Prosecution Insights
Last updated: April 17, 2026
Application No. 18/547,709

NOVEL CAR T-CELL PRODUCT AND METHOD OF PREPARATION THEREOF

Non-Final OA §112
Filed
Aug 24, 2023
Examiner
DUNN, LINDSAY MICHELLE
Art Unit
1644
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
unknown
OA Round
1 (Non-Final)
Grant Probability
Favorable
1-2
OA Rounds
3y 2m
To Grant

Examiner Intelligence

Grants only 0% of cases
0%
Career Allow Rate
0 granted / 0 resolved
-60.0% vs TC avg
Minimal +0% lift
Without
With
+0.0%
Interview Lift
resolved cases with interview
Typical timeline
3y 2m
Avg Prosecution
16 currently pending
Career history
16
Total Applications
across all art units

Statute-Specific Performance

§101
4.2%
-35.8% vs TC avg
§103
31.3%
-8.7% vs TC avg
§102
18.8%
-21.2% vs TC avg
§112
33.3%
-6.7% vs TC avg
Black line = Tech Center average estimate • Based on career data from 0 resolved cases

Office Action

§112
DETAILED ACTION 1. Claims 1, 4-5, 7-11, 13-16, 21-23, and 25 are currently pending. Notice of Pre-AIA or AIA Status 2. The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Priority 3. Application claims the benefit of PCT/IB2022/051670 filed on 2/25/2022. Claims were reviewed and the claimed subject matter is disclosed in the prior application. Therefore, the application is given priority to the above application and the effective filing date for the above claims is 2/25/2022. Claim Interpretation 4. Claims 7, and 21-23 are product-by-process claims. "[E]ven though product-by-process claims are limited by and defined by the process, determination of patentability is based on the product itself. The patentability of a product does not depend on its method of production. If the product in the product-by-process claim is the same as or obvious from a product of the prior art, the claim is unpatentable even though the prior product was made by a different process." In re Thorpe, 777 F.2d 695, 698, 227 USPQ 964, 966 (Fed. Cir. 1985). (See MPEP 2113) Therefore, examination will be determined based on the structure of the product in the claim and not by the process used to manufacture the product. Claim Objections 5. Claims 1, 4-5, 7-11, 13-16, 21-23, and 25 are objected to because of the following informalities: Please review all claims for proper singular and plural forms and keep forms consistent, for example “CAR T cell product(s)” in all claims Please re-write “signalling” to “signaling” Please review claims for unnecessary extra words, for example from claim 1: “the CAR gene nucleotide sequence is as per SEQ ID NO:1” Please review claims for proper verb form within claims, for example from claim 5: ‘wherein the CAR gene sequence comprising DNA encoded….” Please replace the phrase “The CAR T cell products as claimed in claim 1” with “The CAR T cell products of claim 1” in all dependent claims Please review all claims for consistency of reference to claim elements, for example: “CD8a hinge region” of claim 1 is referred to as “the hinge region in claim 8 Appropriate correction is required. Claim Rejections - 35 USC § 112 The following is a quotation of 35 U.S.C. 112(b): (b) CONCLUSION.—The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the inventor or a joint inventor regards as the invention. The following is a quotation of 35 U.S.C. 112 (pre-AIA ), second paragraph: The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the applicant regards as his invention. 6. Claims 1, 4-5, 7-11, 13-16, 21-23, and 25 are rejected under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter which the inventor or a joint inventor (or for applications subject to pre-AIA 35 U.S.C. 112, the applicant), regards as the invention. Claim 1 recites a CAR T cell product, followed by the phrase “which is further used by cutting to remove the 41BB domain…and cutting to remove…to generate CAR T cell products”. This entire phrase renders claim 1 indefinite because it is considered a method or process step using the CAR T cell product, rendering the claim unclear as to whether a product or a process invention is being claimed. It is unclear what is “further used” when there is nothing recited as first being used. The metes and bounds of the claimed invention cannot be determined. Claim 1 further recites, “the second generation CD19-CD28-CD3z CAR gene as per SEQ ID No.2 and cutting to remove the CD28 domain to generate the CD19-41BB-CD3z CAR gene as per SEQ ID No.3 to generate CAR T cell products.” This phrase is indefinite because the 41BB domain is cut out of the SEQ ID NO:2 but then reappears in SEQ ID NO:3 without any explanation of how it was added back into the sequence. Claim 1 recites the phrase: “where in the CAR gene nucleotide sequence is as per SEQ ID No. 1”. This phrase renders the claim unclear with regard to what nucleotide sequence is comprised by the CAR gene. Does the phrase “is as per SEQ ID No. 1” mean the CAR gene comprises SEQ ID No. 1? Or does it mean the CAR gene is similar to or like SEQ ID No.1? The metes and bounds of the claimed invention cannot be determined. Similarly, claim 1 recites the phrases “as per SEQ ID No. 2” and “as per SEQ ID No. 3” to describe second generation CAR gene and another CAR gene. These phrases render the claim unclear with regard to what nucleotide sequence is comprised by each of the CAR genes. Do the phrases “as per SEQ ID No.” mean the CAR gene comprises SEQ ID No. 2 or 3? Or does it mean the CAR gene is similar to or like SEQ ID No.2 or 3? The metes and bounds of the claimed invention cannot be determined. As claim 1 is written, it cannot be determined what the structure of the final product of the claim would be. Since all other claims depend from claim 1, this makes the entire claimed invention indefinite. Claim 5 recites the limitation "the CAR gene sequence comprising DNA encoding a chimeric antigen receptor (CAR) protein". It is unclear which CAR gene sequence of claim 1 is being referenced and no CAR gene sequences were previously identified in claim 1 specifically as “comprising DNA encoding chimeric antigen receptor (CAR) protein.” In regard to claim 7, the claim is indefinite because it is not clear what the structural product would be after using PCR or restriction enzymes to cut at critical junctions. In regard to claim 8, the claim recites, “use of combinations of these restriction enzymes or along with suitable restriction enzymes to cut the sequences in upstream or downstream to replace the single chain variable chain of antibody sequence or signalling domain sequence to generate new CAR T cell product.” It is unclear what restriction enzymes are being referred to in this section, possibly even reciting additional restriction enzymes not listed above. Additionally, the phrase “cut the sequences upstream or downstream” is unclear as to where the sequence is being cut. Further, the phrase appears to be a method step or process claim and it is unclear if the invention is directed to a product or a process. The metes and bounds of the claimed invention cannot be determined. Claim 13 recites the CAR T cell products of claim 1 followed by the phrase: “is used for parenteral or local administration in the patients”. The phrase appears to be a method step or process claim and it is unclear if the invention is directed to a product with an intended use or to a process. The metes and bounds of the claimed invention cannot be determined. Claim 14 is directed to the CAR T cell product of claim 1 and recites the phrase: "wherein the CAR gene sequence is cloned into a DNA cloning vector…” The phrase appears to be a method step or process claim and it is unclear if the invention is directed to a product with an intended use or to a process. The metes and bounds of the claimed invention cannot be determined. Claim 16 recites the phrase: “or remain as an extra chromosomal DNA”. There was no prior mention of DNA encoding the CAR existing as extra chromosomal DNA in a cell in claim 1, therefore it is unclear how it can remain so. Clarification is required. In regard to claim 21, the phrase “wherein the CAR T cell product is manufactured using soluble anti-CD3 and anti-CD28 antibodies based activation of T cell without utilizing anti-CD3 bead or anti-CD29 bead” is indefinite. It is unclear what this limitation is referring to and how it affects the structure of the product. In regard to claim 22, the claim is indefinite because it recites using T cells from peripheral blood mononuclear cells but does not explain how the peripheral blood mononuclear cells are obtained. Further, the phrase “and then infecting using CAR gene containing viral particles to generate CAR T cells” is unclear and indefinite. In regard to claim 23, the phrase “infecting them with CAR gene containing viral particles” is indefinite. It is unclear what exactly is being “infected” and what exactly is a “CAR gene containing viral particle.” Claim 25 recites the CAR T cell products of claim 1 followed by the phrase: “are used in the process of transfecting 293T cells…” The phrase appears to be a method step or process claim and it is unclear if the invention is directed to a product or a process. The metes and bounds of the claimed invention cannot be determined. 7. Claims 4, 7-11, 14, 16, 21, 23 and 25 are all rejected under 35 U.S.C. 112(b) for lack of antecedent basis. Claim 4 recites the limitation “the signalling domains” in line 2. There is insufficient antecedent basis for this limitation in the claim. Claim 1 which claim 4 depends from lists three different signaling domains, please re-write to cite the correct signaling domain. Claim 7 recites the limitation “the critical junction” in line 3. There is insufficient antecedent basis for this limitation in the claim. Please re-write the claim to reference “a” critical junction. Claim 8 recites the limitation “restriction enzymes” in line 1. There is insufficient antecedent basis for this limitation in the claim. Claim 8 depends from claim 1 which does not cite restriction enzymes. Restriction enzymes are first disclosed in claim 4. It is suggested that applicant re-write claim 8 to depend from claim 4. Further, in claim 8 the use of “these restriction enzymes” is not a proper antecedent basis. Following after the first recitation, proper antecedent basis should use “the” or “said.” Claim 8 further recites the limitations "wherein restriction enzymes is selected from", “the hinge region”, “the single chain antibody sequence”, “the junction between CD3z signalling domain sequence and co-stimulatory domain sequence”. There is insufficient antecedent basis for these limitations in the claim. Claim 9 recites the limitation "the antibody domain" and “the signaling domain” in lines 2-3. There is insufficient antecedent basis for this limitation in the claim. Claim 9 depends from claim 1, which cites “anti-CD19 antibody” and “signaling domain of CD28” and “signaling domain of 41BB” and “CD3z signaling domain.” Please re-write the claim to specify what is being further limited. Claim 10 recites the limitation “the alternative antibody domain” in lines 1-2. There is insufficient antecedent basis for this limitation in this claim. Claim 10 depends from claim 1, which does not recite “an alternative antibody domain.” This is listed in claim 9. It is suggested applicant re-write the claim to depend from claim 9. Claim 11 recites the limitation “the alternative signaling domain” in lines 1-2. There is insufficient antecedent basis for this limitation in this claim. Claim 11 depends from claim 1, which does not recite “an alternative antibody domain.” This is listed in claim 9. It is suggested applicant re-write the claim to depend from claim 9. Claim 13 recites the limitation "the patient”. There is insufficient antecedent basis for this limitation in the claim. Claim 14 recites the limitation “the CAR gene sequence” in line 2. There is insufficient antecedent basis for this limitation in this claim. Claim 1 from which claim 14 depends lists 3 different CAR gene sequences, SEQ ID NO:1, 2, and 3. There is not a definite “CAR gene sequence of claim 1” to cite. Claim 16 recites the phrase: “the genome of the cell”. There is insufficient antecedent basis for this limitation in the claim. Claim 16 recites the limitation “wherein DNA encoding the CAR” in line 2. There is insufficient antecedent basis for this limitation in this claim. Claim 1 from which claim 16 depends does not cite a DNA encoding the CAR. This is cited in claim 5. Claim 21 recites the limitation “the soluble anti-CD3 and anti-CD28 antibodies” in lines 2-3. There is insufficient basis for the limitation in this claim. There are no prior claims reciting a soluble anti-CD3 and anti-CD28 antibodies. It is suggested that applicant replace “the” with “a.” Claim 23 recites the limitation “the in vitro cultures” in lines 2-3. There is insufficient basis for the limitation in this claim. There are no prior claims reciting an in vitro culture. It is suggested that applicant remove “the.” Claim 25 recites the limitation “the CAR gene sequence” in lines 1-2. There is insufficient basis for the limitation in this claim. Claim 1 from which claim 25 depends lists 3 different CAR gene sequences, SEQ ID NO:1, 2, and 3. There is not a definite “CAR gene sequence of claim 1” to cite. 35 U.S.C 112(d)- Failure to Further Limit Subject Matter The following is a quotation of 35 U.S.C. 112(d): (d) REFERENCE IN DEPENDENT FORMS.—Subject to subsection (e), a claim in dependent form shall contain a reference to a claim previously set forth and then specify a further limitation of the subject matter claimed. A claim in dependent form shall be construed to incorporate by reference all the limitations of the claim to which it refers. The following is a quotation of pre-AIA 35 U.S.C. 112, fourth paragraph: Subject to the following paragraph [i.e., the fifth paragraph of pre-AIA 35 U.S.C. 112], a claim in dependent form shall contain a reference to a claim previously set forth and then specify a further limitation of the subject matter claimed. A claim in dependent form shall be construed to incorporate by reference all the limitations of the claim to which it refers. NOTE: For the sake of compact prosecution, the rejection below assumes Applicants intended claim 1 to recite the CAR gene nucleotide sequence comprises the amino acid sequence of SEQ ID NO:1, SEQ ID NO:2, or SEQ ID NO:3, rather than portions of it. 8. Claim 5 is rejected under 35 U.S.C. 112(d) or pre-AIA 35 U.S.C. 112, 4th paragraph, as being of improper dependent form for failing to further limit the subject matter of the claim upon which it depends, or for failing to include all the limitations of the claim upon which it depends. Claim 5 recites, “a CAR protein which is at least 90% identical to SEQ ID NO:1, 2, and 3.” This is improper because claim 1 from which claim 5 depends requires the SEQ ID NO: 1, 2, and 3 to be complete. At least 90% improperly broadens the claim from which it depends. Claim 15 is rejected under 35 U.S.C. 112(d) or pre-AIA 35 U.S.C. 112, 4th paragraph, as being of improper dependent form for failing to further limit the subject matter of the claim upon which it depends, or for failing to include all the limitations of the claim upon which it depends. Claim 15 is dependent on claim 1 which recites the nucleotide sequences of SEQ ID NO: 1, 2, and 3. Claim 15 further limits to at least 90% of SEQ ID NO:4, 5, or 6. This improperly broadens the disclosure of claim 1. Applicant may cancel the claim(s), amend the claim(s) to place the claim(s) in proper dependent form, rewrite the claim(s) in independent form, or present a sufficient showing that the dependent claim(s) complies with the statutory requirements. Broadest Reasonable Interpretation 9. During patent examination, the pending claims must be "given their broadest reasonable interpretation consistent with the specification." The Federal Circuit’s en banc decision in Phillips v. AWH Corp., 415 F.3d 1303, 1316, 75 USPQ2d 1321, 1329 (Fed. Cir. 2005). Applying this standard to claim 1, the broadest reasonable interpretation is that claim 1 is drawn to a CAR T cell that comprises a nucleotide sequence that includes a single chain variable region of anti-CD19 antibody, signaling domain of CD28, signaling domain of 41BB, transmembrane region of CD8a, CD8a hinge region, and CD3z signaling domain along with leader and linker sequences containing the nucleotide sequence of SEQ ID NO:1, 2, or 3. For all of the above 112(b) and (d) rejections listed, the broadest reasonable interpretation of the claim is difficult to determine. A search did find Brogdon (U.S. Patent Publication No. 20140271635). Brogdon discloses a nucleic acid sequence encoding a CAR T cell which contains an anti-CD19 binding domain, and intracellular signaling domains that can include CD3z, CD28, and 41BB (See Brogdon, pg. 25 [0148]). Further, Brogdon discloses SEQ ID NO:96 which is 87.8% identical to SEQ ID NO:1, 87.8% identical to SEQ ID NO:2, and 96.0% identical to SEQ ID NO:3. It is requested that applicant respond to the rejections under 35 U.S.C. 112(b) before a more thorough examination of the patentability of the claimed invention can be made. Instant SEQ ID NO:1 aligned with Brogdon SEQ ID NO:96: RESULT 3 US-14-214-728-96 Publication No. US20140271635A1 GENERAL INFORMATION APPLICANT: NOVARTIS AG APPLICANT: TRUSTEES OF THE UNIVERSITY OF PENNSYLVANIA TITLE OF INVENTION: TREATMENT OF CANCER USING HUMANIZED ANTI-CD19 CHIMERIC ANTIGEN TITLE OF INVENTION: RECEPTOR FILE REFERENCE: N2067-7002WO CURRENT APPLICATION NUMBER: US/14/214,728 CURRENT FILING DATE: 2014-03-15 PRIOR APPLICATION NUMBER: 61/838,537 PRIOR FILING DATE: 2013-06-24 PRIOR APPLICATION NUMBER: 61/802,629 PRIOR FILING DATE: 2013-03-16 NUMBER OF SEQ ID NOS: 121 SEQ ID NO 96 LENGTH: 1458 TYPE: DNA ORGANISM: Artificial Sequence FEATURE: NAME/KEY: source OTHER INFORMATION: /note="Description of Artificial Sequence: Synthetic polynucleotide" Query Match 87.8%; Score 1296.2; Length 1458; Best Local Similarity 94.0%; Matches 1385; Conservative 0; Mismatches 73; Indels 15; Gaps 3; Qy 1 ATGGCCCTCCCTGTCACCGCCCTGCTGCTTCCGCTGGCTCTTCTGCTCCACGCCGCTCGG 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 ATGGCCCTCCCTGTCACCGCCCTGCTGCTTCCGCTGGCTCTTCTGCTCCACGCCGCTCGG 60 Qy 61 CCCGAAATTGTGATGACCCAGTCACCCGCCACTCTTAGCCTTTCACCCGGTGAGCGCGCA120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 CCCGAAATTGTGATGACCCAGTCACCCGCCACTCTTAGCCTTTCACCCGGTGAGCGCGCA120 Qy 121 ACCCTGTCTTGCAGAGCCTCCCAAGACATCTCAAAATACCTTAATTGGTATCAACAGAAG180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 ACCCTGTCTTGCAGAGCCTCCCAAGACATCTCAAAATACCTTAATTGGTATCAACAGAAG180 Qy 181 CCCGGACAGGCTCCTCGCCTTCTGATCTACCACACCAGCCGGCTCCATTCTGGAATCCCT240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 CCCGGACAGGCTCCTCGCCTTCTGATCTACCACACCAGCCGGCTCCATTCTGGAATCCCT240 Qy 241 GCCAGGTTCAGCGGTAGCGGATCTGGGACCGACTACACCCTCACTATCAGCTCACTGCAG300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 GCCAGGTTCAGCGGTAGCGGATCTGGGACCGACTACACCCTCACTATCAGCTCACTGCAG300 Qy 301 CCAGAGGACTTCGCTGTCTATTTCTGTCAGCAAGGGAACACCCTGCCCTACACCTTTGGA360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 CCAGAGGACTTCGCTGTCTATTTCTGTCAGCAAGGGAACACCCTGCCCTACACCTTTGGA360 Qy 361 CAGGGCACCAAGCTCGAGATTAAAGGTGGAGGTGGCAGCGGAGGAGGTGGGTCCGGCGGT420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 CAGGGCACCAAGCTCGAGATTAAAGGTGGAGGTGGCAGCGGAGGAGGTGGGTCCGGCGGT420 Qy 421 GGAGGAAGCCAGGTCCAACTCCAAGAAAGCGGACCGGGTCTTGTGAAGCCATCAGAAACT480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 GGAGGAAGCCAGGTCCAACTCCAAGAAAGCGGACCGGGTCTTGTGAAGCCATCAGAAACT480 Qy 481 CTTTCACTGACTTGTACTGTGAGCGGAGTGTCTCTCCCCGATTACGGGGTGTCTTGGATC540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 481 CTTTCACTGACTTGTACTGTGAGCGGAGTGTCTCTCCCCGATTACGGGGTGTCTTGGATC540 Qy 541 AGACAGCCACCGGGGAAGGGTCTGGAATGGATTGGAGTGATTTGGGGCTCTGAGACTACT600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 541 AGACAGCCACCGGGGAAGGGTCTGGAATGGATTGGAGTGATTTGGGGCTCTGAGACTACT600 Qy 601 TACTACAACTCATCCCTCAAGTCACGCGTCACCATCTCAAAGGACAACTCTAAGAATCAG660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 601 TACTACAACTCATCCCTCAAGTCACGCGTCACCATCTCAAAGGACAACTCTAAGAATCAG660 Qy 661 GTGTCACTGAAACTGTCATCTGTGACCGCAGCCGACACCGCCGTGTACTATTGCGCTAAG720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 661 GTGTCACTGAAACTGTCATCTGTGACCGCAGCCGACACCGCCGTGTACTATTGCGCTAAG720 Qy 721 CATTACTATTATGGCGGGAGCTACGCAATGGATTACTGGGGACAGGGTACTCTGGTCACC780 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 721 CATTACTATTATGGCGGGAGCTACGCAATGGATTACTGGGGACAGGGTACTCTGGTCACC780 Qy 781 GTGTCCAGCGTTAACACCACTACCCCAGCACCGAGGCCACCCACCCCGGCTCCTACCATC840 |||||||| |||||||||||||||||||||||||||||||||||||||||||||| Db 781 GTGTCCAG------CACCACTACCCCAGCACCGAGGCCACCCACCCCGGCTCCTACCATC834 Qy 841 GCCTCCCAGCCTCTGTCCCTGCGTCCGGAGGCATGTAGACCCGCAGCTGGTGGGGCCGTG900 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 835 GCCTCCCAGCCTCTGTCCCTGCGTCCGGAGGCATGTAGACCCGCAGCTGGTGGGGCCGTG894 Qy 901 CATACCCGGGGTCTTGACTTCGCCTGCGATATCTACATTTGGGCCCCTCTGGCTGGTACT960 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 895 CATACCCGGGGTCTTGACTTCGCCTGCGATATCTACATTTGGGCCCCTCTGGCTGGTACT954 Qy 961 TGCGGGGTCCTGCTGCTTTCACTCGTGATCACTCTTTACTGTAGGAGTAAGAGGAGCAGG 1020 ||||||||||||||||||||||||||||||||||||||||||| | | ||| | | Db 955 TGCGGGGTCCTGCTGCTTTCACTCGTGATCACTCTTTACTGTAAGCGCGGTCGGAAGAAG 1014 Qy 1021 CTCCTGCACAGTGACTACATGAACATGACTCCCCGCCGCCCCGGGCCCACCCGCAAGCAT 1080 || ||| ||| | | | || || | | ||| | | |||| Db 1015 CTGCTGTACA-----TCTTTAAGCAACCCTTCATGAGGCCTGTGCAGACTACTCAAG--- 1066 Qy 1081 TACCAGCCCTATGCCCCACCACGCGACTTCGCAGCCTATCGCTCCGGTGGCGGATCCCGC 1140 | || | || || | | | | ||| ||| | ||| Db 1067 -AGGAGGACGGCTGTTCATGCCGGTTCCCAGAGGAGGAGGAAGGCGGCTGCGAACTGCGC 1125 Qy 1141 GTGAAATTCAGCCGCAGCGCAGATGCTCCAGCCTACAAGCAGGGGCAGAACCAGCTCTAC 1200 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1126 GTGAAATTCAGCCGCAGCGCAGATGCTCCAGCCTACAAGCAGGGGCAGAACCAGCTCTAC 1185 Qy 1201 AACGAACTCAATCTTGGTCGGAGAGAGGAGTACGACGTGCTGGACAAGCGGAGAGGACGG 1260 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1186 AACGAACTCAATCTTGGTCGGAGAGAGGAGTACGACGTGCTGGACAAGCGGAGAGGACGG 1245 Qy 1261 GACCCAGAAATGGGCGGGAAGCCGCGCAGAAAGAATCCCCAAGAGGGCCTGTACAACGAG 1320 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1246 GACCCAGAAATGGGCGGGAAGCCGCGCAGAAAGAATCCCCAAGAGGGCCTGTACAACGAG 1305 Qy 1321 CTCCAAAAGGATAAGATGGCAGAAGCCTATAGCGAGATTGGTATGAAAGGGGAACGCAGA 1380 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1306 CTCCAAAAGGATAAGATGGCAGAAGCCTATAGCGAGATTGGTATGAAAGGGGAACGCAGA 1365 Qy 1381 AGAGGCAAAGGCCACGACGGACTGTACCAGGGACTCAGCACCGCCACCAAGGACACCTAT 1440 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1366 AGAGGCAAAGGCCACGACGGACTGTACCAGGGACTCAGCACCGCCACCAAGGACACCTAT 1425 Qy 1441 GACGCTCTTCACATGCAGGCCCTGCCGCCTCGG 1473 ||||||||||||||||||||||||||||||||| Db 1426 GACGCTCTTCACATGCAGGCCCTGCCGCCTCGG 1458 Instant SEQ ID NO:4 aligned with Brogdon SEQ ID NO:42: ESULT 4 US-14-214-728-42 Sequence 42, US/14214728 Publication No. US20140271635A1 GENERAL INFORMATION APPLICANT: NOVARTIS AG APPLICANT: TRUSTEES OF THE UNIVERSITY OF PENNSYLVANIA TITLE OF INVENTION: TREATMENT OF CANCER USING HUMANIZED ANTI-CD19 CHIMERIC ANTIGEN TITLE OF INVENTION: RECEPTOR FILE REFERENCE: N2067-7002WO CURRENT APPLICATION NUMBER: US/14/214,728 CURRENT FILING DATE: 2014-03-15 PRIOR APPLICATION NUMBER: 61/838,537 PRIOR FILING DATE: 2013-06-24 PRIOR APPLICATION NUMBER: 61/802,629 PRIOR FILING DATE: 2013-03-16 NUMBER OF SEQ ID NOS: 121 SEQ ID NO 42 LENGTH: 486 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: NAME/KEY: source OTHER INFORMATION: /note="Description of Artificial Sequence: Synthetic polypeptide" Query Match 89.0%; Score 2524.5; Length 486; Best Local Similarity 91.2%; Matches 486; Conservative 0; Mismatches 0; Indels 47; Gaps 3; Qy 1 MALPVTALLLPLALLLHAARPEIVMTQSPATLSLSPGERATLSCRASQDISKYLNWYQQK 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MALPVTALLLPLALLLHAARPEIVMTQSPATLSLSPGERATLSCRASQDISKYLNWYQQK 60 Qy 61 PGQAPRLLIYHTSRLHSGIPARFSGSGSGTDYTLTISSLQPEDFAVYFCQQGNTLPYTFG120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 PGQAPRLLIYHTSRLHSGIPARFSGSGSGTDYTLTISSLQPEDFAVYFCQQGNTLPYTFG120 Qy 121 QGTKLEIKGGGGSGGGGSGGGGSQVQLQESGPGLVKPSETLSLTCTVSGVSLPDYGVSWI180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 QGTKLEIKGGGGSGGGGSGGGGSQVQLQESGPGLVKPSETLSLTCTVSGVSLPDYGVSWI180 Qy 181 RQPPGKGLEWIGVIWGSETTYYNSSLKSRVTISKDNSKNQVSLKLSSVTAADTAVYYCAK240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 RQPPGKGLEWIGVIWGSETTYYNSSLKSRVTISKDNSKNQVSLKLSSVTAADTAVYYCAK240 Qy 241 HYYYGGSYAMDYWGQGTLVTVSSVNTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAV300 ||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||| Db 241 HYYYGGSYAMDYWGQGTLVTVSS--TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAV298 Qy 301 HTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCRSKRSRLLHSDYMNMTPRRPGPTRKH360 |||||||||||||||||||||||||||||||||| Db 299 HTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYC--------------------------332 Qy 361 YQPYAPPRDFAAYRSKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELGGG420 |||||||||||||||||||||||||||||||||||||||||| Db 333 ---------------KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL---374 Qy 421 SRVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLY480 ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 375 -RVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLY433 Qy 481 NELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR 533 ||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 434 NELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR 486 Conclusion 10. Claims 1, 4-5, 7-11, 13-16, 21-23, and 25 are all rejected. 11. Any inquiry concerning this communication or earlier communications from the examiner should be directed to LINDSAY DUNN whose telephone number is (571)272-5825. The examiner can normally be reached Monday-Friday 8-4:30. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Samira Jean-Louis can be reached at 571-270-3503. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /LINDSAY DUNN/Examiner, Art Unit 1644 /Laura B Goddard/Primary Examiner, Art Unit 1642
Read full office action

Prosecution Timeline

Aug 24, 2023
Application Filed
Feb 25, 2026
Non-Final Rejection — §112 (current)

AI Strategy Recommendation

Get an AI-powered prosecution strategy using examiner precedents, rejection analysis, and claim mapping.
Powered by AI — typically takes 5-10 seconds

Prosecution Projections

1-2
Expected OA Rounds
Grant Probability
3y 2m
Median Time to Grant
Low
PTA Risk
Based on 0 resolved cases by this examiner. Grant probability derived from career allow rate.

Sign in for Full Analysis

Enter your email to receive a magic link. No password needed.

Free tier: 3 strategy analyses per month