAKTIIVQLNESVEINCTRPNNNTRK 1835 Qy 301 ------------------------------------------------------------ 300 Db 1836 SINIGPGRALYTTGEIIGDIRQAHCNISRAKWNNTLKQIVIKLREQFGNKTIVFNQSSGG 1895 Qy 301 ------------------------------------------------------------ 300 Db 1896 DPEIVMHSFNCGGEFFYCNSTQLFTWNDTRKLNNTGRNITLPCRIKQIINMWQEVGKAMY 1955 Qy 301 ------------------------------------------------------------ 300 Db 1956 APPIRGQIRCSSNITGLLLTRDGGKDTNGTEIFRPGGGDMRDNWRSELYKYKVVKIEPLG 2015 Qy 301 ------KRRVVQREKRAVGIGAMFLGFLGAAGSTMGAASITLTVQARQLLSGIVQQQNNL 354 |||||||||||||||||||||||||||||||||:|||||||||||||||||||| Db 2016 VAPTKAKRRVVQREKRAVGIGAMFLGFLGAAGSTMGAASMTLTVQARQLLSGIVQQQNNL 2075 Qy 355 LRAIEAQQHLLQLTVWGIKQLQARVLAVERYLKDQQLLGIWGCSGKLICTT 405 ||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2076 LRAIEAQQHLLQLTVWGIKQLQARVLAVERYLKDQQLLGIWGCSGKLICTT 2126 SEQ ID NO: 364 RESULT 21 ADY99901 ID ADY99901 standard; protein; 1005 AA. XX AC ADY99901; XX DT 16-JUN-2005 (first entry) XX DE Human codon-optmized HIV B Pol protein. XX KW pol; viral replication; recombinant DNA; vector; vaccine; cancer; KW infectious disease; HIV; hepatitis; variola virus infection; KW immune stimulation; antimicrobial; virucide; anti-HIV; cytostatic; KW antiinflammatory; hepatotropic; immunogenicity. XX OS Homo sapiens. OS Human immunodeficiency virus 1. XX CC PN WO2005028634-A2. XX CC PD 31-MAR-2005. XX CC PF 20-SEP-2004; 2004WO-US030849. XX PR 18-SEP-2003; 2003US-0504030P. XX CC PA (UYEM-) UNIV EMORY. XX CC PI Feinberg MMD, Garber D; XX DR WPI; 2005-254126/26. DR N-PSDB; ADY99900. XX CC PT New recombinant modified vaccinia Ankara virus comprising first null CC PT mutation in vaccinia gene, useful for treating or preventing viral CC PT infection (e.g. HIV, hepatitis and smallpox), and cancer. XX CC PS Claim 69; SEQ ID NO 29; 324pp; English. XX CC This invention relates to a novel recombinant modified vaccinia Ankara CC virus (rMVA). Specifically, it refers to the use of rMVA vectors in the CC development of vaccines to protect against cancer or infectious viral CC diseases such as HIV, hepatitis and smallpox. The present invention CC describes introducing a null mutation (preferably a deletion) into a CC vaccinia gene that is necessary for replication of the rMVA, in CC particular an exemplary gene is the vaccinia uracil DNA glycosylase gene. CC Additional vaccinia genes that can contain null mutations include, but CC are not limited to, IL1 beta receptor, A46R, IL-18BP, A41L and E3L. CC Accordingly, it provides a system for producing an appropriate vaccine CC that involves an immortalized, non-transformed avian fibroblast cell CC infected with the rMVA, where the cell is from a complementing cell line CC that is engineered to express the gene necessary for viral replication, CC such that the virus is able to propagate. Furthermore, the rMVA may CC include a heterologous nucleic acid sequence encoding an antigen or a CC fragment thereof derived from viral, animal or plant polynucleotides, for CC example this may include an antigen from the HIV virus, measles virus, CC SARS virus, influenza virus, malaria plasmodium, tuberculosis Bacillus, CC yellow fever virus, dengue flavivirus or the river blindness nematode. CC The rMVA also comprises a second heterologous nucleic acid sequence CC encoding a pro-apoptotic, anti-apoptotic or an immunomodulator operably CC linked to an early stage viral promoter. As such, the developed vaccine CC can be administered in a sufficient amount to effect an immune response CC in a host and exhibits antimicrobial, virucide, anti-HIV, cytostatic, CC antiinflammatory and hepatotropic activities. This polypeptide sequence CC is a human codon-optimized HIV-1 consensus protein sequence, encoded by CC an antigenic sequence of an MVA-based vector given in an exemplification CC of the invention. XX SQ Sequence 1005 AA; Query Match 37.5%; Score 1757.5; Length 1005; Best Local Similarity 45.7%; Matches 424; Conservative 63; Mismatches 136; Indels 305; Gaps 28; Qy 14 LCGAVFVSARGTVLVGPTPVNIIGRNLLTQIGCTLNFPISPIETVPVKLKPGMDGPKVKQ 73 :|| | |||||||||||||||||||||||||||||||||||||||||||||||||| Db 124 ICGH---KAIGTVLVGPTPVNIIGRNLLTQIGCTLNFPISPIETVPVKLKPGMDGPKVKQ 180 Qy 74 WPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKR 133 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 WPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKR 240 Qy 134 TQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIR 193 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 TQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNETPGIR 300 Qy 194 YQYNVLPQGWKGSPAIFQSSMTTVKAACWWAGIKQEFGIPYNPQSQGVV--ESMN----- 246 |||||||||||||||||||||| : |: |: :| : || Db 301 YQYNVLPQGWKGSPAIFQSSMTKILE-------------PFRKQNPDIVIYQYMNDLYVG 347 Qy 247 KELKKIIGQVRDQAEHL--------------------------------KTAVQMAVF-- 272 :|: ||| | : | | | || | Db 348 SDLE--IGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPE 405 Qy 273 -----IHNFKRKGG--------------------IGGYSAGERIV--------------- 292 ::: :: | : | | :: Db 406 KDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVIPLTEEAELELAENRE 465 Qy 293 ---------------DII---------------------NVST--------------VQC 302 |:| |: | | Db 466 ILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQL 525 Qy 303 THGIRPVVSTQLLLNGSLAEEKRRV---------------------------------VQ 329 | :: : : ::: | : | : | Db 526 TEAVQKIATESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ 585 Qy 330 REKRAVGIGAMFLGFLGAAG--STMGAA-------------------------SITLTVQ 362 || : :|| ||| : :| | :| | :| Db 586 LEKEPI-VGAETFYVDGAANRETKLGKAGYVTDRGRQKVVSLTDTTNQKTELQAIHLALQ 644 Qy 363 ARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARVLAVERYLKDQQLLGIW---- 418 | || | |:|| : :| ::: :|: :| ::: | Db 645 DSGLEVNIVTDSQYALGIIQAQPDKSE------SELVSQI--IEQLIKKEKVYLAWVPAH 696 Qy 419 -GCSG-----KLICT------------------------------------TVAKEIVAS 436 | | ||: |||||||| Db 697 KGIGGNEQVDKLVSAGIRKVLFLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVAS 756 Qy 437 CDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAY 496 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 757 CDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAY 816 Qy 497 FLLKLAGRWPVKTL------------------WVTV--YYGVPVWKEAAFPQITLWQRPL 536 |||||||||||||: | : :|:| : : : : | Db 817 FLLKLAGRWPVKTIHTDNGSNFTSTTVKAACWWAGIKQEFGIP-YNPQSQGVVESMNKEL 875 Qy 537 VTIKIGGQLKEAL--LDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQAAAAHNV 594 || ||::: | | | :| | |||||: :| : Db 876 K--KIIGQVRDQAEHLKTAVQMAVFIH-----NFKRK--GGIGGY---------SAGERI 917 Qy 595 WATHACVPTDPNPQEAITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVV 654 | |: |||||||||||||||||||||||||||||||||||||||||||| Db 918 VDIIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVV 977 Qy 655 PRRKAKIIRDYGKQMAGDDCVASRQDED 682 |||||||||||||||||||||||||||| Db 978 PRRKAKIIRDYGKQMAGDDCVASRQDED 1005 Claim Rejections - 35 USC § 103 The following is a quotation of 35 U.S.C. 103 which forms the basis for all obviousness rejections set forth in this Office action: A patent for a claimed invention may not be obtained, notwithstanding that the claimed invention is not identically disclosed as set forth in section 102, if the differences between the claimed invention and the prior art are such that the claimed invention as a whole would have been obvious before the effective filing date of the claimed invention to a person having ordinary skill in the art to which the claimed invention pertains. Patentability shall not be negated by the manner in which the invention was made. Claim(s) 1, 5, 8, 9, 10-11, 15, 18-19, 23, 34, 40, 46, 47 and 130 are rejected under 35 U.S.C. 103 as being unpatentable over Feinberg et al (WO2005028634 A1; Published 3/31/2005), in view of Chappell et al (US11254712 B2, Priority to: 03/301/2017). The teachings of Feinberg are recited above. However, Feinberg does not explicitly teach that the fusion polypeptide comprises an N-terminal signal peptide or leader sequence as recited in claims 8 and 9. Chappell teaches a HIV fusion protein or polypeptide as a vaccine. Chappell teaches the use of a leader sequence and/or an N-terminal signal peptide. Chappell teaches the use of colony stimulating factor 2 (CSF-2) and CD74. Chappell teaches the use of a leader sequence for targeting to the secretory pathway in a selected host cell. It is noted that claims 8 and 9 require that the fusion polypeptide comprises an N-terminal signal peptide or leader sequence. It would have been prima facie obvious to one of ordinary skill in the art at the time the invention was filed to attach an N-terminal signal peptide or leader sequence to the fusion polypeptide of Feinberg. One would have been motivated to, and have a reasonable expectation of success, because: (1) Feinberg and Chappell teaches expressing HIV fusion polypeptide as an immunogenic composition, and (2) Chappell teaches the routine use of a leader sequence and/or N-terminal signal peptide. Conclusion Any inquiry concerning this communication or earlier communications from the examiner should be directed to SARAH A ALSOMAIRY whose telephone number is (571)272-0027. The examiner can normally be reached Monday-Friday 7:30 AM to 5:30 PM. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Gregory Emch can be reached at (571) 272-8149. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /SARAH A ALSOMAIRY/Examiner, Art Unit 1646 /Zachariah Lucas/Supervisory Patent Examiner, Art Unit 1600
Read full office action

Prosecution Timeline

Sep 15, 2023
Application Filed
May 27, 2026
Non-Final Rejection mailed — §102, §103 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12667606
FORMULATIONS OF PROTEIN MOLECULES COMPRISING IDURONATE 2-SULFATASE
4y 9m to grant Granted Jun 30, 2026
Patent 12668644
ANTIBODY-BASED METHOD TO IDENTIFY, PURIFY, AND MANIPULATE CELL TYPES AND PROCESSES
4y 7m to grant Granted Jun 30, 2026
Patent 12668632
Bispecific Anti-MUC16 x Anti-CD28 Antibodies and Uses Thereof
3y 10m to grant Granted Jun 30, 2026
Patent 12655451
TAL- effector nuclease (TALEN) -MODIFIED ALLOGENIC CELLS SUITABLE FOR THERAPY
7y 2m to grant Granted Jun 16, 2026
Patent 12649923
COMPOSITION COMPRISING EMP3 INHIBITOR FOR INHIBITING GROWTH OF CANCER STEMCELL AND USE THEREOF
4y 1m to grant Granted Jun 09, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

Strategy Recommendation AI-generated — please review before filing

Get a prosecution strategy drawn from examiner precedents, rejection analysis, and claim mapping.
Typically takes 5-10 seconds — AI-generated, attorney review required before filing

Prosecution Projections

1-2
Expected OA Rounds
59%
Grant Probability
86%
With Interview (+27.2%)
3y 3m (~5m remaining)
Median Time to Grant
Low
PTA Risk
Based on 141 resolved cases by this examiner. Grant probability derived from career allowance rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month