Prosecution Insights
Last updated: October 04, 2026
Application No. 18/556,240

ANTI-CD70 ANTIBODIES, CONJUGATES THEREOF AND METHODS OF USING THE SAME

Non-Final OA §112§DP
Filed
Oct 19, 2023
Priority
Apr 23, 2021 — CN PCT/CN2021/089164 +2 more
Examiner
SULLIVAN, DENNIS JOHN
Art Unit
1642
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Genmab A/S
OA Round
1 (Non-Final)
57%
Grant Probability
Moderate
1-2
OA Rounds
9m
Est. Remaining
99%
With Interview

Examiner Intelligence

Grants 57% of resolved cases
57%
Career Allowance Rate
67 granted / 117 resolved
-2.7% vs TC avg
Strong +49% interview lift
Without
With
+49.1%
Interview Lift
resolved cases with interview
Typical timeline
3y 9m
Avg Prosecution
39 currently pending
Career history
162
Total Applications
across all art units

Statute-Specific Performance

§101
6.3%
-33.7% vs TC avg
§103
41.8%
+1.8% vs TC avg
§102
3.6%
-36.4% vs TC avg
§112
27.1%
-12.9% vs TC avg
Black line = Tech Center average estimate • Based on career data from 117 resolved cases

Office Action

§112 §DP
Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . DETAILED ACTION Priority Applicant’s claim for the benefit of a prior-filed application under 35 U.S.C. 119(e) or under 35 U.S.C. 120, 121, 365(c), or 386(c) is acknowledged. Claims 84, 86-88, 92-112, and 114-134 have an effective filing date of 23APR2021. Information Disclosure Statement The information disclosure statements (IDS) submitted on 6/24/2026 and 6/24/2026 are in compliance with the provisions of 37 CFR 1.97. Accordingly, the information disclosure statements are being considered by the examiner. Election/Restriction In the response filed on 6/24/2026, Applicant elected: Group I, claims 84-115 Species VHCDR 1-3 SEQ ID NOs: 21, 22, and 15 and VLCDR 1-3 of SEQ ID NOs: 24, 25, and 26 Mc-VC-PAB Cytotoxic agent Status of Claims Claims 84, 86-88, 92-112, and 114-134 are currently pending and presented for examination on the merits. Claims 116-117, 123, 125, 132, and 134 are withdrawn from further consideration by Examiner under 37 CFR 1.1.42(b) as being drawn to a non-elected invention. Claims 84, 86, and 88 are amended. Claims 118-134 are new. Claims 1-83, 85, 89-91, and 113 are canceled. Claim Rejections - 35 USC § 112 The following is a quotation of 35 U.S.C. 112(b): (b) CONCLUSION.—The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the inventor or a joint inventor regards as the invention. The following is a quotation of 35 U.S.C. 112 (pre-AIA ), second paragraph: The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the applicant regards as his invention. Claims 84, 92-112, 114-11 rejected under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter which the inventor or a joint inventor (or for applications subject to pre-AIA 35 U.S.C. 112, the applicant), regards as the invention. Claim 84 recites, “a heavy chain variable (VH) region and a light chain variable (VL) region, the VH region comprising complementarity determining regions HCDR1, HCDR2 and HCDR3, and the VL region comprising LCDR1, LCDR2 and LCDR3, wherein the VH and VL regions have amino acid sequences set forth in SEQ OD NO:21, SEQ ID NO:22, SEQ ID NO:15, SEQ ID NO:24, SEQ ID NO:25 and SEQ ID NO:26.”. It is unclear what the claimed sequence is. Examiner recommends adding “, respectively” after the listed CDRs. Double Patenting The nonstatutory double patenting rejection is based on a judicially created doctrine grounded in public policy (a policy reflected in the statute) so as to prevent the unjustified or improper timewise extension of the “right to exclude” granted by a patent and to prevent possible harassment by multiple assignees. A nonstatutory double patenting rejection is appropriate where the conflicting claims are not identical, but at least one examined application claim is not patentably distinct from the reference claim(s) because the examined application claim is either anticipated by, or would have been obvious over, the reference claim(s). See, e.g., In re Berg, 140 F.3d 1428, 46 USPQ2d 1226 (Fed. Cir. 1998); In re Goodman, 11 F.3d 1046, 29 USPQ2d 2010 (Fed. Cir. 1993); In re Longi, 759 F.2d 887, 225 USPQ 645 (Fed. Cir. 1985); In re Van Ornum, 686 F.2d 937, 214 USPQ 761 (CCPA 1982); In re Vogel, 422 F.2d 438, 164 USPQ 619 (CCPA 1970); In re Thorington, 418 F.2d 528, 163 USPQ 644 (CCPA 1969). A timely filed terminal disclaimer in compliance with 37 CFR 1.321(c) or 1.321(d) may be used to overcome an actual or provisional rejection based on nonstatutory double patenting provided the reference application or patent either is shown to be commonly owned with the examined application, or claims an invention made as a result of activities undertaken within the scope of a joint research agreement. See MPEP § 717.02 for applications subject to examination under the first inventor to file provisions of the AIA as explained in MPEP § 2159. See MPEP § 2146 et seq. for applications not subject to examination under the first inventor to file provisions of the AIA . A terminal disclaimer must be signed in compliance with 37 CFR 1.321(b). The filing of a terminal disclaimer by itself is not a complete reply to a nonstatutory double patenting (NSDP) rejection. A complete reply requires that the terminal disclaimer be accompanied by a reply requesting reconsideration of the prior Office action. Even where the NSDP rejection is provisional the reply must be complete. See MPEP § 804, subsection I.B.1. For a reply to a non-final Office action, see 37 CFR 1.111(a). For a reply to final Office action, see 37 CFR 1.113(c). A request for reconsideration while not provided for in 37 CFR 1.113(c) may be filed after final for consideration. See MPEP §§ 706.07(e) and 714.13. The USPTO Internet website contains terminal disclaimer forms which may be used. Please visit www.uspto.gov/patent/patents-forms. The actual filing date of the application in which the form is filed determines what form (e.g., PTO/SB/25, PTO/SB/26, PTO/AIA /25, or PTO/AIA /26) should be used. A web-based eTerminal Disclaimer may be filled out completely online using web-screens. An eTerminal Disclaimer that meets all requirements is auto-processed and approved immediately upon submission. For more information about eTerminal Disclaimers, refer to www.uspto.gov/patents/apply/applying-online/eterminal-disclaimer. Claims 84, 86-88, 92, 95-101, 114-115, 118-121, 124, 126-131, and 133 are provisionally rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1, 3-7, 10-12, 14-17, 91, 96, and 120-121 of copending Application No. 19/123,878 ('878) (reference application). Although the claims at issue are not identical, they are not patentably distinct from each other because: Claims 84, 86-88, 93, 94, 106, 111, 112, 119, 120, 122, 126, and 127 are not patentably distinct from claims 1, 3-6, and 120 of Application ‘878. Specifically, a binding agent (and conjugate) that binds CD70 comprising SEQ ID NOs: 7 and 8 (see conflicting claims 3, 91, and 96). A comparison of SEQ ID NOs: 7 and 8 of the instant claims and SEQ ID NOs: 7 and 8 of ‘878 are shown below. Instant SEQ ID NO: 7 and SEQ ID NO: 7 of ‘878. Query Match 100.0%; Score 655; Length 122; Best Local Similarity 100.0%; Matches 122; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 QVQLQESGPGLVKPSETLSLTCTVSGGSVSSDYYYWSWIRQPPGKGLEWLGYIYYSGSTN 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 QVQLQESGPGLVKPSETLSLTCTVSGGSVSSDYYYWSWIRQPPGKGLEWLGYIYYSGSTN 60 Qy 61 YNPSLKSRVTISVDTSKNQFSLKLRSVTTADTAVYYCARGDGDFLGVCFDYWGQGTLVTV 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 YNPSLKSRVTISVDTSKNQFSLKLRSVTTADTAVYYCARGDGDFLGVCFDYWGQGTLVTV 120 Qy 121 SS 122 || Db 121 SS 122 Instant SEQ ID NO: 8 and SEQ ID NO: 8 of ‘878. Query Match 100.0%; Score 553; Length 107; Best Local Similarity 100.0%; Matches 107; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIFDASNRATGIPA 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIFDASNRATGIPA 60 Qy 61 RFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSNWPLTFGGGTKVEIK 107 ||||||||||||||||||||||||||||||||||||||||||||||| Db 61 RFSGSGSGTDFTLTISSLEPEDFAVYYCQQRSNWPLTFGGGTKVEIK 107 Claim 92 is not patentably distinct from claim 7 of ‘878. Specifically, the VH and he VL regions comprise human framework regions. Claim 95 is not patentably distinct from claim 10 of ‘878. Specifically, the biding agent further comprises a heavy chain constant region. Claim 96 is not patentably distinct from claim 11 of ‘878. Specifically, the heavy chain constant region is of the IgG isotype. Claim 97 is not patentably distinct from claim 12 of ‘878. Specifically, the heavy chain constant region is an IgG1 constant region. Claim 98 is not patentably distinct from claim 14 of ‘878. Specifically, the IgG1 constant region has the amino acid sequence set forth in SEQ ID NO: 28. Claim 99 is not patentably distinct from claim 15 of ‘878. Specifically, the binding agent further comprises a light chain constant region. Claim 100 is not patentably distinct from claim 16 of ‘878. Specifically, the light chain constant region is of the kappa isotype. Claim 101 is not patentably distinct from claim 17 of ‘878. Specifically, the kappa isotype has the amino acid sequence set forth in SEQ ID NO: 29. Claims 108-110 and 129 are not patentably distinct from claim 119 of ‘878. Specifically, the conflicting claim recites various drug-antibody ratios. Claims 114-115, 122, and 131 are not patentably distinct from claim 121 of ‘878. Specifically, the binding agent and a pharmaceutically acceptable carrier. Claim 118 is not patentably distinct from claim 96 of ‘878. Specifically, the cytotoxic agent is exatecan. This is a provisional nonstatutory double patenting rejection because the patentably indistinct claims have not in fact been patented. Claims 102-105, 107, 121, 124, 128, 130, and 133 are provisionally rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1, 3-7, 10-12, 14-17, 91, 96, and 120-121 of copending Application No. 19/123,878 ('878), as applied to claims 84, 86-88, 93, 94, 106, 111, 112, 119, 120, 122, 126, and 127 in view of Chen et al. (US PG PUB 2016/0096893, publication date: 04/07/2016). With respect to the instant claims 102, 107, 121, and 128, the conflicting claims do not teach or suggest L234A and L235A Fc region mutations; however at [0303], Chen et al. teach that L234A and L235A Fc region mutations result in the down-modulation of antibody-dependent cellular cytotoxicity (ADCC). Therefore it would have been prima facie obvious to modify the conflicting claims to comprise L234A and L235A Fc region mutations, as the resultant binding agent would be expected to exhibit reduced ADCC, which would be advantageous in settings where reduced ADCC is desired. With respect to the instant claims 103-105, at [0321], Chen et al. teach that antigen-binding molecules may be prepared by introducing nucleic acid vectors into host cells and culturing said host cells. With respect to the instant claims 124, 130, and 133, as indicated above, claim 121 of ‘878 recites a binding agent and a pharmaceutically acceptable carrier, and claim 119 of ‘878 recites various drug-antibody ratios. This is a provisional nonstatutory double patenting rejection. Conclusion Any inquiry concerning this communication or earlier communications from the examiner should be directed to DENNIS JOHN SULLIVAN whose telephone number is (571)272-0509. The examiner can normally be reached Mon - Fri: 7:30AM - 4:30PM. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Samira Jean-Louis can be reached at (571) 270-3503. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /DENNIS J SULLIVAN/Examiner, Art Unit 1642 /NELSON B MOSELEY II/Primary Examiner, Art Unit 1642
Read full office action

Prosecution Timeline

Oct 19, 2023
Application Filed
Sep 14, 2026
Non-Final Rejection mailed — §112, §DP (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12728163
INTRACELLULAR DELIVERY OF BIOMOLECULES TO MODIFY IMMUNE RESPONSE
5y 12m to grant Granted Sep 08, 2026
Patent 12693289
APPLICATION OF COMPOUNDS IN THE PREPARATION OF REAGENTS FOR DOWN-REGULATION OF RUNX2
3y 2m to grant Granted Jul 28, 2026
Patent 12674796
SINGLE CELL PATHOLOGY ANALYSIS OF TUMOUR SAMPLES
3y 11m to grant Granted Jul 07, 2026
Patent 12668621
COMPOSITIONS AND METHODS FOR THE TREATMENT OF TUBERCULOSIS
4y 5m to grant Granted Jun 30, 2026
Patent 12662689
NOVEL PROMOTER AND METHOD FOR PRODUCING DESIRED SUBSTANCE USING SAME
4y 3m to grant Granted Jun 23, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

Strategy Recommendation AI-generated — please review before filing

Get a prosecution strategy drawn from examiner precedents, rejection analysis, and claim mapping.
Typically takes 5-10 seconds — AI-generated, attorney review required before filing

Prosecution Projections

1-2
Expected OA Rounds
57%
Grant Probability
99%
With Interview (+49.1%)
3y 9m (~9m remaining)
Median Time to Grant
Low
PTA Risk
Based on 117 resolved cases by this examiner. Grant probability derived from career allowance rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month