Prosecution Insights
Last updated: April 19, 2026
Application No. 18/537,754

SELECTION BY ESSENTIAL-GENE KNOCK-IN

Non-Final OA §103§112§DP
Filed
Dec 12, 2023
Examiner
HILL, KEVIN KAI
Art Unit
1638
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Editas Medicine Inc.
OA Round
5 (Non-Final)
36%
Grant Probability
At Risk
5-6
OA Rounds
3y 7m
To Grant
70%
With Interview

Examiner Intelligence

Grants only 36% of cases
36%
Career Allow Rate
304 granted / 845 resolved
-24.0% vs TC avg
Strong +34% interview lift
Without
With
+33.7%
Interview Lift
resolved cases with interview
Typical timeline
3y 7m
Avg Prosecution
75 currently pending
Career history
920
Total Applications
across all art units

Statute-Specific Performance

§101
5.8%
-34.2% vs TC avg
§103
33.6%
-6.4% vs TC avg
§102
20.1%
-19.9% vs TC avg
§112
29.8%
-10.2% vs TC avg
Black line = Tech Center average estimate • Based on career data from 845 resolved cases

Office Action

§103 §112 §DP
Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Continued Examination Under 37 CFR 1.114 A request for continued examination under 37 CFR 1.114, including the fee set forth in 37 CFR 1.17(e), was filed in this application after final rejection. Since this application is eligible for continued examination under 37 CFR 1.114, and the fee set forth in 37 CFR 1.17(e) has been timely paid, the finality of the previous Office action has been withdrawn pursuant to 37 CFR 1.114. Applicant's submission filed on December 23, 2025 has been entered. Detailed Action This action is in response to the papers filed December 23, 2025. Amendments Applicant's response and amendments, filed December 23, 2025, is acknowledged. Applicant has cancelled Claims 1-144, 148-151, 156, and 159-161, and withdrawn Claims 146, 152-155, 157-158, 162-165, and 167. Claims 145-147, 152-155, 157-158, and 162-167 are pending. Election/Restrictions Applicant has elected without traverse the following species, wherein: i) the alternative knock-in effect of the essential gene is to express the essential gene, as recited in Claim 145 ii) the alternative target essential gene is GAPDH, as recited in Claim 160; iii) the alternative additional method step is selecting against a second plurality of cells of the population of starting cells, as recited in Claim 147; iv) the alternative indel break location is within the last exon of the essential gene, as recited in Claim 149; v) the alternative 5’ and 3’ homology arm structural homology limitation is a 5' homology arm upstream of the knock-in cassette and a 3' homology arm downstream of the knock-in cassette, as recited in Claim 151; and vi) the alternative donor template structural limitation is the exogenous partial coding sequence of the essential gene in the knock-in cassette encodes a C-terminal fragment of a protein encoded by the essential gene, as recited in Claim 156. Claims 145-147, 152-155, 157-158, and 162-167 are pending. Claims 146, 152-155, 157-158, 162-165, and 167 are pending but withdrawn from further consideration pursuant to 37 CFR 1.142(b) as being drawn to a non-elected invention, there being no allowable generic or linking claim. Claims 145, 147, and 166 are under consideration. Priority This application is a continuation of application 17/923,358 filed on November 4, 2022, which is a 371 of PCT/US21/30744 filed May 4, 2021. Applicant’s claim for the benefit of a prior-filed application provisional application 63/019,950 filed May 4, 2020 under 35 U.S.C. 119(e) or under 35 U.S.C. 120, 121, or 365(c) is acknowledged. Claim Rejections - 35 USC § 112 The following is a quotation of the first paragraph of 35 U.S.C. 112(a): (a) IN GENERAL.—The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor or joint inventor of carrying out the invention. The following is a quotation of the first paragraph of pre-AIA 35 U.S.C. 112: The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor of carrying out his invention. The following is a quotation of 35 U.S.C. 112(b): (b) CONCLUSION.—The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the inventor or a joint inventor regards as the invention. The following is a quotation of 35 U.S.C. 112 (pre-AIA ), second paragraph: The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the applicant regards as his invention. 1. Claims 145-146 and 166 are rejected under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter which the inventor or a joint inventor (or for applications subject to pre-AIA 35 U.S.C. 112, the applicant), regards as the invention. Claim 145 recites wherein the donor template comprises a gene product of interest, to be fused in frame with and downstream of an exogenous coding sequence of GAPDH or an exogenous partial coding sequence of GAPDH. Claim 145 has been amended to recite the negative limitation ‘wherein the donor template does not comprise a reporter gene’. The term “reporter gene” is a relative term which renders the claim indefinite. The term “reporter gene” is not defined by the claim, the specification does not provide a standard for ascertaining the requisite degree, and one of ordinary skill in the art would not be reasonably apprised of the scope of the invention. The specification fails to actually define the metes and bounds of what genes objectively fall within “reporter gene”, and what genes objectively do not fulfill “reporter gene”. Rather, the specification discloses exemplary language, e.g. [0018], “the donor template does not comprise a reporter gene, e.g., a fluorescent reporter gene or an antibiotic resistance gene”. The specification discloses the reporter gene “confers a trait suitable for artificial selection” [0528]. Claim 145 recites a selection step, “selecting a first plurality…”, which is recited at a high level of generality. However, here too, the specification fails to actually define the metes and bounds of what selection trait(s) and/or means of selection objectively fall(s) within “artificial selection”, as opposed to what selection trait(s) and/or means of selection objectively do not fulfill “artificial selection”. It is axiomatic that the presence of any heterologous nucleic acid sequence encoding a gene product of interest now fused to a GAPDH coding sequence necessarily “confers a trait suitable for artificial selection” in one form or another, as such is natural law of chemistry and biology. The claims fail to recite, and the specification fails to disclose what objectively distinguishes a “gene product of interest” that is not a “reporter gene”, as opposed to a “gene product of interest” that is a “reporter gene”. For example, Yesbolatova et al (Generation of conditional auxin-inducible degron (AID) cells and tight control of degron-fused proteins using the degradation inhibitor auxinole, Methods 164-165: 73-80, available online April 24, 2019; of record) taught the use of the CRISPR/Cas9 system to fuse two different gene products of interest in frame with the artisan’s target gene of interest, wherein the two different gene products are a “tag” and a “marker” (e.g. Figure 2b). Similarly, Neklesa et al (A Bidirectional System for the Dynamic Small Molecule Control of Intracellular Fusion Proteins, ACS Chem. Biol. 8: 2293-2300, 2013) is considered relevant prior art for having taught fusing the artisan’s protein of interest with a tag polypeptide, wherein said tag is able to bind small molecules, thereby allowing the artisan to control the stability or instability of the fusion protein (e.g. Abstract). Does Applicant consider the “tag” of Yesbolatova et al and/or Neklesa et al, to be a gene product of interest (may be present)? Or, a reporter gene (must be absent)? Sitchern et al (NF-kappaB mediates inhibition of mesenchymal cell differentiation through a posttranscriptional gene silencing mechanism, Genes & Development 17: 2368-2373, 2003) is considered relevant prior art for having taught fusing the artisan’s protein of interest, to wit, GAPDH, with an exogenous polypeptide, to wit, MyoD domain (e.g. pg 54048, col. 2), thereby allowing the artisan to detect stimulus-responsive down-regulation of GAPDH mRNA transcripts via a post-transcriptional mechanism (e.g. pg 2370). Sitcheran et al taught, for example, inserting nucleotides 539-914, 748-914, and 720-853 of the mouse MyoD mRNA into the BstX1 restriction site of mouse GAPDH cDNA (pg 2370; Figures 3b, 5c; pg 2372, col. 1, Methods). GenBank M84918.1 (mouse MyoD mRNA, 1993) evidences that this region encodes the polypeptide: CPEHHPCIHWCCQGCGSEHYSGDSDASSPRSNCSDGMMDYSGPPSGPRRQNGYDTAYYSGGQGHPRAEREA. GenBank GU214026 (mouse GAPDH mRNA, 2011) evidences the location of the unique BstX1 restriction site in the mouse GAPDH mRNA, thereby resulting in an in-frame GAPDH-MyoD-GAPDH fusion protein. Does Applicant consider the MyoD polypeptide insertions into GAPDH that yield a regulatable down-regulation of GAPDH mRNA via a post-transcriptional mechanism to be a gene product of interest (may be present)? Or, a reporter gene (must be absent)? Tisdale et al (Glyceraldehyde-3-phosphate Dehydrogenase Interacts with Rab2 and Plays an Essential Role in Endoplasmic Reticulum to Golgi Transport Exclusive of Its Glycolytic Activity, J. Biol. Chem. 279(52): 54046-54052, 2004) is considered relevant prior art for having taught fusing the artisan’s protein of interest, to wit, GAPDH, with an exogenous polypeptide, to wit, VP16 transactivation domain (e.g. pg 54048, col. 2), thereby allowing the artisan to detect the presence of transcriptional transactivation domains in GAPDH (e.g. Abstract). Similarly, Kim et al (Regulation of oncogenic transcription factor hTAFII68-TEC activity by human glyceraldehyde-3-phosphate dehydrogenase (GAPDH), Biochem. J. 404: 197-206, 2007) is considered relevant prior art for having taught fusing the artisan’s protein of interest, to wit, GAPDH, with an exogenous polypeptide, to wit, GAL4 DNA-binding domain, thereby allowing the artisan to detect the presence of transcriptional transactivation domains in GAPDH (e.g. Abstract). Does Applicant consider the VP16 domain and/or the GAL4 DNA-binding domain of Tisdale et al and Kim et al to be a gene product of interest (may be present)? Or, a reporter gene (must be absent)? A claim may be rendered indefinite by reference to an object that is variable. (MPEP §2173.05(b)). The term “reporter gene” appears to be an arbitrary and subjective determination. The instant claims as a whole do not apprise one of ordinary skill in the art of its scope and, therefore, does not serve the notice function required by 35 U.S.C. 112, second paragraph, by providing clear warning to others as to what constitutes infringement of the patent. Dependent claims are included in the basis of the rejection because they do not correct the primary deficiencies of the independent claim. Response to Arguments Applicant argues that the term “reporter gene” is not arbitrary and subjective. Rather, [0528, 623, and 643] defines “reporter gene”. Applicant’s argument(s) has been fully considered, but is not persuasive. The “reporter gene” is recited at a high level of generality. There is no special definition of “reporter gene”. [0018] discloses “a reporter gene, e.g., a fluorescent reporter gene or an antibiotic resistance gene”. This is not a definition. Rather, these are non-exclusive examples. [0528] discloses the reporter gene “confers a trait suitable for artificial selection”, whereby “a trait” and “suitable for artificial selection” are each disclosed at a high level of generality, “e.g., green fluorescent protein (GFP) or an antibiotic resistance genes”. This is not a definition. Rather, these are non-exclusive examples. [0623] discloses reporter genes “such as a fluorescent protein (e.g. as described herein) and an enzyme (e.g. luciferase and lacZ)…, may aid the tracking of therapeutic cells). This is not a definition. Rather, these are non-exclusive examples. [0643] discloses “reporter gene (e.g. GFP, mCherry, etc.)”. This is not a definition. Rather, these are non-exclusive examples. Thus “reporter gene” is open-ended and not limited to art-recognized fluorescent reporter genes and/or art-recognized antibiotic resistance genes. While it is understood that GFP (Han et al), mCherry, EGFP, and luciferase (Kim et al; Zhu et al) are art-recognized reporter genes, Applicant does not actually answer the question(s) posed in the rejection nor clarifies the record as to whether or not the peptide tags or exogenous polypeptides, e.g. VP16, Gal4 transactivator, fused to GAPDH (Yesbolatova et al; Neklesa et al, Li et al) or mRNA insertions (Sitchern et al) do or do not read upon “reporter gene”. Each of these heterologous molecules, and, more generally, any heterologous molecule, is/are selectable, in one way or another, as per natural law of chemistry, cell biology, and/or molecular biology. So, what heterologous molecule present in the donor template does not objectively fulfill “reporter gene”, and thus may be present, as opposed to what heterologous molecule present in the donor template does objectively fulfill “reporter gene”, and thus must be absent?? Applicant fails to clarify the record on this issue. A claim may be rendered indefinite by reference to an object that is variable. (MPEP §2173.05(b)). The term “reporter gene” appears to be an arbitrary and subjective determination. The instant claims as a whole do not apprise one of ordinary skill in the art of its scope and, therefore, does not serve the notice function required by 35 U.S.C. 112, second paragraph, by providing clear warning to others as to what constitutes infringement of the patent. Dependent claims are included in the basis of the rejection because they do not correct the primary deficiencies of the independent claim. 2. Claims 145-146 and 166 are rejected under 35 U.S.C. 112(a) or 35 U.S.C. 112 (pre-AIA ), first paragraph, as failing to comply with the written description requirement. The claim(s) contains subject matter which was not described in the specification in such a way as to reasonably convey to one skilled in the relevant art that the inventor or a joint inventor, or for applications subject to pre-AIA 35 U.S.C. 112, the inventor(s), at the time the application was filed, had possession of the claimed invention. Claim 145 recites wherein the donor template comprises a gene product of interest, to be fused in frame with and downstream of an exogenous coding sequence of GAPDH or an exogenous partial coding sequence of GAPDH. Claim 145 has been amended to recite the negative limitation ‘wherein the donor template does not comprise a reporter gene’. The Examiner incorporates herein the above 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, rejection. In analyzing whether the written description requirement is met for genus claims, it is first determined whether a representative number of species have been described by their complete structure. To provide adequate written description and evidence of possession of a claimed genus, the specification must provide sufficient distinguishing identifying characteristics of the genus. The factors to be considered include disclosure of complete or partial structure, physical and/or chemical properties, functional characteristics, structure/function correlation, methods of making the claimed product, or any combination thereof. The disclosure of a single species is rarely, if ever, sufficient to describe a broad genus, particularly when the specification fails to describe the features of that genus, even in passing. (see In re Shokal 113USPQ283(CCPA1957); Purdue Pharma L.P. vs Faulding Inc. 56 USPQ2nd 1481 (CAFC 2000). The court explained that “reading a claim in light of the specification, to thereby interpret limitations explicitly recited in the claim, is a quite different thing from ‘reading limitations of the specification into a claim,’ to thereby narrow the scope of the claim by implicitly adding disclosed limitations which have no express basis in the claim.” The court found that applicant was advocating the latter, i.e., the impermissible importation of subject matter from the specification into the claim.). See also In re Morris, 127 F.3d 1048, 1054-55, 44 USPQ2d 1023, 1027-28 (Fed. Cir. 1997). Does Applicant consider: the “tag” of Yesbolatova et al and/or Neklesa et al; the MyoD polypeptide insertions into GAPDH of Sitcheran et al; and/or the VP16 domain and/or the GAL4 DNA-binding domain of Tisdale et al and Kim et al, to be a gene product of interest (may be present)? Or, a reporter gene (must be absent)? A claim may be rendered indefinite by reference to an object that is variable. (MPEP §2173.05(b)). The Federal Circuit has explained that a specification cannot always support expansive claim language and satisfy the requirements of 35 U.S.C. 112 “merely by clearly describing one embodiment of the thing claimed.” LizardTech v. Earth Resource Mapping, Inc., 424 F.3d 1336, 1346, 76 USPQ2d 1731, 1733 (Fed. Cir. 2005). Without a correlation between structure and function, the claim does little more than define the claimed invention by function. That is not sufficient to satisfy the written description requirement. See Eli Lilly, 119 F.3d at 1568, 43 USPQ2d at 1406 (“definition by function ... does not suffice to define the genus because it is only an indication of what the gene does, rather than what it is’). Applicant essentially describes the negative limitation at a high level of generality using only functional language. Thus, for the reasons outlined above, it is concluded that the claims do not meet the requirements for written description under 35 U.S.C. 112, first paragraph. MPEP 2163 - 35 U.S.C. 112(a) and the first paragraph of pre-AIA 35 U.S.C. 112 require that the “specification shall contain a written description of the invention ....” This requirement is separate and distinct from the enablement requirement. Ariad Pharm., Inc. v. Eli Lilly & Co., 598 F.3d 1336, 1340, 94 USPQ2d 1161, 1167 (Fed. Cir. 2010) (en banc) Dependent claims are included in the basis of the rejection because they do not correct the primary deficiencies of the independent claim(s). 3. Claims 145-146 and 166 are rejected under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter which the inventor or a joint inventor (or for applications subject to pre-AIA 35 U.S.C. 112, the applicant), regards as the invention. Claim 145 recites the limitation (i)(b), wherein the break is located within the first 50 base pairs of exon 9 of GAPDH [structure] and the break results in [function] a loss of function of the gene product encoded by GAPDH. The claim is broad for the gene editing method step parameters by which the limitation (i)(b), wherein the break is located within the first 50 base pairs of exon 9 of GAPDH [structure] and the break results in [function] a loss of function of the gene product encoded by GAPDH is to be achieved. Those of ordinary skill in the art recognize that functional property of the CRISPR/Cas9 nuclease to generate a break in the genome of a target host cell, and corresponding genus of molecular lesions thereof, is dependent upon many different variable parameters, including, but not limited to: the gRNA target seed nucleotide sequence [parameter 1]; the gRNA concentration [parameter 2]; the type of CRISPR/Cas nuclease [parameter 3]; the concentration of the CRISPR/Cas nuclease [parameter 4]; the means by which the gRNA and/or CRISPR/Cas nuclease is introduced into the target host cell, e.g. electroporation protocol, transfection protocol, viral transduction protocol, nucleofection protocol, etc… [parameter 5]; and the assay means by which the gene editing lesions are determined or measured [parameter 6]. The claim(s) also denote(s) that there is a genus of gRNAs and/or Cas nucleases and/or gene editing method step conditions that, do not, in fact, yield a break located within the first 50 base pairs of exon 9 of GAPDH [structure] and/or the break(s) do/does not result in [function] a loss of function of the gene product encoded by GAPDH. A claim may be rendered indefinite by reference to an object that is variable. (MPEP §2173.05(b)). If there are multiple ways to achieve and/or determine ‘wherein the break is located within the first 50 base pairs of exon 9 of GAPDH [structure] and the break results in [function] a loss of function of the gene product encoded by GAPDH’, e.g. gRNA target sequence(s), gRNA and/or Cas nuclease concentration(s), experimental means by which the gRNAs and/or Cas nucleases are introduced into the cell, amount of time after introducing the gRNA(s) and/or Cas nuclease(s) into the cell from which indel(s) and/or GAPDH function is/are determined, and/or the assay means of detecting indels, yet each yields a different result, then the claim may be indefinite because it is unclear which method is to be performed to determine infringement. Parameter 1 Claim 145 requires the CRISPR/Cas nuclease to cause a break (syn. cleave) within the first 50 base pairs of GAPDH exon 9. The specification discloses the gRNA targeting domain (syn. seed sequence) may be 10-30 nucleotides in length [0686]. Thus, the GAPDH target region encompasses targeting domain nucleotide sequences that are complementary to nucleotide sequences that is/are about 29 nucleotides 5’ upstream to the first 50 base pairs of GAPDH exon 9 as well as 29 nucleotides 3’ downstream to the first 50 base pairs of GAPDH exon 9, a total range of 108 nucleotides to which the gRNA target seed sequence is complementary and hybridizes, thereby eliciting the CRISPR/Cas nuclease DNA break (syn. cleave). Claim 166 requires the CRISPR/Cas nuclease to cause a break (syn. cleave) within the first 21 base pairs of GAPDH exon 9. Thus, the GAPDH target region encompasses targeting domain nucleotide sequences that are complementary to nucleotide sequences that is/are about 29 nucleotides 5’ upstream to the first 21 base pairs of GAPDH exon 9 as well as 29 nucleotides 3’ downstream to the first 21 base pairs of GAPDH exon 9, a total range of 79 nucleotides to which the gRNA target seed sequence is complementary and hybridizes, thereby eliciting the CRISPR/Cas nuclease DNA break (syn. cleave). The gRNA is recited at a high level of generality. The specification discloses a GAPDH gRNA in which the seed sequence is only 21 nucleotides in length (e.g. Example 1, [0780], SEQ ID NO:90). The specification discloses a small genus of about 37 GAPDH gRNA seed sequences, e.g. Table 7, for which only 5 exhibited measurable editing of GAPDH and resulted in significant cell death at the population level due to expression of a non-functional GAPDH protein or a GAPDH protein with insufficient function (e.g. Example 1, [780]; Figures 1-2). Applicant’s own data clearly evidence that not all GAPDH gRNA seed sequences within the region of 108 nucleotides to which the gRNA target seed sequence is complementary and hybridizes, including 5’ upstream and/or 3’ downstream of the first 50 base pairs of GAPDH exon 9, yield the claimed functional result. For example, RSQ24576, substantially overlapping RSQ22237, did not achieve the editing results of RSQ22337. Similarly, RSQ22336, RSQ24574, and RSQ24575, just a few nucleotides away from RSQ22337, did not achieve the editing results of RSQ22337. Rather, Applicant discloses a small subgenus of only 6 GAPDH gRNAs with no in-silico off-target effects (Figure 2) and only 5 GAPDH gRNAs apparently able to achieve the recited functional properties. Thus, it is axiomatic that those of ordinary skill in the art would immediately recognize that the breadth of the gRNA targeting domain (syn. seed sequence) lengths encompassed by the claims, 10-30 nucleotides in length [0686], is vastly greater than the specific 21 nucleotide gRNA targeting domain (syn. seed sequence) lengths, and their specific corresponding nucleotide sequences, actually reduced to practice. Those of ordinary skill in the art would also immediately recognize that the few specific species of GAPDH gRNA targeting domain (syn. seed sequence) lengths, and their corresponding specific nucleotide sequences, do not adequately represent the claimed genus of gRNA targeting domains (syn. seed sequences) lengths, and their corresponding nucleotide sequences, because the claimed genus is highly variant. Zhang et al (U.S. Patent 10,494,621) is considered relevant prior art for having disclosed that while truncated guide sequences may reduce off-target activity at some reference target site(s), they increased off-target activity at other target sites (Example 14, col. 464, lines 52-54). Xie et al (RNA-Guided Genome Editing in Plants Using a CRISPR-Cas System, Molecular Plant 6(6): 1975-1983, 2013; available online August 17, 2013) is considered relevant prior art for having taught that guide sequences of 22 nucleotides in length comprising one or more nucleotide mismatches relative to a first target site (PS3), wherein said guide sequence is now capable of hybridizing to said first target site and to a second, different target site ("off-target"), even though at least 10 nucleotides of the guide sequence seed region remain unchanged (Figure 4). Cho et al (Analysis of off-target effects of CRISPR/Cas-derived RNA-guided endonucleases and nickases, Genome Research 24: 132-141, 2013; available online November 19, 2013) is considered relevant prior art for having taught guide sequences of 20 nucleotides in length comprising one or more nucleotide mismatches relative to a first target site ("on"), wherein said guide sequence is no longer capable of hybridizing to said first target site but instead to a second, different off-target site ("Off4", "Off5"), even though at least 10 nucleotides of the guide sequence seed region remain unchanged (Figure 1B). Thus, while the single guide polynucleotide comprising a guide sequence of 10 to 16 nucleotides in length appears to have lost the recited functional property relative to a first, arbitrary "target sequence", it has gained the recited functional property relative to a second, arbitrary "target sequence". Church et al (U.S. 2014/0356956) is considered relevant prior art for having disclosed truncated guide RNAs that are 11 or 15 nucleotides in length (Figure 16D-2), for which no indel activity is detectable. Thus, the ordinary artisan would immediately recognize that Applicant’s specification does not support the enormous breadth of GAPDH gRNA target sequences encompassed by the instantly claimed invention. The claimed genus of GAPDH gRNA seed sequences is highly variant, and the 5 specific GAPDH gRNAs whose target domain (syn. seed sequence) consists of 21 nucleotides do not adequately represent the enormous genus of structurally and functionally undisclosed gRNA seed sequences comprising target domains (syn. seed sequences) of 10-30 nucleotides encompassed by the claims. Parameter 2 The claims fail to recite the working concentration of the gRNA with which to generate the recited GAPDH gene editing. The specification discloses transfecting target cells with GAPDH gRNA/Cas12a ribonucleoprotein complexes (RNPs) by nucleofection or electroporation (e.g. Example 2, [0783]) at varying concentrations, e.g. 0.0625, 0.25, 1, or 4uM [0785], for which the 4uM RNP concentration resulted in the highest editing levels. However, the independent claim, nor any claims, neither recite(s) nor require(s) nucleofection or electroporation of GAPDH gRNA/Cas12a ribonucleoprotein complexes (RNPs). Li et al (Optimization of Genome Engineering Approaches with the CRISPR/Cas9 System, PLoS One 9(8): 105779; 10 pages, available online August 28, 2014) is considered relevant prior art for having taught optimization of the CRISPR/Cas9 system for genome engineering (Title), wherein said optimization includes comparison of different guide RNA target sequences, individually or in combination, e.g. GFP KO gRNAs (Table 1; pg 3, col. 2), as such is common practice in the art (See also citation #13 to Mali et al, "target specificity screening"). Li et al taught that the cleavage efficiency, ranging from 20% to 49%, "varied based on the transfection efficiency" (pg 3, col. 2). Liang et al (Rapid and highly efficient mammalian cell engineering via Cas9 protein transfection, J. Biotechnol. 208: 44-53, May 21, 2015) is considered relevant prior art for having taught that the indel efficiency of a Cas9 protein/gRNA RNP complex varies widely, between 25% and 85%, depending upon the electroporation conditions (Figure 4a). Schumann et al (Generation of knock-in primary human T cells using Cas9 ribonucleoproteins, Proc. Nat'l Acad. Sci. 112(33): 10437-10442, available online July 27, 2015) is considered relevant prior art for having taught that the editing efficiency of a Cas9/gRNA ribonucleoprotein complex delivered in vitro into primary human T cells varies between 4% to 29%, depending upon the dose of the Cas9/gRNA RNP concentration (pg 10438, col. 2; Figure 4d). Parameter 3 The type of CRISPR/Cas nuclease is recited at a high level of generality. The claims encompass an enormous genus of Cas nucleases molecules including, but not limited to, Type I Cas, Type II Cas, Type III Cas, Type IV Cas, Type V Cas, Cas 3, Cas9, Cpf, CasX, and CasY nucleases. As discussed above, the specification discloses transfecting target cells with GAPDH gRNA/Cas12a ribonucleoprotein complexes (RNPs) (e.g. Example 2, [0783]). Terns et al (U.S. 2011/0189776) is considered relevant prior art for having disclosed disclosed a multitude of different Cas-type enzymes (e.g. Figure 5F, at least 29 different Cas-type enzymes), not all of which have actually been functionally characterized. Doudna et al (U.S. 2016/0060653) is considered relevant prior art for having disclosed Cas nucleases, wherein the amino acid sequence of the Cas nuclease may have as little as 75% identity to a reference nuclease (e.g. [0198]). SEQ ID NO:993 is 1688 amino acids in length. 75% identity allows for as many as 422 amino acid changes, 20^422, which is essentially an infinite genus. (www.calculator.net/exponent-calculator.html; last visited January 5, 2026) Briner et al (Guide RNA Functional Modules Direct Cas9 Activity and Orthogonality Molecular Cell 56: 333-339, October 23, 2014) is considered relevant prior art for having taught that changes to the nucleotide sequence(s) and length(s) of the gRNA molecule affects the ability of the gRNA to bind to different Cas9 orthologs, subsequently affecting the ability of the gRNA variants/Cas9 ortholog variants to efficiently cleave the intended target site nucleotide sequence (e.g. Figure 1). Briner et al taught that, "the molecular basis of selective Cas9:guide-RNA interactions is poorly understood" (Abstract). Distinct portions of the sgRNA are predicted to form various features that interact with Cas9 and/or the DNA target. However, the boundaries and respective roles of these portions remain to be determined (pgs 333-334, joining para.). Parameter 4 The claims fail to recite the working concentration of the CRISPR/Cas nuclease with which to generate the recited GAPDH gene editing. As discussed above, the specification discloses transfecting target cells with GAPDH gRNA/Cas12a ribonucleoprotein complexes (RNPs) by nucleofection or electroporation (e.g. Example 2, [0783]) at varying concentrations, e.g. 0.0625, 0.25, 1, or 4uM [0785], for which the 4uM RNP concentration resulted in the highest editing levels. However, the independent claim, nor any claims, neither recite(s) nor require(s) nucleofection or electroporation of GAPDH gRNA/Cas12a ribonucleoprotein complexes (RNPs). As discussed above, Li et al taught that the cleavage efficiency, ranging from 20% to 49%, "varied based on the transfection efficiency" (pg 3, col. 2). As discussed above, Liang et al taught that the indel efficiency of a Cas9 protein/gRNA RNP complex varies widely, between 25% and 85%, depending upon the electroporation conditions (Figure 4a). As discussed above, Schumann et al taught that the editing efficiency of a Cas9/gRNA ribonucleoprotein complex delivered in vitro into primary human T cells varies between 4% to 29%, depending upon the dose of the Cas9/gRNA RNP concentration (pg 10438, col. 2; Figure 4d). Parameter 5 The claims are broad for the means by which the gRNA and/or CRISPR/Cas nuclease is/are introduced into the target host cell, e.g. electroporation protocol(s), transfection protocol(s), viral transduction protocol(s), nucleofection protocol(s) from which the limitation (i)(b), wherein the break is located within the first 50 base pairs of exon 9 of GAPDH [structure] and the break results in [function] a loss of function of the gene product encoded by GAPDH is to be achieved. As discussed above, the specification discloses transfecting target cells with GAPDH gRNA/Cas12a ribonucleoprotein complexes (RNPs) by nucleofection or electroporation (e.g. Example 2, [0783]) at varying concentrations, e.g. 0.0625, 0.25, 1, or 4uM [0785], for which the 4uM RNP concentration resulted in the highest editing levels. However, the independent claim, nor any claims, neither recite(s) nor require(s) nucleofection or electroporation of GAPDH gRNA/Cas12a ribonucleoprotein complexes (RNPs). Parameter 6 The claims are broad for the assay means by which the gene editing lesions are determined or measured, from which the limitation (i)(b), wherein the break is located within the first 50 base pairs of exon 9 of GAPDH [structure] and the break results in [function] a loss of function of the gene product encoded by GAPDH is to be determined. As discussed in prior Office Actions, Galetto et al (Targeted approaches for gene therapy and the emergence of engineered meganucleases, Expert Opinion Biological Therapy 9(10): 1289-1303, 2009; of record) is considered relevant prior art for having reviewed the general mechanism by which nucleases mediate insertion of the artisan’s exogenous polynucleotide of interest into the artisan’s genomic target site of interest. As illustrated in Figure 2A (provided below), while the nuclease recognizes its target site and cleaves the DNA, the actual molecular mechanism by which the exogenous polynucleotide of interest integrates into the artisan’s genomic target site of interest via homologous recombination occurs through homologous recombination at the 5’ and 3’ homology arms that flank the exogenous polynucleotide that is to be inserted into the genomic target site by homologous recombination. PNG media_image1.png 243 168 media_image1.png Greyscale As discussed in prior Office Actions, San Filippo et al (Mechanism of Eukaryotic Homologous Recombination, Ann. Rev. Biochem. 77:229-57, 2008; of record) is considered relevant prior art for having taught that a double-stranded break in the host cell’s genome naturally results in end resection of the cleaved DNA strands. The single strand ends perform strand invasion into the template sequence, upon which DNA synthesis repairs the gaps. Homologous recombination to resolve the 5’ and 3’ D-loops may occur anywhere within the D-loops, including much farther away from the actual site of the initial double-stranded break (e.g. Figure 1), as shown below: PNG media_image2.png 544 400 media_image2.png Greyscale As discussed in prior Office Actions, Nimonkar et al (BLM–DNA2–RPA–MRN and EXO1–BLM–RPA–MRN constitute two DNA end resection machineries for human DNA break repair, Genes & Development 25: 350-362, 2011; of record) is considered relevant prior art for having taught that the end-resection mechanism in human cells can naturally remove a few hundred nucleotides (e.g. pg 350, col. 2) to a few thousands of nucleotides (e.g. pg 357, col. 2). As discussed in prior Office Actions, Joung et al (U.S. 2014/0295556; of record) disclosed that the CRISPR/Cas9 system naturally generates deletions ranging in size from 2, 6, 14, 22, 56, 78, 94, 115, 181, 202, and 365 nucleotides at the target site where the nuclease causes a break in the endogenous genome (e.g. Figure 3C). PNG media_image3.png 640 650 media_image3.png Greyscale Koike-Yusa et al (Genome-wide recessive genetic screening in mammalian cells with a lentiviral CRISPR-guide RNA library, Nature Biotechnol. 32(4): 267-273, 2014) is considered relevant prior art for having taught a CRISPR/Cas9 method of editing target cells comprising the use of lentiviral vectors to transduce and deliver the Cas9 nuclease and gRNA into the cells (e.g. Figure 1), wherein the resulting indels ranged from less than 9bp to as many as 45bp (e.g. pg 269, col. 2), when measured about 14 days post infection (Online Methods, libraries and screening; off-target and cleavage analysis). As discussed in prior Office Actions, Han et al (available online August 29, 2019; of record) taught a method of selecting a population of genetically modified cells, the method comprising the steps of: A) contacting a population of starting cells with: (i) a nuclease that causes a break within an endogenous coding sequence of an essential gene in the cells, wherein the essential gene encodes GAPDH (e.g. Title; Abstract, “efficient transgene knock-in in the endogenous GAPDH gene via CRISPR/Cas9 mediated homologous recombination”), and (ii) a donor template that comprises a knock-in cassette comprising an exogenous coding sequence for a gene product of interest in frame with and downstream (3') of a partial coding sequence of the essential gene (Figure 1a), wherein the knock-in cassette is integrated into the genome of a first plurality of cells of the population of starting cells by homology-directed repair (HDR) of the break, wherein the first plurality of cells express: (a) the gene product of interest, and (b) the gene product encoded by the essential gene (e.g. pg 4, Section 3.1 Results, “When HR-mediated knock-in events occurred, the 2A-GFP fragment was inserted in frame with the endogenous GAPDH coding sequence, and because the self-cleaving 2A peptide exists, the GAPDH and GFP can be expressed separately (Figure 1a)”); and B) selecting those cells comprising the knock-in cassette that express the GAPDH gene and the gene product of interest. While Han et al demonstrated a reduction to practice of their gene-editing method using a reporter gene encoding a fluorescent protein, to wit, GFP (e.g. Figure 1a), Han et al taught that the method may be used instead to insert the artisan’s foreign gene of interest into the GAPDH locus for stable expression (e.g. Abstract; pg 2, para 3, “integrate exogenous genes”), e.g. for biomedical applications (e.g. pg 2, lines 2-3). Han et al taught the GAPDH sgRNA (underlined) targeted a site that is at least 4 nucleotides 5’ to the last coding sequence of the last GAPDH exon (e.g. Figure 1), as shown below: gtatgacaacgaatttggctacagcaacagggtggtggacctcatggcccacatggcctccaaggagtaa Claim 145 recites wherein the edit is within the first 50pb of exon 9 (nts 1255-1305 below), which overlaps with the gRNA target sequence of Han et al (nts 1297-1318 below). Claim 166 recites wherein the edit is within the first 21bp of exon 9 (nts 1255-1276 below), which is only 21 nts away from the gRNA target sequence of Han et al (nts 1297-1318 below). As discussed above, the GAPDH target region encompasses targeting domain nucleotide sequences that are complementary to nucleotide sequences that is/are about 29 nucleotides 3’ downstream to the first 21 base pairs of GAPDH exon 9, which abuts and/or overlaps with as many as 8 nucleotides of Han et al’s GAPDH exon 9 gRNA. Applicant argues that the Examiner’s contention that Han’s method would inherently and naturally result in a loss-of-function of the GAPDH gene product is incorrect because Han et al themselves taught that by TIDE analysis, the CRISPR/Cas9 system primarily generated indels of up to 6 nucleotides, and thus contradicts the assertion that Han’s methods would generate a large deletion that would encompass a region within the first 50 basepairs of GAPDH exon 9. Applicant’s argument is unpersuasive because: The TIDE analysis of Han et al only speaks to the results achieved per their specific CRISPR/Cas9 method step parameters, not the overall ability of the gRNA itself when used in other CRISPR/Cas9 method conditions and/or other CRISPR/Cas method conditions encompassed by the breadth of the instantly claimed method recited at a high level of generality. That Han et al did not observe the same range of deletions of 2-365 nucleotides in length disclosed by Joung et al (Figure 3C) does not mean that they cannot exist and/or will never exist by the broadly claimed instant method, but rather that the single gRNA used by Han et al (e.g. pg 2, Methods, 2.1, “one sgRNA targeting the GAPDH locus” and/or the single sgRNA/Ca9 editing protocol, e.g. respective gRNA and Cas formulation, to wit, PX330 vector expressing Cas9 and sgRNA (e.g. pg 2, Methods, 2.2), donor:editing vector ratio of 1:1, by which the CRISPR/Cas system was introduced into the target mammalian cells to perform the GAPDH gene edits. Those of ordinary skill in the art have long-recognized that there are different method step parameters by which the CRISPR/Cas gene editing system is performed. The experimental condition of Han et al is but one example, and is not limiting. Allen et al (Predicting the mutations generated by repair of Cas9-induced double-strand breaks, Nature Biotechnol. 37(1): 64-72, available online November 27, 2018) is considered relevant prior art for having taught a CRISPR/Cas9 method of editing target cells comprising the use of lentiviral vectors to transduce and deliver the gRNA into Cas9-expressing cells (e.g. Figure 1). Allen et al taught that they measured indel formation anywhere from 7 to 20 days post-infection with the CRISPR/Cas9 system to evaluate the effect of time-point choice (e.g. Online Methods, Screening and sequence of repair outcomes). Allen et al also taught that to analyze indel prevalence by size, they classified indels into deletions of 1–30 nt and insertions of 1–10 nt. In this case, information about deletions larger than 30 and insertions larger than 10 nt was excluded from the analysis because they are not well detected by our method (Suppl Methods). Thus, the ordinary artisan would immediately recognize that mere discussion of smaller deletions and/or insertions does not mean that larger deletions and insertions do not exist, but rather that such events were excluded from the analyzed data set for reasons of simplifying the analysis. Other detection means may be used to identify larger deletions and insertions. Deletions of 30 nucleotides, per Allen et al, using the Han et al gRNA (underlined), would substantially overlap with DNA breaks within the first 50 nucleotides (bolded) and/or abut the first 21 nucleotides of GAPDH exon 9, as shown below: gtatgacaacgaatttggctacagcaacagggtggtggacctcatggcccacatggcctccaaggagtaa Kosicki et al (Dynamics of Indel Profiles Induced by Various CRISPR/Cas9 Delivery Methods, Progress in Molecular Biology and Translational Science (52): 49-67, dx.doi.org/10.1016/bs.pmbts.2017.09.003, 2017) is considered relevant prior art for having taught different CRISPR/Cas9 delivery formats, e.g. lentiviral transduction, plasmid lipofection, ribonuclear protein electroporation (e.g. pg 50; Figure 4), whereby different indel results are achieved using different methods and when measured at different days, e.g. Days 2-14, post-introduction of the CRISPR/Cas system into the target host cell (e.g. Figures 6-8). Methods for detection of indels differ widely in their ability to resolve alleles, sensitivity, requirement for technical expertise, difficulty of results analysis, cost, time and effort required (pg 51), including, but not limited to Enzyme Mismatch Cleavage (EMC)/Surveyor assay, Tracking of Indels by DEcomposition (TIDE), Next Generation Sequencing (NGS), and Indel Detection by Amplicon Analysis (IDAA), each of which varies by their degree of sensitivity and resolution. Using the gRNA of Han et al per the CRISPR/Cas9 experimental methods of Zhang et al, Xie et al, Cho et al, Joung et al, Church et al, Li et al, Liang et al, Schumann et al, Koike-Yusa et al, Allen et al, and/or Kosicki et al would be reasonably expected by the ordinary artisan to yield different indel results than the single experimental condition of Han et al, as detected by TIDE analysis, whereby depending on the indel detection assay and arbitrary selection of detection parameters, one will arrive at the detection of different indel sizes. Han et al taught only the use of the TIDE analysis detection assay used to determine the GAPDH CRISPR/Cas9 indels. However, this does not mean that other, larger indels were not present. Rather, it is limited to the selective results of TIDE assay. Those of ordinary skill in the art would reasonably understand that other indel detection methods including, but not limited to Enzyme Mismatch Cleavage (EMC)/Surveyor assay, Next Generation Sequencing (NGS), and Indel Detection by Amplicon Analysis (IDAA), each of which varies by their degree of sensitivity and resolution would be reasonably expected to yield different results than the TIDE analysis of Han et al. The claims fail to recite, and the specification fails to disclose the nexus between the method step parameters 1-6, individually and/or in combination(s) and/or subcombination(s) thereof, that are necessary and sufficient to predictably achieve the recited limitation of a break located within the first 50 base pairs of exon 9 of GAPDH [structure] and the break results in [function] a loss of function of the gene product encoded by GAPDH. A claim may be rendered indefinite by reference to an object that is variable. (MPEP §2173.05(b)). If there are multiple ways to achieve and/or determine ‘wherein the break is located within the first 50 base pairs of exon 9 of GAPDH [structure] and the break results in [function] a loss of function of the gene product encoded by GAPDH’, e.g. gRNA target sequence(s), gRNA and/or Cas nuclease concentration(s), experimental means by which the gRNAs and/or Cas nucleases are introduced into the cell, amount of time after introducing the gRNA(s) and/or Cas nuclease(s) into the cell from which indel(s) and/or GAPDH function is/are determined, and/or the assay means of detecting indels, yet each yields a different result, then the claim may be indefinite because it is unclear which method is to be performed to determine infringement. The instant claims as a whole do not apprise one of ordinary skill in the art of its scope and, therefore, does not serve the notice function required by 35 U.S.C. 112, second paragraph, by providing clear warning to others as to what constitutes infringement of the patent. Dependent claims are included in the basis of the rejection because they do not correct the primary deficiencies of the independent claim. When functional claim language is found indefinite, it typically lacks an adequate written description under §112(a), because an indefinite, unbounded functional limitation would cover a plurality of undisclosed structures and/or method steps of performing a function and indicate that the inventor has not provided sufficient disclosure to show possession of the invention. Thus, in most cases, a §112(b) rejection that is based on functional language having unclear (or no) claim boundaries should be accompanied by a rejection under §112(a) based on failure to provide a written description for the claim. See MPEP 2173.05(g). 4. Claims 145-146 and 166 are rejected under 35 U.S.C. 112(a) or 35 U.S.C. 112 (pre-AIA ), first paragraph, as failing to comply with the written description requirement. The claim(s) contains subject matter which was not described in the specification in such a way as to reasonably convey to one skilled in the relevant art that the inventor or a joint inventor, or for applications subject to pre-AIA 35 U.S.C. 112, the inventor(s), at the time the application was filed, had possession of the claimed invention. Claim 145 recites the limitation (i)(b), wherein the break is located within the first 50 base pairs of exon 9 of GAPDH [structure] and the break results in [function] a loss of function of the gene product encoded by GAPDH. Claim 166 requires the CRISPR/Cas nuclease to cause a break (syn. cleave) within the first 21 base pairs of GAPDH exon 9 [structure] and the break results in [function] a loss of function of the gene product encoded by GAPDH. The limitation(s) suffer(s) from a gap in the structure/function nexus and/or method step/function nexus. The Examiner incorporates herein the above 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, rejection. In analyzing whether the written description requirement is met for genus claims, it is first determined whether a representative number of species have been described by their complete structure. To provide adequate written description and evidence of possession of a claimed genus, the specification must provide sufficient distinguishing identifying characteristics of the genus. The factors to be considered include disclosure of complete or partial structure, physical and/or chemical properties, functional characteristics, structure/function correlation, methods of making the claimed product, or any combination thereof. The disclosure of a single species is rarely, if ever, sufficient to describe a broad genus, particularly when the specification fails to describe the features of that genus, even in passing. (see In re Shokal 113USPQ283(CCPA1957); Purdue Pharma L.P. vs Faulding Inc. 56 USPQ2nd 1481 (CAFC 2000). The court explained that “reading a claim in light of the specification, to thereby interpret limitations explicitly recited in the claim, is a quite different thing from ‘reading limitations of the specification into a claim,’ to thereby narrow the scope of the claim by implicitly adding disclosed limitations which have no express basis in the claim.” The court found that applicant was advocating the latter, i.e., the impermissible importation of subject matter from the specification into the claim.). See also In re Morris, 127 F.3d 1048, 1054-55, 44 USPQ2d 1023, 1027-28 (Fed. Cir. 1997). The claim is broad for the gene editing method step parameters by which the limitation (i)(b), wherein the break is located within the first 50 base pairs of exon 9 of GAPDH [structure] and the break results in [function] a loss of function of the gene product encoded by GAPDH is to be achieved. Those of ordinary skill in the art recognize that functional property of the CRISPR/Cas9 nuclease to generate a break in the genome of a target host cell, and corresponding genus of molecular lesions thereof, is dependent upon many different variable parameters, including, but not limited to: the gRNA target seed nucleotide sequence [parameter 1]; the gRNA concentration [parameter 2]; the type of CRISPR/Cas nuclease [parameter 3]; the concentration of the CRISPR/Cas nuclease [parameter 4]; the means by which the gRNA and/or CRISPR/Cas nuclease is introduced into the target host cell, e.g. electroporation protocol, transfection protocol, viral transduction protocol, nucleofection protocol, etc… [parameter 5]; and the assay means by which the gene editing lesions are determined or measured [parameter 6]. The claim(s) also denote(s) that there is a genus of gRNAs and/or Cas nucleases and/or gene editing method step conditions that, do not, in fact, yield a break located within the first 50 base pairs of exon 9 of GAPDH [structure] and/or the break(s) do/does not result in [function] a loss of function of the gene product encoded by GAPDH. The Federal Circuit has explained that a specification cannot always support expansive claim language and satisfy the requirements of 35 U.S.C. 112 “merely by clearly describing one embodiment of the thing claimed.” LizardTech v. Earth Resource Mapping, Inc., 424 F.3d 1336, 1346, 76 USPQ2d 1731, 1733 (Fed. Cir. 2005). Without a correlation between structure and function, the claim does little more than define the claimed invention by function. That is not sufficient to satisfy the written description requirement. See Eli Lilly, 119 F.3d at 1568, 43 USPQ2d at 1406 (“definition by function ... does not suffice to define the genus because it is only an indication of what the gene does, rather than what it is’). The claims fail to recite, and the specification fails to disclose the nexus between the method step parameters 1-6, individually and/or in combination(s) and/or subcombination(s) thereof, that are necessary and sufficient to predictably achieve the recited limitation of a break located within the first 50 base pairs of exon 9 of GAPDH [structure] and the break results in [function] a loss of function of the gene product encoded by GAPDH. A claim may be rendered indefinite by reference to an object that is variable. (MPEP §2173.05(b)). If there are multiple ways to achieve and/or determine ‘wherein the break is located within the first 50 base pairs of exon 9 of GAPDH [structure] and the break results in [function] a loss of function of the gene product encoded by GAPDH’, e.g. gRNA target sequence(s), gRNA and/or Cas nuclease concentration(s), experimental means by which the gRNAs and/or Cas nucleases are introduced into the cell, amount of time after introducing the gRNA(s) and/or Cas nuclease(s) into the cell from which indel(s) and/or GAPDH function is/are determined, and/or the assay means of detecting indels, yet each yields a different result, then the claim may be indefinite because it is unclear which method is to be performed to determine infringement. Thus, for the reasons outlined above, it is concluded that the claims do not meet the requirements for written description under 35 U.S.C. 112, first paragraph. MPEP 2163 - 35 U.S.C. 112(a) and the first paragraph of pre-AIA 35 U.S.C. 112 require that the “specification shall contain a written description of the invention ....” This requirement is separate and distinct from the enablement requirement. Ariad Pharm., Inc. v. Eli Lilly & Co., 598 F.3d 1336, 1340, 94 USPQ2d 1161, 1167 (Fed. Cir. 2010) (en banc) Dependent claims are included in the basis of the rejection because they do not correct the primary deficiencies of the independent claim(s). Claim Rejections - 35 USC § 103 In the event the determination of the status of the application as subject to AIA 35 U.S.C. 102 and 103 (or as subject to pre-AIA 35 U.S.C. 102 and 103) is incorrect, any correction of the statutory basis for the rejection will not be considered a new ground of rejection if the prior art relied upon, and the rationale supporting the rejection, would be the same under either status. The following is a quotation of 35 U.S.C. 103 which forms the basis for all obviousness rejections set forth in this Office action: A patent for a claimed invention may not be obtained, notwithstanding that the claimed invention is not identically disclosed as set forth in section 102 of this title, if the differences between the claimed invention and the prior art are such that the claimed invention as a whole would have been obvious before the effective filing date of the claimed invention to a person having ordinary skill in the art to which the claimed invention pertains. Patentability shall not be negated by the manner in which the invention was made. The factual inquiries set forth in Graham v. John Deere Co., 383 U.S. 1, 148 USPQ 459 (1966), that are applied for establishing a background for determining obviousness under 35 U.S.C. 103(a) are summarized as follows: 1. Determining the scope and contents of the prior art. 2. Ascertaining the differences between the prior art and the claims at issue. 3. Resolving the level of ordinary skill in the pertinent art. 4. Considering objective evidence present in the application indicating obviousness or nonobviousness. This application currently names joint inventors. In considering patentability of the claims the examiner presumes that the subject matter of the various claims was commonly owned as of the effective filing date of the claimed invention(s) absent any evidence to the contrary. Applicant is advised of the obligation under 37 CFR 1.56 to point out the inventor and effective filing dates of each claim that was not commonly owned as of the effective filing date of the later invention in order for the examiner to consider the applicability of 35 U.S.C. 102(b)(2)(C) for any potential 35 U.S.C. 102(a)(2) prior art against the later invention. 5. Claims 145, 147, and 166 are rejected under AIA 35 U.S.C. 103 as being unpatentable over Han et al (available online August 29, 2019; of record) in view of Joung et al (U.S. 2014/0295556; of record), Zhu et al (2015; of record), Yesbolatova et al (available online April 24, 2019; of record), Li et al (April 7, 2015; of record), Galetto et al (2009; of record), San Filippo et al (2008; of record), and Nimonkar et al (2011; of record). Determining the scope and contents of the prior art, and Ascertaining the differences between the prior art and the claims at issue. GenBank NM_001289746 (Homo sapiens GAPDH; August 3, 2024; of record) teaches that GAPDH exon 9 begins at coordinate 1255, 67 nucleotides 5’ to the translation stop codon (bold; coordinates 1322-1324), as shown below: gtatgacaacgaatttggctacagcaacagggtggtggacctcatggcccacatggcctccaaggagtaa The GAPDH exon 9 encodes only the last 22 amino acids of GAPDH protein, as shown below: YDNEFGYSNRVVDLMAHMASKE* With respect to Claim 145, Han et al taught a method of selecting a population of genetically modified cells, the method comprising the steps of: A) contacting a population of starting cells with: (i) a nuclease that causes a break within an endogenous coding sequence of an essential gene in the cells, wherein the essential gene encodes GAPDH (e.g. Title; Abstract, “efficient transgene knock-in in the endogenous GAPDH gene via CRISPR/Cas9 mediated homologous recombination”), and (ii) a donor template that comprises a knock-in cassette comprising an exogenous coding sequence for a gene product of interest in frame with and downstream (3') of a partial coding sequence of the essential gene (Figure 1a), wherein the knock-in cassette is integrated into the genome of a first plurality of cells of the population of starting cells by homology-directed repair (HDR) of the break, wherein the first plurality of cells express: (a) the gene product of interest, and (b) the gene product encoded by the essential gene (e.g. pg 4, Section 3.1 Results, “When HR-mediated knock-in events occurred, the 2A-GFP fragment was inserted in frame with the endogenous GAPDH coding sequence, and because the self-cleaving 2A peptide exists, the GAPDH and GFP can be expressed separately (Figure 1a)”); and B) selecting those cells comprising the knock-in cassette that express the GAPDH gene and the gene product of interest. While Han et al demonstrated a reduction to practice of their gene-editing method using a reporter gene encoding a fluorescent protein, to wit, GFP (e.g. Figure 1a), Han et al taught that the method may be used instead to insert the artisan’s foreign gene of interest into the GAPDH locus for stable expression (e.g. Abstract; pg 2, para 3, “integrate exogenous genes”), e.g. for biomedical applications (e.g. pg 2, lines 2-3). Han et al taught the GAPDH sgRNA targeted a site that is at least 4 nucleotides 5’ to the last coding sequence of the last GAPDH exon (e.g. Figure 1), as shown below: gtatgacaacgaatttggctacagcaacagggtggtggacctcatggcccacatggcctccaaggagtaa The DNA cleavage is at the last amino acid of GAPDH. The donor template and 5’ homology arm of Han et al naturally comprises the coding sequences of the 5’ portion of the GAPDH exon 9, fused in frame with and upstream of, the exogenous GFP coding sequence. Joung et al is considered relevant prior art for having disclosed that the CRISPR/Cas9 system naturally generates deletions ranging in size from 2, 6, 14, 22, 56, 78, 94, 115, 181, 202, and 365 nucleotides at the target site where the nuclease causes a break in the endogenous genome (e.g. Figure 3C). Thus, it is considered natural law of cell biology that the break in the GAPDH exon 9 coding sequence caused by the CRISPR/Cas system of Han et al inherently and naturally “results in a loss of function of the gene product encoded by the essential gene”. Since the Patent Office does not have the facilities for examining and comparing genus of molecular lesions caused by the Han et al guide RNA and DNA breaks of the CRISPR/Cas9 system of the prior art reference, the burden is upon Applicants to show a distinction between the material structural and functional characteristics of the claimed generically recited essential gene target site and corresponding generically recited nuclease and the guide RNA and CRISPR/Cas9 system of the prior art. See In re Best, 562 F.2d 1252, 195 USPQ 430 (CCPA 1977) and In re Fitzgerald et al., 205 USPQ 594. Han et al do not teach ipsis verbis wherein the exogenous coding sequence or exogenous partial coding sequence of the essential gene corresponds to endogenous coding sequence of the essential gene located downstream (3’) of the break, thereby restoring the coding region of the essential gene and rescuing the loss of function of the gene product. However, prior to the effective filing date of the instantly claimed invention, Zhu et al is considered relevant prior art for having taught a method of selecting a population of cells comprising a knock-in expression cassette comprising a heterologous gene of interest, e.g. EGFP, using the CRISPR/Cas gene editing system (e.g. Figures 5a and 6a), whereby the donor template comprises an exogenous coding sequence for the target gene in frame with and upstream (5’) to said heterologous gene of interest, e.g. EGFP, and wherein the exogenous coding sequence for the target gene corresponds to endogenous coding sequences downstream (3’) of the double-stranded break (e.g. Figure 6a). Similar to Han et al, the gRNA of Zhu et al cleaves the DNA just 9 nucleotides (3 amino acids) upstream of the translation stop codon. The 5’ homology arm of the donor template encodes the last 20 amino acids of the target gene and fuses in frame the EGFP coding sequence. The 3’ homology arm encodes the nucleotide sequence downstream of the translation stop codon, and introduces a new stop codon several nucleotides downstream (Figure 6a). Zhu et al selected for those cells expressing the knock-in cassette (e.g. Figures 5-6). Similarly, Yesbolatova et al is considered relevant prior art for having taught a method of selecting a population of cells comprising a knock-in expression cassette comprising a heterologous peptide of interest, e.g. peptide tag, using the CRISPR/Cas gene editing system (e.g. Figure 2a; C-terminal tagging donor), whereby the donor template comprises an exogenous coding sequence for the target gene in frame with and upstream (5’) to said heterologous peptide tag, and wherein the exogenous coding sequence for the target gene corresponds to endogenous coding sequences downstream (3’) of the double-stranded break. Yesbolatova et al taught that they identify CRISPR/Cas9 target sites within 50bp upstream of the stop codon (e.g. pg 74, col. 1), and the donor template encodes the tag cloned in frame with the gene of interest, so as to be able to express a fusion protein (e.g. pg 74, col. 2). Yesbolatova et al selected for those cells expressing the knock-in cassette (e.g. Figures 1, 4). Similarly, Li et al is considered relevant prior art for having taught a method of selecting a population of cells comprising a knock-in expression cassette comprising a heterologous protein of interest, e.g. EGFP, fused in frame with and downstream of the last exon of the target gene using the CRISPR/Cas gene editing system (e.g. Figure 1a), whereby the donor template comprises an exogenous coding sequence for the target gene in frame with and upstream (5’) to said heterologous protein, and wherein the exogenous coding sequence for the target gene corresponds to endogenous coding sequences downstream (3’) of the double-stranded break. The gRNA of Li et al targets the intron upstream of the last exon of the target gene (exon 13), and the 5’ homology arm encodes the intron nucleotides and entire last exon fused in frame with EGFP, all of which are 3’ downstream to the gRNA target site cut by the CRISPR/Cas9 system. Li et al taught a demonstration to extend the application of the knock-in strategy to other exogenous genes by substituting the first artisan’s gene of interest, GFP gene, for a second artisan’s gene of interest, to wit, GAL4 transactivator (e.g. pg 636, col. 2). Galetto et al is considered relevant prior art for having reviewed the general mechanism by which nucleases mediate insertion of the artisan’s exogenous polynucleotide of interest into the artisan’s genomic target site of interest. As illustrated in Figure 2A (provided below), while the nuclease recognizes its target site and cleaves the DNA, the actual molecular mechanism by which the exogenous polynucleotide of interest integrates into the artisan’s genomic target site of interest via homologous recombination occurs through homologous recombination at the 5’ and 3’ homology arms that flank the exogenous polynucleotide that is to be inserted into the genomic target site by homologous recombination. PNG media_image1.png 243 168 media_image1.png Greyscale San Filippo et al is considered relevant prior art for having taught that a double-stranded break in the host cell’s genome naturally results in end resection of the cleaved DNA strands. The single strand ends perform strand invasion into the template sequence, upon which DNA synthesis repairs the gaps. Homologous recombination to resolve the 5’ and 3’ D-loops may occur anywhere within the D-loops, including much farther away from the actual site of the initial double-stranded break (e.g. Figure 1), as shown below: PNG media_image2.png 544 400 media_image2.png Greyscale Nimonkar et al is considered relevant prior art for having taught that the end-resection mechanism in human cells can naturally remove a few hundred nucleotides (e.g. pg 350, col. 2) to a few thousands of nucleotides (e.g. pg 357, col. 2). With respect to the presence of 5’ and 3’ homology arms in the donor construct, Han et al taught wherein the donor template comprises a 5' homology arm upstream of the knock-in cassette and a 3' homology arm downstream of the knock-in cassette (e.g. Figure 1a). Zhu et al taught wherein the donor template comprises a 5' homology arm upstream of the knock-in cassette and a 3' homology arm downstream of the knock-in cassette (e.g. Figures 5a, 6a). Yesbolatova et al taught wherein the donor template comprises a 5' homology arm upstream of the knock-in cassette and a 3' homology arm downstream of the knock-in cassette (e.g. Figure 2a). Li et al taught wherein the donor template comprises a 5' homology arm upstream of the knock-in cassette and a 3' homology arm downstream of the knock-in cassette (e.g. Figure 1a). Resolving the level of ordinary skill in the pertinent art. People of the ordinary skill in the art will be highly educated individuals such as medical doctors, scientists, or engineers possessing advanced degrees, including M.D.'s and Ph.D.'s. Thus, these people most likely will be knowledgeable and well-read in the relevant literature and have the practical experience in molecular biology, gene editing technologies, and natural law of cell biology regarding DNA repair. Therefore, the level of ordinary skill in this art is high. "A person of ordinary skill in the art is also a person of ordinary creativity, not an automaton." KSR International Co. v. Teleflex Inc., 550 U.S. ___, ___, 82 USPQ2d 1385, 1397 (2007). "[I]n many cases a person of ordinary skill will be able to fit the teachings of multiple patents together like pieces of a puzzle." Id. Office personnel may also take into account "the inferences and creative steps that a person of ordinary skill in the art would employ." Id. at ___, 82 USPQ2d at 1396. Considering objective evidence present in the application indicating obviousness or nonobviousness. The focus when making a determination of obviousness should be on what a person of ordinary skill in the pertinent art would have known at the time of the invention, and on what such a person would have reasonably expected to have been able to do in view of that knowledge. This is so regardless of whether the source of that knowledge and ability was documentary prior art, general knowledge in the art, or common sense. M.P.E.P. §2141. The rationale to modify or combine the prior art does not have to be expressly stated in the prior art; the rationale may be expressly or impliedly contained in the prior art or it may be reasoned from knowledge generally available to one of ordinary skill in the art, established scientific principles, or legal precedent established by prior case law. In re Fine, 837 F.2d 1071, 5 USPQ2d 1596 (Fed. Cir. 1988); In re Jones, 958 F.2d 347, 21 USPQ2d 1941 (Fed. Cir. 1992). See also In re Kotzab, 217 F.3d 1365, 1370, 55 USPQ2d 1313, 1317 (Fed. Cir. 2000) (setting forth test for implicit teachings); In re Eli Lilly & Co., 902 F.2d 943, 14 USPQ2d 1741 (Fed. Cir. 1990) (discussion of reliance on legal precedent); In re Nilssen, 851 F.2d 1401, 1403, 7 USPQ2d 1500, 1502 (Fed. Cir. 1988) (references do not have to explicitly suggest combining teachings); and Ex parte Levengood, 28 USPQ2d 1300 (Bd. Pat. App. & Inter. 1993) (reliance on logic and sound scientific reasoning). See MPEP §2144. Prior to the effective filing date of the instantly claimed invention, it would have been obvious to one of ordinary skill in the art to modify the 5’ homology arm of Han et al to further comprise exogenous coding sequence or exogenous partial coding sequence of the essential gene corresponds to endogenous coding sequence of the essential gene located downstream (3’) of the break, as taught by Zhu et al, Yesbolatova et al, and Li et al with a reasonable expectation of success because those of ordinary skill in the art previously recognized and successfully reduced to practice such design principles in order to generate their desired fusion protein knock-in construct. Wherein the break is located within the first 50 or 21 nucleotides of GAPDH exon 9, as discussed above, Joung et al disclosed that the CRISPR/Cas9 system naturally generates deletions ranging in size from 2, 6, 14, 22, 56, 78, 94, 115, 181, 202, and 365 nucleotides at the target site where the nuclease causes a break in the endogenous genome (e.g. Figure 3C). Nimonkar et al taught that the end-resection mechanism in human cells can naturally remove a few hundred nucleotides (e.g. pg 350, col. 2) to a few thousands of nucleotides (e.g. pg 357, col. 2). Galetto et al and San Filippo et al taught that homologous recombination to resolve the 5’ and 3’ D-loops may occur anywhere within the D-loops, including much farther away from the actual site of the initial double-stranded break. In the case where the claimed ranges "overlap or lie inside ranges disclosed by the prior art" a prima facie case of obviousness exists. In re Wertheim, 541 F.2d 257, 191 USPQ 90 (CCPA 1976); In re Woodruff, 919 F.2d 1575, 16 USPQ2d 1934 (Fed. Cir. 1990). It is routine procedure to optimize component amounts to arrive at an optimal product that is superior for its intended use, since it has been held where the general conditions of a claim are disclosed in the prior art, discovering the optimum or workable ranges involves only routine skill in the art. Similarly, a prima facie case of obviousness exists where the claimed ranges or amounts do not overlap with the prior art but are close enough that one skilled in the art would have expected them to have the same properties. See M.P.E.P. §2144.05(I). Instant application fails to disclose an element of criticality for the break to be within the 1st, 2nd, 5th, 10th, 15th, 20th, 21st, 23rd, 27th, 30th, 35th, 40th, 43rd, 47th, and/or 50th, as opposed to the 52nd, 54th, 58th, 61st, 64th, and/or 66th nucleotide of the GAPDH exon 9. In light of the natural law of cell biology that the double-stranded break naturally results in end resection lengths of up to hundreds of nucleotides, whereupon after strand invasion and DNA synthesis, the actual resolution between the donor template and the genomic DNA may occur anywhere within the D-loop, including hundreds of nucleotides 5’ and/or 3’ to the actual target site DNA break, it is considered that the gRNA of Han et al would also be capable of generating recombination events within the first 50 and /or 21 nucleotides of the GAPDH exon 9. The 5’ homology arm of Han et al is 900 nucleotides in length, and encodes the entire last exon of GAPDH (Figure 1a, exon 9). Zhu et al taught the 5’ homology arm was almost 800 nucleotides in length (pg 6), and encoded the entire last exon (e.g. Figure 6a, exons 9 and 10). Yesbolatova et al taught the 5’ homology arm is about 1000 nucleotides in length (pg 74, col. 2), and encodes the last coding exon of the target gene (Figure 2a). Li et al taught the 5’ homology arm is about 1300 nucleotides in length and encodes the last coding exon of the target gene (Figure 1). Even if one was to argue that the resulting GAPDH knock-in sequence is missing the last amino acid, upstream of the exogenous gene of interest, there is no objective evidence, or element of criticality for, the absence of the last amino acid of GAPDH to render the edited GAPDH gene inactive or loss of function. The "mere existence of differences between the prior art and an invention does not establish the invention's nonobviousness." Dann v. Johnston, 425 U.S. 219, 230, 189 USPQ 257, 261 (1976). The gap between the prior art and the claimed invention may not be "so great as to render the [claim] nonobvious to one reasonably skilled in the art."Id. Furthermore, both Zhu et al and Yesbolatova et al taught the 5’ homology arm of the donor template included the C-terminal amino acid coding sequences fused in frame with the peptide or polypeptide of interest, thereby restoring the entire amino acid sequence of the target gene that is cleaved by the gRNA. Prior to the effective filing date of the instantly claimed invention, it also would have been obvious to one of ordinary skill in the art to substitute a first artisan’s gene of interest encoding a reporter gene, e.g. GFP, with a second artisan’s gene of interest that does not encode a reporter gene, in a method of editing the endogenous GAPDH locus in a mammalian cell with a reasonable expectation of success because the simple substitution of one known element for another would have yielded predictable results to one of ordinary skill in the art at the time of the invention. M.P.E.P. §2144.07 states "The selection of a known material based on its suitability for its intended use supported a prima facie obviousness determination in Sinclair & Carroll Co. v. Interchemical Corp., 325 U.S. 327, 65 USPQ 297 (1945).” An artisan would have been motivated to substitute a first artisan’s gene of interest encoding a reporter gene, e.g. GFP, with a second artisan’s gene of interest that does not encode a reporter gene, in a method of editing the endogenous GAPDH locus in a mammalian cell because: i) Han et al taught that the gene-editing method, as successfully demonstrated using a GFP reporter gene, may instead be used instead to insert the artisan’s foreign gene of interest that is not a reporter gene, e.g. GFP, into the GAPDH locus for stable expression (e.g. Abstract; pg 2, para 3, “integrate exogenous genes”), e.g. for biomedical applications (e.g. pg 2, lines 2-3); and ii) Li et al successfully demonstrated extending the application of the knock-in strategy to other exogenous genes by substituting the first artisan’s gene of interest, GFP gene, for a second artisan’s gene of interest, to wit, GAL4 transactivator (e.g. pg 636, col. 2). It is proper to "take account of the inferences and creative steps that a person of ordinary skill in the art would employ." KSR Int'l Co. v. Teleflex Inc., 127 S. Ct. 1727, 1741,82 USPQ2d 1385, 1396 (2007). See also Id. At 1742, 82 USPQ2d 1397 ("A person of ordinary skill is also a person of ordinary creativity, not an automaton."). It should be noted that the KSR case forecloses the argument that a specific teaching, suggestion, or motivation is required to support a finding of obviousness. See the recent Board decision Ex parte Smith, —USPQ2d—, slip op. at 20, (Bd. Pat. App. & Interf. June 25, 2007) (citing KSR, 82 USPQ2d at 1396) (available at http: www. uspto.gov/web/offices/dcom/bpai/prec/fd071925 .pdf). With respect to Claim 147, Han et al taught the method further comprising selecting against a second plurality of cells of the population of starting cells, wherein the knock-in cassette is not integrated into the genomes of the second plurality of cells by homology-directed repair (HDR) in the correct position or orientation, and the second plurality of cells no longer express the gene product encoded by the essential gene (e.g. pg 6, last para, “average frequencies of GFP+ cells are over 2%”, “genome PCR and sequencing analysis of the sorted GFP+ cells (syn. selecting against the second plurality of cells) showed that the 2A-GFP fragment indeed integrated precisely at the 3’ end of the GAPDH gene”). Zhu et al taught the step of selecting against those cells that did not comprise the knock-in cassette in the genome, or in the correct position or orientation (e.g. Figures 5b, 6b). Yesbolatova et al taught the step of selecting against those cells that did not comprise the knock-in cassette in the genome, or in the correct position or orientation (e.g. Figures 1 and 4). Li et al taught the step of selecting against those cells that did not comprise the knock-in cassette in the genome, or in the correct position or orientation (e.g. Figures 1b, e, g; only those embryos derived from successful integration; Figure 1d, sequence analysis of the knock-in insertion junctions). The cited prior art meets the criteria set forth in both Graham and KSR, and the teachings of the cited prior art provide the requisite teachings and motivations with a clear, reasonable expectation of success. Thus, the invention as a whole is prima facie obvious. Response to Arguments Applicant iterates prior arguments. Applicant’s argument(s) has been fully considered, but is not persuasive. The Examiner has rebutted Applicant’s prior arguments. See also discussions in the above 35 U.S.C. 112(a) or 35 U.S.C. 112 (pre-AIA ), first paragraph, and 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, rejections. Double Patenting The nonstatutory double patenting rejection is based on a judicially created doctrine grounded in public policy (a policy reflected in the statute) so as to prevent the unjustified or improper timewise extension of the “right to exclude” granted by a patent and to prevent possible harassment by multiple assignees. A nonstatutory double patenting rejection is appropriate where the conflicting claims are not identical, but at least one examined application claim is not patentably distinct from the reference claim(s) because the examined application claim is either anticipated by, or would have been obvious over, the reference claim(s). See, e.g., In re Berg, 140 F.3d 1428, 46 USPQ2d 1226 (Fed. Cir. 1998); In re Goodman, 11 F.3d 1046, 29 USPQ2d 2010 (Fed. Cir. 1993); In re Longi, 759 F.2d 887, 225 USPQ 645 (Fed. Cir. 1985); In re Van Ornum, 686 F.2d 937, 214 USPQ 761 (CCPA 1982); In re Vogel, 422 F.2d 438, 164 USPQ 619 (CCPA 1970); In re Thorington, 418 F.2d 528, 163 USPQ 644 (CCPA 1969). A timely filed terminal disclaimer in compliance with 37 CFR 1.321(c) or 1.321(d) may be used to overcome an actual or provisional rejection based on nonstatutory double patenting provided the reference application or patent either is shown to be commonly owned with the examined application, or claims an invention made as a result of activities undertaken within the scope of a joint research agreement. See MPEP § 717.02 for applications subject to examination under the first inventor to file provisions of the AIA as explained in MPEP § 2159. See MPEP § 2146 et seq. for applications not subject to examination under the first inventor to file provisions of the AIA . A terminal disclaimer must be signed in compliance with 37 CFR 1.321(b). The filing of a terminal disclaimer by itself is not a complete reply to a nonstatutory double patenting (NSDP) rejection. A complete reply requires that the terminal disclaimer be accompanied by a reply requesting reconsideration of the prior Office action. Even where the NSDP rejection is provisional the reply must be complete. See MPEP § 804, subsection I.B.1. For a reply to a non-final Office action, see 37 CFR 1.111(a). For a reply to final Office action, see 37 CFR 1.113(c). A request for reconsideration while not provided for in 37 CFR 1.113(c) may be filed after final for consideration. See MPEP §§ 706.07(e) and 714.13. The USPTO Internet website contains terminal disclaimer forms which may be used. Please visit www.uspto.gov/patent/patents-forms. The actual filing date of the application in which the form is filed determines what form (e.g., PTO/SB/25, PTO/SB/26, PTO/AIA /25, or PTO/AIA /26) should be used. A web-based eTerminal Disclaimer may be filled out completely online using web-screens. An eTerminal Disclaimer that meets all requirements is auto-processed and approved immediately upon submission. For more information about eTerminal Disclaimers, refer to www.uspto.gov/patents/apply/applying-online/eterminal-disclaimer. 6. Claims 145 and 166 are provisionally rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1, 83, 125, 145, 147, 150, 152, 162, 186-187, 190, 192, 199, 205, 227, 229-230 of copending Application No. 17/923,358 (reference application; U.S. 2023/0227856; claim set filed July 13, 2023). Although the claims at issue are not identical, they are not patentably distinct from each other. With respect to Claim 145, ‘358 claims (e.g. claims 1, 145, 186, 227, and 229) a method of making and selecting a population of genetically modified cells, the method comprising the steps of: A) contacting a population of starting cells with: (i) a nuclease that causes a break within an endogenous coding sequence of an essential gene in the cells, wherein the essential gene encodes GAPDH (e.g.), and (ii) a donor template that comprises a knock-in cassette comprising an exogenous coding sequence for a gene product of interest in frame with and downstream (3') of a partial coding sequence of the essential gene, wherein the knock-in cassette is integrated into the genome of a first plurality of cells of the population of starting cells by homology-directed repair (HDR) of the break, wherein the first plurality of cells express: (a) the gene product of interest, and (b) the gene product encoded by the essential gene. ‘358 claims (e.g. claims 205, 227, 229-230) wherein the essential gene is a housekeeping gene, more specifically, GAPDH. ‘358 claims (e.g. claims 147, 187) wherein the break is located within the last exon of the essential gene. ‘358 claims (e.g. claims 83, 125, 152, 192) wherein the donor template comprises a 5' homology arm upstream of the knock-in cassette and a 3' homology arm downstream of the knock-in cassette. ‘358 claims (e.g. claims 162, 199) wherein the exogenous partial coding sequence of the essential gene in the knock-in cassette encodes a C-terminal fragment of a protein encoded by the essential gene. Thus, the instant claims are anticipated by and/or obvious variants of the ‘358 claims. This is a provisional nonstatutory double patenting rejection because the patentably indistinct claims have not in fact been patented. 7. Claim 147 is provisionally rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1, 83, 125, 145, 147, 150, 152, 162, 186-187, 190, 192, 199, 205, 227, 229-230 of copending Application No. 17/923,358 (reference application; U.S. 2023/0227856; claim set filed July 13, 2023) in view of Han et al (cited above; available online August 29, 2019). Although the claims at issue are not identical, they are not patentably distinct from each other. With respect to Claim 147, ‘358 claims (e.g. claims 162, 199) does not claim the method further comprising selecting against a second plurality of cells of the population of starting cells, wherein the knock-in cassette is not integrated into the genomes of the second plurality of cells by homology-directed repair (HDR) in the correct position or orientation, and the second plurality of cells no longer express the gene product encoded by the essential gene. However, Han et al previously taught such a step (e.g. pg 6, last para, “average frequencies of GFP+ cells are over 2%”, “genome PCR and sequencing analysis of the sorted GFP+ cells (syn. selecting against the second plurality of cells) showed that the 2A-GFP fragment indeed integrated precisely at the 3’ end of the GAPDH gene”). Thus, the instant claims are an obvious variant of the ‘358 claims. This is a provisional nonstatutory double patenting rejection because the patentably indistinct claims have not in fact been patented. Conclusion 8. No claims are allowed. Any inquiry concerning this communication or earlier communications from the examiner should be directed to KEVIN K. HILL whose telephone number is (571)272-8036. The examiner can normally be reached 12pm-8pm EST. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Tracy Vivlemore can be reached at 571-272-2914. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. KEVIN K. HILL Examiner Art Unit 1638 /KEVIN K HILL/Primary Examiner, Art Unit 1638
Read full office action

Prosecution Timeline

Dec 12, 2023
Application Filed
May 06, 2024
Non-Final Rejection — §103, §112, §DP
Jun 28, 2024
Applicant Interview (Telephonic)
Jun 28, 2024
Examiner Interview Summary
Aug 08, 2024
Response Filed
Aug 26, 2024
Final Rejection — §103, §112, §DP
Nov 21, 2024
Applicant Interview (Telephonic)
Nov 21, 2024
Examiner Interview Summary
Dec 30, 2024
Request for Continued Examination
Jan 10, 2025
Response after Non-Final Action
Jan 27, 2025
Non-Final Rejection — §103, §112, §DP
Mar 31, 2025
Applicant Interview (Telephonic)
Mar 31, 2025
Examiner Interview Summary
Apr 30, 2025
Response Filed
May 19, 2025
Final Rejection — §103, §112, §DP
May 21, 2025
Response after Non-Final Action
Oct 17, 2025
Response after Non-Final Action
Oct 17, 2025
Notice of Allowance
Nov 18, 2025
Response after Non-Final Action
Dec 23, 2025
Request for Continued Examination
Dec 29, 2025
Response after Non-Final Action
Jan 26, 2026
Non-Final Rejection — §103, §112, §DP (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12589168
COMPOSITIONS AND METHODS FOR TREATING SENSORINEURAL HEARING LOSS USING OTOFERLIN DUAL VECTOR SYSTEMS
2y 5m to grant Granted Mar 31, 2026
Patent 12576135
Compositions and Methods for Anti-TnMUC1 Gold CAR T-cells
2y 5m to grant Granted Mar 17, 2026
Patent 12559717
GENE THERAPY FOR RECESSIVE DYSTROPHIC EPIDERMOLYSIS BULLOSA USING GENETICALLY CORRECTED AUTOLOGOUS KERATINOCYTES
2y 5m to grant Granted Feb 24, 2026
Patent 12544461
ISOLATED NUCLEIC ACID MOLECULE AND APPLICATION THEREOF
2y 5m to grant Granted Feb 10, 2026
Patent 12522636
COMPOSITIONS AND METHODS FOR DELIVERING CFTR POLYPEPTIDES
2y 5m to grant Granted Jan 13, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

AI Strategy Recommendation

Get an AI-powered prosecution strategy using examiner precedents, rejection analysis, and claim mapping.
Powered by AI — typically takes 5-10 seconds

Prosecution Projections

5-6
Expected OA Rounds
36%
Grant Probability
70%
With Interview (+33.7%)
3y 7m
Median Time to Grant
High
PTA Risk
Based on 845 resolved cases by this examiner. Grant probability derived from career allow rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month