Prosecution Insights
Last updated: September 17, 2026
Application No. 18/550,055

FUSION PROTEIN OF TNFR2 AND APRIL BAFF RECEPTOR

Non-Final OA §102§DP
Filed
Sep 12, 2023
Priority
Mar 12, 2021 — CN 202110272529.9 +1 more
Examiner
XIAO, YAN
Art Unit
1642
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Shanghai Celgen Bio-Pharmaceutical Co. Ltd.
OA Round
1 (Non-Final)
67%
Grant Probability
Favorable
1-2
OA Rounds
0m
Est. Remaining
99%
With Interview

Examiner Intelligence

Grants 67% — above average
67%
Career Allowance Rate
516 granted / 768 resolved
+7.2% vs TC avg
Strong +53% interview lift
Without
With
+52.6%
Interview Lift
resolved cases with interview
Typical timeline
2y 11m
Avg Prosecution
45 currently pending
Career history
799
Total Applications
across all art units

Statute-Specific Performance

§101
4.8%
-35.2% vs TC avg
§103
26.4%
-13.6% vs TC avg
§102
18.5%
-21.5% vs TC avg
§112
27.0%
-13.0% vs TC avg
Black line = Tech Center average estimate • Based on career data from 768 resolved cases

Office Action

§102 §DP
Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . DETAILED ACTION 2. The election filed on 07/12/2026 in response to the Office Action of 05/13/2026 is acknowledged and has been entered. Applicant has elected Group I, claims 1-5, 10 and 12, drawn to a fusion protein, which comprises the following fused elements: (a) TNF receptor or active fragment thereof; (b) APRIL/BAFF receptor or active fragment thereof, wherein the APRIL/BAFF receptor includes TACI, BCMA, BAFFR, and combinations thereof; and optionally (c) antibody Fc region; wherein, the fusion protein retains the biological activity of above elements (a) and (b). Because applicant did not distinctly and specifically point out any supposed errors in the restriction requirement, the election has been treated as an election without traverse. See MPEP 818.03(a). Claims 1-10 and 12-13 are pending in the application. Claims 6-9 and 13 have been withdrawn from further consideration pursuant to 37 CFR 1.142(b) as being drawn to a nonelected invention, there being no allowable generic or linking claim. Election was made without traverse in the reply filed on 07/12/2026. Claims 1-5, 10 and 12 are currently under prosecution. Priority 5. Applicant’s claim under 35 U.S.C. §§ 365(c) for benefit of the earlier filing date of application, is acknowledged. Receipt is acknowledged of papers submitted under 35 U.S.C. 119(a)-(d), which papers have been placed of record in the file. Claim Objections 7. Claim 1 is objected to because of the following informalities: Claim 1, “the” in line 1 is duplicated. 8. In the event the determination of the status of the application as subject to AIA 35 U.S.C. 102 and 103 (or as subject to pre-AIA 35 U.S.C. 102 and 103) is incorrect, any correction of the statutory basis for the rejection will not be considered a new ground of rejection if the prior art relied upon, and the rationale supporting the rejection, would be the same under either status. Claim Rejections - 35 USC § 102 9. The following is a quotation of the appropriate paragraphs of 35 U.S.C. 102 that form the basis for the rejections under this section made in this Office action: A person shall be entitled to a patent unless – (a)(1) the claimed invention was patented, described in a printed publication, or in public use, on sale or otherwise available to the public before the effective filing date of the claimed invention. 10. Claims 1-3, 5, 10 and 12 are rejected under 35 U.S.C. 102(a)(1) as being anticipated by Lofquist et al. (US 20110152173, published on 06/23/2011) (of record). Claims 1-3, 5, 10 and 12 are herein drawn to a fusion protein, which comprises the following fused elements: (a) TNF receptor or active fragment thereof; (b) APRIL/BAFF receptor or active fragment thereof, wherein the APRIL/BAFF receptor includes TACI, BCMA, BAFFR, and combinations thereof; and optionally (c) antibody Fc region; wherein, the fusion protein retains the biological activity of above elements (a) and (b). Lofquist et al. teach a multi-target fusion protein comprises a TNF-α antagonist and a BLyS/APRIL antagonist (e.g., TACI, BCMA, BAFFR); see entire document, e.g., abstract, [0030], [0109]. Lofquist et al. teach the fusion protein further comprising an Fc region at N-terminus or C-terminus of the fusion protein; see [0126-0128]. For claim 2, Lofquist et al. teach the fusion protein can be used to treat a disease associated with TNFα; see [0197]. For claim 5, Lofquist et al. teach amino acids 23-185 of SEQ ID NO:671 of TNFα; see [0033]. Lofquist et al. teach the first 166 amino acids of TACI (SEQ ID NO: 743); see [0111]. SEQ ID NOs: 671 and 743 of Lofquist et al. are 100% identical with the instant claimed SEQ ID NOs: 13-14; see sequence alignment below. For claim 10, Lofquist et al. teach a pharmaceutical composition comprising the fusion protein and a pharmaceutically acceptable carrier; see [0199]. For claim 12, Lofquist et al. teach the fusion protein can be used to treat an inflammatory, autoimmune diseases; see claims 13-14. Double Patenting 11. The nonstatutory double patenting rejection is based on a judicially created doctrine grounded in public policy (a policy reflected in the statute) so as to prevent the unjustified or improper timewise extension of the “right to exclude” granted by a patent and to prevent possible harassment by multiple assignees. A nonstatutory double patenting rejection is appropriate where the claims at issue are not identical, but at least one examined application claim is not patentably distinct from the reference claim(s) because the examined application claim is either anticipated by, or would have been obvious over, the reference claim(s). See, e.g., In re Berg, 140 F.3d 1428, 46 USPQ2d 1226 (Fed. Cir. 1998); In re Goodman, 11 F.3d 1046, 29 USPQ2d 2010 (Fed. Cir. 1993); In re Longi, 759 F.2d 887, 225 USPQ 645 (Fed. Cir. 1985); In re Van Ornum, 686 F.2d 937, 214 USPQ 761 (CCPA 1982); In re Vogel, 422 F.2d 438, 164 USPQ 619 (CCPA 1970); and In re Thorington, 418 F.2d 528, 163 USPQ 644 (CCPA 1969). A timely filed terminal disclaimer in compliance with 37 CFR 1.321(c) or 1.321(d) may be used to overcome an actual or provisional rejection based on a nonstatutory double patenting ground provided the reference application or patent either is shown to be commonly owned with this application, or claims an invention made as a result of activities undertaken within the scope of a joint research agreement. A terminal disclaimer must be signed in compliance with 37 CFR 1.321(b). The USPTO internet Web site contains terminal disclaimer forms which may be used. Please visit http://www.uspto.gov/forms/. The filing date of the application will determine what form should be used. A web-based eTerminal Disclaimer may be filled out completely online using web-screens. An eTerminal Disclaimer that meets all requirements is auto-processed and approved immediately upon submission. For more information about eTerminal Disclaimers, refer to http://www.uspto.gov/patents/process/file/efs/guidance/eTD-info-I.jsp. 12. Claims 1-3, 5, 10 and 12 are rejected on the ground of nonstatutory obviousness-type double patenting as being unpatentable over claims 1-4, 9 and 14-17 of U.S. Patent No. 10,562,954. Although the conflicting claims are not identical, they are not patentably distinct from each other because for the following reasons: Claims 1-3, 5, 10 and 12 are herein drawn to a fusion protein, which comprises the following fused elements: (a) TNF receptor or active fragment thereof; (b) APRIL/BAFF receptor or active fragment thereof, wherein the APRIL/BAFF receptor includes TACI, BCMA, BAFFR, and combinations thereof; and optionally (c) antibody Fc region; wherein, the fusion protein retains the biological activity of above elements (a) and (b). Claims 1-4, 9 and 14-17 of U.S. Patent No. 10,562,954 are drawn to a fusion protein, which comprises: (a) an extracellular region of a TNF receptor, wherein the extracellular region comprises amino acids 23-76 of human TNF-R2; (b) an extracellular region of a BAFF receptor, wherein the extracellular region comprises amino acids 30-119 of human TACI; and (c) a human antibody Fc region; wherein (a), (b), and (c) are in the order of, from N-terminus to C-terminus, (a)-(b)-(c) or (b)-(a)-(c); and wherein the fusion protein inhibits the formation of a TACI-BAFF complex, and lowers the concentration of IgE in serum. Conclusion 13. Claims 1-3, 5, 10 and 12 are rejected. Claim 4 is objected to as being dependent upon a rejected base claim. 14. Any inquiry concerning this communication or earlier communications from the examiner should be directed to YAN XIAO whose telephone number is (571)270-3578. The examiner can normally be reached M-F 8-5 EST. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Samira Jean-Louis can be reached on 571-270-3503. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /YAN XIAO/Primary Examiner, Art Unit 1642 Sequence alignment US-13-001-087-671 Filing date in PALM: 2011-03-03 Sequence 671, US/13001087 Publication No. US20110152173A1 GENERAL INFORMATION APPLICANT: Lofquist, Alan Keith APPLICANT: Mohler, Kendall APPLICANT: Baum, Peter Robert APPLICANT: Thompson, Peter Armstrong APPLICANT: Misher, Lynda TITLE OF INVENTION: TNF-alpha Antagonist Multi-Target Binding Proteins FILE REFERENCE: 2479.0940008 CURRENT APPLICATION NUMBER: US/13/001,087 CURRENT FILING DATE: 2011-03-03 PRIOR APPLICATION NUMBER: PCT/US2009/049603 PRIOR FILING DATE: 2009-07-02 PRIOR APPLICATION NUMBER: US 61/180,097 PRIOR FILING DATE: 2009-05-20 PRIOR APPLICATION NUMBER: US 61/134,095 PRIOR FILING DATE: 2008-07-02 PRIOR APPLICATION NUMBER: US 61/134,096 PRIOR FILING DATE: 2008-07-02 PRIOR APPLICATION NUMBER: US 61/134,097 PRIOR FILING DATE: 2008-07-02 PRIOR APPLICATION NUMBER: US 61/134,098 PRIOR FILING DATE: 2008-07-02 PRIOR APPLICATION NUMBER: US 61/134,099 PRIOR FILING DATE: 2008-07-02 PRIOR APPLICATION NUMBER: US 61/134,100 PRIOR FILING DATE: 2008-07-02 PRIOR APPLICATION NUMBER: US 61/134,101 PRIOR FILING DATE: 2008-07-02 NUMBER OF SEQ ID NOS: 834 SEQ ID NO 671 LENGTH: 257 TYPE: PRT ORGANISM: Human Query Match 100.0%; Score 1318; Length 257; Best Local Similarity 100.0%; Matches 235; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDST 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 23 LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDST 82 Qy 61 YTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRK 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 83 YTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRK 142 Qy 121 CRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTS 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 143 CRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTS 202 Qy 181 TSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGD 235 ||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 203 TSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGD 257 US-13-001-087-743 Filing date in PALM: 2011-03-03 Sequence 743, US/13001087 Publication No. US20110152173A1 GENERAL INFORMATION APPLICANT: Lofquist, Alan Keith APPLICANT: Mohler, Kendall APPLICANT: Baum, Peter Robert APPLICANT: Thompson, Peter Armstrong APPLICANT: Misher, Lynda TITLE OF INVENTION: TNF-alpha Antagonist Multi-Target Binding Proteins FILE REFERENCE: 2479.0940008 CURRENT APPLICATION NUMBER: US/13/001,087 CURRENT FILING DATE: 2011-03-03 PRIOR APPLICATION NUMBER: PCT/US2009/049603 PRIOR FILING DATE: 2009-07-02 PRIOR APPLICATION NUMBER: US 61/180,097 PRIOR FILING DATE: 2009-05-20 PRIOR APPLICATION NUMBER: US 61/134,095 PRIOR FILING DATE: 2008-07-02 PRIOR APPLICATION NUMBER: US 61/134,096 PRIOR FILING DATE: 2008-07-02 PRIOR APPLICATION NUMBER: US 61/134,097 PRIOR FILING DATE: 2008-07-02 PRIOR APPLICATION NUMBER: US 61/134,098 PRIOR FILING DATE: 2008-07-02 PRIOR APPLICATION NUMBER: US 61/134,099 PRIOR FILING DATE: 2008-07-02 PRIOR APPLICATION NUMBER: US 61/134,100 PRIOR FILING DATE: 2008-07-02 PRIOR APPLICATION NUMBER: US 61/134,101 PRIOR FILING DATE: 2008-07-02 NUMBER OF SEQ ID NOS: 834 SEQ ID NO 743 LENGTH: 166 TYPE: PRT ORGANISM: Human Query Match 55.9%; Score 909; Length 166; Best Local Similarity 100.0%; Matches 166; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MSGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQR 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MSGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQR 60 Qy 61 TCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRR 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 TCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRR 120 Qy 121 QRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQVALVYST 166 |||||||||||||||||||||||||||||||||||||||||||||| Db 121 QRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQVALVYST 166
Read full office action

Prosecution Timeline

Sep 12, 2023
Application Filed
Aug 11, 2026
Non-Final Rejection mailed — §102, §DP (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12729239
ANTI-CEACAM5 ANTIBODIES AND CONJUGATES AND USES THEREOF
3y 6m to grant Granted Sep 08, 2026
Patent 12723092
Anti-CXCR2 Antibodies and Uses Thereof
2y 12m to grant Granted Sep 01, 2026
Patent 12698326
ANTI-CD19 ANTIBODY FORMULATIONS
4y 4m to grant Granted Aug 04, 2026
Patent 12673995
MATERIALS AND METHODS FOR MODULATING T CELL MEDIATED IMMUNITY
3y 2m to grant Granted Jul 07, 2026
Patent 12668623
ANTI-PERIOSTIN HUMANIZED MONOCLONAL ANTIBODY, AND PREPARATION METHOD THEREFOR AND USE THEREOF
2y 3m to grant Granted Jun 30, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

Strategy Recommendation AI-generated — please review before filing

Get a prosecution strategy drawn from examiner precedents, rejection analysis, and claim mapping.
Typically takes 5-10 seconds — AI-generated, attorney review required before filing

Prosecution Projections

1-2
Expected OA Rounds
67%
Grant Probability
99%
With Interview (+52.6%)
2y 11m (~0m remaining)
Median Time to Grant
Low
PTA Risk
Based on 768 resolved cases by this examiner. Grant probability derived from career allowance rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month