Prosecution Insights
Last updated: April 19, 2026
Application No. 18/570,301

METHOD FOR CONTROLLING SLIME IN A PULP OR PAPER MAKING PROCESS

Non-Final OA §103§112
Filed
Dec 14, 2023
Examiner
PAK, YONG D
Art Unit
1652
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Novozymes A/S
OA Round
1 (Non-Final)
74%
Grant Probability
Favorable
1-2
OA Rounds
3y 0m
To Grant
88%
With Interview

Examiner Intelligence

Grants 74% — above average
74%
Career Allow Rate
685 granted / 924 resolved
+14.1% vs TC avg
Moderate +14% lift
Without
With
+14.0%
Interview Lift
resolved cases with interview
Typical timeline
3y 0m
Avg Prosecution
55 currently pending
Career history
979
Total Applications
across all art units

Statute-Specific Performance

§101
7.0%
-33.0% vs TC avg
§103
21.0%
-19.0% vs TC avg
§102
21.8%
-18.2% vs TC avg
§112
32.6%
-7.4% vs TC avg
Black line = Tech Center average estimate • Based on career data from 924 resolved cases

Office Action

§103 §112
Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . DETAILED ACTION This application is a 371 PCT/EP2022/066384. The response filed on December 1, 2025 has been entered. Election/Restrictions Applicant’s election without traverse of Group I with a species election of (1) SEQ ID NO:1 as the parent DNase and (2) T1l+S13Y+T22P+S27L+L33K+S39P+S42G+D56HS57W+S59V+T65V+V76L+Q109R+S116D+T127V+S144P+A147H+S167L+G175D as the amino acid modifications made in the parent DNase the reply filed on December 1, 2025 is acknowledged. Claims 24-25 and 36-39 are withdrawn from further consideration pursuant to 37 CFR 1.142(b) as being drawn to a nonelected invention, there being no allowable generic or linking claim. Election was made without traverse in the reply filed on December 1, 2025. Status of Claims Claims 20-39 are pending. Claims 24-25 and 36-39 are withdrawn. Claims 20-23 and 26-35 are under examination. Claim for Foreign Priority Receipt is acknowledged of certified copies of papers required by 37 CFR 1.55. Information Disclosure Statement The information disclosure statement (IDS) submitted on December 14, 2023 is in compliance with the provisions of 37 CFR 1.97. Accordingly, the information disclosure statement is being considered by the examiner. Claim Rejections - 35 USC § 112 The following is a quotation of 35 U.S.C. 112(b): (b) CONCLUSION.—The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the inventor or a joint inventor regards as the invention. The following is a quotation of 35 U.S.C. 112 (pre-AIA ), second paragraph: The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the applicant regards as his invention. Claim 20 and claims 21-23 and 26-35 depending therefrom are rejected under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter which the inventor or a joint inventor (or for applications subject to pre-AIA 35 U.S.C. 112, the applicant), regards as the invention. The term “build-up” of slime in claim 20 is a relative term which renders the claim indefinite. The term “build-up”” is not defined by the claim, the specification does not provide a standard for ascertaining the requisite degree, and one of ordinary skill in the art would not be reasonably apprised of the scope of the invention. It is unclear as to how much slime is considered as “build-up”. Claims 26-27 are rejected under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter which the inventor or a joint inventor (or for applications subject to pre-AIA 35 U.S.C. 112, the applicant), regards as the invention. Claims 26-27 recites the limitation “enzyme protein/L”. The metes and bounds of the limitations in the context of the claim are not clear. It is unclear if the “enzyme protein” is the DNase recited in the claims are is the “enzyme protein” refers to another enzyme. Clarification is requested. Claim Rejections - 35 USC § 103 In the event the determination of the status of the application as subject to AIA 35 U.S.C. 102 and 103 (or as subject to pre-AIA 35 U.S.C. 102 and 103) is incorrect, any correction of the statutory basis (i.e., changing from AIA to pre-AIA ) for the rejection will not be considered a new ground of rejection if the prior art relied upon, and the rationale supporting the rejection, would be the same under either status. The following is a quotation of 35 U.S.C. 103 which forms the basis for all obviousness rejections set forth in this Office action: A patent for a claimed invention may not be obtained, notwithstanding that the claimed invention is not identically disclosed as set forth in section 102, if the differences between the claimed invention and the prior art are such that the claimed invention as a whole would have been obvious before the effective filing date of the claimed invention to a person having ordinary skill in the art to which the claimed invention pertains. Patentability shall not be negated by the manner in which the invention was made. The factual inquiries for establishing a background for determining obviousness under 35 U.S.C. 103 are summarized as follows: 1. Determining the scope and contents of the prior art. 2. Ascertaining the differences between the prior art and the claims at issue. 3. Resolving the level of ordinary skill in the pertinent art. 4. Considering objective evidence present in the application indicating obviousness or nonobviousness. This application currently names joint inventors. In considering patentability of the claims the examiner presumes that the subject matter of the various claims was commonly owned as of the effective filing date of the claimed invention(s) absent any evidence to the contrary. Applicant is advised of the obligation under 37 CFR 1.56 to point out the inventor and effective filing dates of each claim that was not commonly owned as of the effective filing date of the later invention in order for the examiner to consider the applicability of 35 U.S.C. 102(b)(2)(C) for any potential 35 U.S.C. 102(a)(2) prior art against the later invention. Claim(s) 20-22, 28, and 31-33 is/are rejected under 35 U.S.C. 103 as being unpatentable over Johnsrud (Biotechnology for Solving Slim Problems in the Pulp and Pater Industry (Advances in Biochemical Engineering/Biotechnology, Vol. 57, pages 311-328, 1997 – form PTO-892), Budny (US 2002/0037260 – form PTO-892), and Beier (US 2019/0211284 – form PTO- 892). Regarding claim 20, Johnsrud discloses that a well-known and long-standing problem in paper manufacture is the proliferation of biological slimes on machinery, wherein slime seeds into process water (page 312, section 2). Johnsrud discloses that adequate control of microbial-induced slime deposits in an essential part of modern pulp and paper manufacture (page 316, section 3). Johnsrud discloses a method of preventing and the disruption of biofilm build-up (which reads on preventing a build-up of slime or removing slime) caused by slime-forming species of microorganism and preventing a build-slime or removing slime by adding various enzymes to the process water (page 320, section 4.2.1). Johnsrud disclose that the striping of the extracellular polysaccharide layer prevents the microorganism from attaching to other surfaces and makes them more accessible to conventional biocide treatment (page 321, 1st full paragraph). Regarding claim 28, the water of Johnsrud is process water (page 312, section 2). Regarding claims 31-33, the surface of Johnsrud is from the paper/pulp making machinery (which reads on a manufacturing equipment) (page 312, section 2). Johnsrud does not disclose a method of preventing a build-up of slime or removing slime from a surface by contacting water with a DNase. Regarding claim 20, Budny discloses that biofilm is associated with paper pulping operations and discloses a composition for degrading biofilm comprising DNase (claims 32-34). Regarding claim 20, Beier disclose that biofilm, slime of microorganism, is surround by a matrix of extracellular polymeric substances composed of extracellular DNA, proteins, and polysaccharides ([0003]). Beier discloses using DNase to degrade the biofilm ([0004]-[0005]). Beier discloses a method of treating a surface by contacting an aqueous wash liquor (which includes water) with DNase and treating the surface with the wash liquor ([0010]). Regarding claim 21, Beier discloses a DNase having the amino acid sequence of SEQ ID NO:1, which has 100% sequence identity to the DNase of SEQ ID NO:1 of the instant application ([0008] and see the sequence alignment below). Regarding claim 22, Beier discloses a DNase variant having at least 80% sequence identity to the DNase of SEQ ID NO:1 of the instant application, wherein the DNase variant has one or more amino acid substitutions selected from T1I, T1L, S13Y, T22P, S25P, S27l, S39P, S42G, S57W, S57Y, S59V, S59I, S59L, V76L, Q109R, S116D, S116E, T127V, S144P, A147H, S167L, G175D, and G175E ([0107]). Therefore, combining the teachings of Johnsrud, Budny, and Beier, it would have been obvious to one having ordinary skill in the art before the claimed invention was effectively filed to enhance the method of Johnsrud by contacting the process water with the DNase of Beier to prevent or remove slim from the surface of the machinery, such as metals or plastics. One having ordinary skill in the art would have been motivated the use the DNase of Beier because said DNase of Beier breaks down biofilm/slime. One having ordinary skill in the art would have had a reasonable expectation of success because Johnsrud discloses a method of preventing build-up of slime or removing slime from a surface of the machinery during pulp or paper making process by degrading said slime, Budny discloses that biofilm is associated with paper pulping operations and discloses a composition for degrading biofilm comprising DNase, and Beier discloses a method of degrading biofilm/slime using a DNase. Further, the rationale supporting that the claims would have been obvious is that a method of enhancing a particular class of devices (preventing build-up of slime or removing slime from a surface using DNase) has been made part of the ordinary capabilities of one skilled in the art based upon the teaching of such improvement in other situations. One of ordinary skill in the art would have been capable of applying this known method of enhancement to a “base” device (method of preventing build-up of slime or removing slime from a surface of machinery during pulp or paper making process) in the prior art and the results would have been predictable to one of ordinary skill in the art because (1) the prior art contained a “base” device upon which the claimed invention can be seen as an “improvement;” (2) the prior art contained a “comparable” device that has been improved in the same way as the claimed invention; and (3) one of ordinary skill in the art could have applied the known “improvement” technique in the same way to the “base” device and the results would have been predictable to one of ordinary skill in the art. Therefore, the above references render claims 20-22, 28, and 31-33 prima facie obvious. Claim(s) 26-27 and 29-30 is/are rejected under 35 U.S.C. 103 as being unpatentable over Johnsrud (Biotechnology for Solving Slim Problems in the Pulp and Pater Industry (Advances in Biochemical Engineering/Biotechnology, Vol. 57, pages 311-328, 1997 – form PTO-892), Budny (US 2002/0037260 – form PTO-892), and Beier (US 2019/0211284 – form PTO- 892) as applied to claims 20-22, 28, and 31-33 above, and further in view of Hatcher (US 3,773,623 – form PTO-892). “[W]here the general conditions of a claim are disclosed in the prior art, it is not inventive to discover the optimum or workable ranges by routine experimentation.”, see MPEP 2144. Regarding claims 26-27, Beier discloses that the amount of the DNase is 0.001-10 mg enzyme protein/L (ppm), which falls within the claimed range of 0.1 to 10 mg/L ([0257]-[0258]). Regarding claims 26-27, Hatcher discloses a method of controlling slime for formation, such as retarding or removing, with an enzyme (abstract). Hatcher discloses using 1 ppm to 10 ppm of the enzyme, which falls within the claimed range of 0.1 to 10 mg/L (Column 3, lines 20-44). Regarding claims 29-30, Hatcher discloses that the pH of the method is 6.7, which falls within the claimed range of 6.1 to 7.6 (Column 4, line 37). Therefore, in combining the above references, it would have been obvious to one having ordinary skill in the art before the time the claimed invention was made to modify the method of Johnsurd by varying the amount of DNase and the pH of the process water. One of ordinary skill in the art at the time the invention was made would have been motivated to do so in order to optimize the method of preventing the build-up of slime or removing slime on the surface of the machinery for pulp or paper making. One of ordinary skill in the art would have had a reasonable expectation of success since Johnsrud discloses a method of preventing build-up of slime or removing slime from a surface during pulp or paper making process by degrading said slime, Budny discloses that biofilm is associated with paper pulping operations and discloses a composition for degrading biofilm comprising DNase, Beier discloses a method of degrading biofilm/slime using a DNase in an amount of 0.001-10 mg enzyme protein/L (ppm), and Hatcher discloses a method of controlling slime for formation, such as retarding or removing, with an enzyme in an amount of 1 ppm to 10 ppm and at a pH of 6.7. Therefore, the above references render claims 20-22 and 26-33 prima facie obvious. Claim(s) 34-35 is/are rejected under 35 U.S.C. 103 as being unpatentable over Johnsrud (Biotechnology for Solving Slim Problems in the Pulp and Pater Industry (Advances in Biochemical Engineering/Biotechnology, Vol. 57, pages 311-328, 1997 – form PTO-892), Budny (US 2002/0037260 – form PTO-892), and Beier (US 2019/0211284 – form PTO- 892) as applied to claims 20-22, 28, and 31-33 above, and further in view of Xu (A novel carbohydrate:acceptor oxidoreductase from Microdochium nivale. Eur J Biochem. 2001 Feb;268(4):1136-4 – form PTO-892) and MNCO_MICNN (UniPortKB/Swiss-Prot Database. February 26, 2020 – form PTO-892). Regarding claim 34, Budny discloses use of two enzymes, a first enzyme to degrade the biofilm structure and a second enzyme to generate active oxygen to directly attack and kill bacteria that are exposed during the process of the degradation and removal of the biofilm ([0060]). Budny discloses that the second enzyme is a hexose oxidase of E.C. 1.1.3.5, which is synonymous with a carbohydrate oxidase, to degrade biofilm ([0061]). Regarding claims 34-35, Xu discloses a carbohydrate oxidase having 100% sequence identity to the carbohydrate oxidase of SEQ ID NO:6 of the instant application (abstract and Fig. 2 at page 1138 and see the sequence alignment below). The carbohydrate oxidase of Xu belongs to E.C. 1.1.3.5 (see MNCO-MICNN). Therefore, in combining the above references, it would have been obvious to one having ordinary skill in the art before the time the claimed invention was made to use a second enzyme, a carbohydrate oxidase. One of ordinary skill in the art at the time the invention was made would have been motivated to do so in order to generate active oxygen to directly attack and kill bacteria that are exposed during the process of the degradation and removal of the biofilm. One of ordinary skill in the art would have had a reasonable expectation of success since Johnsrud discloses a method of preventing build-up of slime or removing slime from a surface during pulp or paper making process by degrading said slime, Budny discloses that biofilm is associated with paper pulping operations and discloses a composition for degrading biofilm comprising DNase, Beier discloses a method of degrading biofilm/slime using a DNase, Budny discloses use of two enzymes, first enzyme to degrade the biofilm structure and a second enzyme to generate active oxygen to directly attack and kill bacteria that are exposed during the process of the degradation and removal of the biofilm, and Xu discloses a carbohydrate oxidase having 100% sequence identity to the carbohydrate oxidase of SEQ ID NO:6 of the instant application. Therefore, the above references render claims 20-22, 28, and 31-35 prima facie obvious. Conclusion Claims 20-39 are pending. Claims 24-25 and 36-39 are withdrawn. Claims 20-23 and 26-35 are rejected. Any inquiry concerning this communication or earlier communications from the examiner should be directed to YONG D PAK whose telephone number is (571)272-0935. The examiner can normally be reached M-Th: 5:30 am - 3:30 pm. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Robert Mondesi can be reached on 408-918-7584. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /YONG D PAK/Primary Examiner, Art Unit 1652 Sequence alignment between the DNase of SEQ ID NO:1 of the instant application (“Qy”) and the DNase of SEQ ID NO:1 of Beier (“Db”) US-16-238-648A-1 Filing date in PALM: 2019-01-03 Sequence 1, US/16238648A Publication No. US20190211284A1 GENERAL INFORMATION APPLICANT: The Procter & Gamble Company TITLE OF INVENTION: POLYPEPTIDE VARIANTS FILE REFERENCE: CM04824C CURRENT APPLICATION NUMBER: US/16/238,648A CURRENT FILING DATE: 2019-01-03 PRIOR APPLICATION NUMBER: US 16/238,648 PRIOR FILING DATE: 2019-01-03 NUMBER OF SEQ ID NOS: 26 SEQ ID NO 1 LENGTH: 182 TYPE: PRT ORGANISM: Bacillus cibi Query Match 100.0%; Score 986; Length 182; Best Local Similarity 100.0%; Matches 182; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 TPPGTPSKSAAQSQLNALTVKTEGSMSGYSRDLFPHWISQGSGCDTRQVVLKRDADSYSG 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 TPPGTPSKSAAQSQLNALTVKTEGSMSGYSRDLFPHWISQGSGCDTRQVVLKRDADSYSG 60 Qy 61 NCPVTSGSWYSYYDGVTFTNPSDLDIDHIVPLAEAWRSGASSWTTSKRQDFANDLSGPQL 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 NCPVTSGSWYSYYDGVTFTNPSDLDIDHIVPLAEAWRSGASSWTTSKRQDFANDLSGPQL 120 Qy 121 IAVSASTNRSKGDQDPSTWQPPRSGAACGYSKWWISTKYKWGLSLQSSEKTALQGMLNSC 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 IAVSASTNRSKGDQDPSTWQPPRSGAACGYSKWWISTKYKWGLSLQSSEKTALQGMLNSC 180 Qy 181 SY 182 || Db 181 SY 182 Sequence alignment between the carbohydrate oxidase of SEQ ID NO:6 of the instant application (“Qy”) and the carbohydrate oxidase of Xu/MNCO-MICNN (“Db”) MNCO_MICNN ID MNCO_MICNN Reviewed; 495 AA. AC I1SB12; DT 10-APR-2019, integrated into UniProtKB/Swiss-Prot. DT 10-APR-2019, sequence version 2. DT 09-APR-2025, entry version 69. DE RecName: Full=Carbohydrate oxidase {ECO:0000303|PubMed:11179980}; DE EC=1.1.3.-; DE EC=1.1.3.5 {ECO:0000269|PubMed:11179980}; DE AltName: Full=Lactose oxidase {ECO:0000303|PubMed:17154316}; DE Short=LaO; DE Flags: Precursor; GN Name=MnCO {ECO:0000303|PubMed:11179980}; OS Microdochium nivale (Pink snow mold) (Lanosa nivalis). OC Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; OC Xylariomycetidae; Xylariales; Microdochiaceae; Microdochium. OX NCBI_TaxID=5520; RN [1] RP NUCLEOTIDE SEQUENCE [GENOMIC DNA], PROTEIN SEQUENCE OF 23-46; 217-292; RP 325-344; 358-369; 404-435 AND 442-462, FUNCTION, CATALYTIC ACTIVITY, RP BIOPHYSICOCHEMICAL PROPERTIES, AND SUBCELLULAR LOCATION. RC STRAIN=NN008551; RX PubMed=11179980; DOI=10.1046/j.1432-1327.2001.01982.x; RA Xu F., Golightly E.J., Fuglsang C.C., Schneider P., Duke K.R., Lam L., RA Christensen S., Brown K.M., Joergensen C.T., Brown S.H.; RT "A novel carbohydrate:acceptor oxidoreductase from Microdochium nivale."; RL Eur. J. Biochem. 268:1136-1142(2001). RN [2] RP FUNCTION, AND CATALYTIC ACTIVITY. RX DOI=10.1016/S1381-1177(00)00233-2; RA Kulys J., Tetianec L., Schneider P.; RT "Specificity and kinetic parameters of recombinant Microdochium nivale RT carbohydrate oxidase."; RL J. Mol. Catal., B Enzym. 13:95-101(2001). RN [3] RP FUNCTION, CATALYTIC ACTIVITY, AND BIOPHYSICOCHEMICAL PROPERTIES. RA Tetianec L., Kulys J.; RT "The specificity of recombinant Microdochium nivale carbohydrate oxidase."; RL Biologija 2:38-41(2003). RN [4] RP CATALYTIC ACTIVITY, BIOPHYSICOCHEMICAL PROPERTIES, AND COFACTOR. RX PubMed=17154316; DOI=10.1002/bit.21273; RA Nordkvist M., Nielsen P.M., Villadsen J.; RT "Oxidation of lactose to lactobionic acid by a Microdochium nivale RT carbohydrate oxidase: kinetics and operational stability."; RL Biotechnol. Bioeng. 97:694-707(2007). RN [5] RP CRYSTALLIZATION. RX PubMed=19478452; DOI=10.1107/s1744309109017643; RA Duskova J., Dohnalek J., Skalova T., Oestergaard L.H., Fuglsang C.C., RA Kolenko P., Stepankova A., Hasek J.; RT "Crystallization of carbohydrate oxidase from Microdochium nivale."; RL Acta Crystallogr. F 65:638-640(2009). RN [6] {ECO:0007744|PDB:3RJ8, ECO:0007744|PDB:3RJA} RP X-RAY CRYSTALLOGRAPHY (2.10 ANGSTROMS) OF 23-495 IN COMPLEX WITH FAD, AND RP GLYCOSYLATION AT ASN-244. RA Duskova J., Skalova T., Kolenko P., Stepankova A., Hasek J., Koval T., RA Ostergaard L.H., Fuglsang C.C., Dohnalek J.; RT "Crystal structure and kinetic studies of carbohydrate oxidase from RT Microdochium nivale."; RL Submitted (APR-2011) to the PDB data bank. CC -!- FUNCTION: Catalyzes the selective oxidation of C1 hydroxyl moieties on CC mono-, oligo- and polysaccharides with concomitant reduction of CC molecular oxygen to hydrogen peroxide. This results in the formation of CC the corresponding lactones, which typically undergo spontaneous CC hydrolysis. Carbohydrate oxidase is able to oxidize a variety of CC substrates including D-glucose, D-galactose, D-xylose, D-maltose, D- CC cellobiose, and lactose. In addition, among various oligosaccharides, CC the enzyme preferred tetrameric dextrins, indicating a favorable CC interaction of four linked glucose units with the substrate binding CC pocket. {ECO:0000269|PubMed:11179980, ECO:0000269|Ref.2, CC ECO:0000269|Ref.3}. CC -!- CATALYTIC ACTIVITY: CC Reaction=beta-D-glucose + O2 = D-glucono-1,5-lactone + H2O2; CC Xref=Rhea:RHEA:11428, ChEBI:CHEBI:15379, ChEBI:CHEBI:15903, CC ChEBI:CHEBI:16217, ChEBI:CHEBI:16240; EC=1.1.3.5; CC Evidence={ECO:0000269|PubMed:11179980}; CC -!- CATALYTIC ACTIVITY: CC Reaction=D-galactose + O2 = D-galactono-1,5-lactone + H2O2; CC Xref=Rhea:RHEA:59312, ChEBI:CHEBI:4139, ChEBI:CHEBI:15379, CC ChEBI:CHEBI:15945, ChEBI:CHEBI:16240; EC=1.1.3.5; CC Evidence={ECO:0000269|PubMed:11179980}; CC -!- CATALYTIC ACTIVITY: CC Reaction=D-cellobiose + O2 = D-cellobiono-1,5-lactone + H2O2; CC Xref=Rhea:RHEA:59316, ChEBI:CHEBI:15379, ChEBI:CHEBI:16240, CC ChEBI:CHEBI:17057, ChEBI:CHEBI:17863; EC=1.1.3.5; CC Evidence={ECO:0000269|PubMed:11179980, ECO:0000269|Ref.3}; CC -!- CATALYTIC ACTIVITY: CC Reaction=beta-lactose + O2 = lactobiono-1,5-lactone + H2O2; CC Xref=Rhea:RHEA:59352, ChEBI:CHEBI:15379, ChEBI:CHEBI:16240, CC ChEBI:CHEBI:36218, ChEBI:CHEBI:143068; EC=1.1.3.5; CC Evidence={ECO:0000269|PubMed:11179980}; CC -!- CATALYTIC ACTIVITY: CC Reaction=D-maltose + O2 = D-maltobiono-1,5-lactone + H2O2; CC Xref=Rhea:RHEA:59344, ChEBI:CHEBI:15379, ChEBI:CHEBI:16240, CC ChEBI:CHEBI:17306, ChEBI:CHEBI:143029; EC=1.1.3.5; CC Evidence={ECO:0000269|PubMed:11179980, ECO:0000269|Ref.3}; CC -!- CATALYTIC ACTIVITY: CC Reaction=D-xylose + O2 = D-xylono-1,5-lactone + H2O2; CC Xref=Rhea:RHEA:59324, ChEBI:CHEBI:15379, ChEBI:CHEBI:15867, CC ChEBI:CHEBI:16240, ChEBI:CHEBI:53455; CC Evidence={ECO:0000269|PubMed:11179980}; CC -!- COFACTOR: CC Name=FAD; Xref=ChEBI:CHEBI:57692; CC Evidence={ECO:0000269|PubMed:17154316}; CC Note=Binds 1 FAD per subunit in a bicovalent manner. CC {ECO:0000269|Ref.6}; CC -!- BIOPHYSICOCHEMICAL PROPERTIES: CC Kinetic parameters: CC KM=0.97 mM for oxygen {ECO:0000269|PubMed:17154316}; CC KM=19 mM for cellobiose (at pH 6 and 30 degrees Celsius) CC {ECO:0000269|PubMed:11179980}; CC KM=59 mM for cellobiose (at pH 6 and 40 degrees Celsius) CC {ECO:0000269|PubMed:11179980}; CC KM=51 uM for cellobiose (at pH 7.2 and 25 degrees Celsius) CC {ECO:0000269|Ref.3}; CC KM=59 uM for cellotriose (at pH 7.2 and 25 degrees Celsius) CC {ECO:0000269|Ref.3}; CC KM=66 uM for cellotetraose (at pH 7.2 and 25 degrees Celsius) CC {ECO:0000269|Ref.3}; CC KM=42 mM for glucose (at pH 6 and 40 degrees Celsius) CC {ECO:0000269|PubMed:11179980}; CC KM=11 mM for maltose (at pH 6 and 40 degrees Celsius) CC {ECO:0000269|PubMed:11179980}; CC KM=12 mM for maltose (at pH 7.2 and 25 degrees Celsius) CC {ECO:0000269|Ref.3}; CC pH dependence: CC Optimum pH is 5-7. {ECO:0000269|PubMed:11179980}; CC Temperature dependence: CC Optimum temperature is 50 degrees Celsius. CC {ECO:0000269|PubMed:11179980}; CC -!- SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:11179980}. CC -!- PTM: The FAD cofactor is bound via a bicovalent 6-S-cysteinyl, 8alpha- CC N1-histidyl FAD linkage. {ECO:0000269|Ref.6}. CC -!- SIMILARITY: Belongs to the oxygen-dependent FAD-linked oxidoreductase CC family. {ECO:0000305}. CC --------------------------------------------------------------------------- CC Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms CC Distributed under the Creative Commons Attribution (CC BY 4.0) License CC --------------------------------------------------------------------------- DR PDB; 3RJ8; X-ray; 2.40 A; A=23-495. DR PDB; 3RJA; X-ray; 2.10 A; A=23-495. DR PDBsum; 3RJ8; -. DR PDBsum; 3RJA; -. DR AlphaFoldDB; I1SB12; -. DR SMR; I1SB12; -. DR GlyCosmos; I1SB12; 2 sites, No reported glycans. DR EvolutionaryTrace; I1SB12; -. DR GO; GO:0005576; C:extracellular region; IEA:UniProtKB-SubCell. DR GO; GO:0046562; F:beta-D-glucose oxidase activity; IEA:RHEA. DR GO; GO:0071949; F:FAD binding; IEA:InterPro. DR GO; GO:0046872; F:metal ion binding; IEA:UniProtKB-KW. DR Gene3D; 3.30.465.10; -; 1. DR Gene3D; 3.40.462.20; -; 1. DR InterPro; IPR012951; BBE. DR InterPro; IPR016166; FAD-bd_PCMH. DR InterPro; IPR036318; FAD-bd_PCMH-like_sf. DR InterPro; IPR016169; FAD-bd_PCMH_sub2. DR InterPro; IPR050416; FAD-linked_Oxidoreductase. DR InterPro; IPR006094; Oxid_FAD_bind_N. DR PANTHER; PTHR42973; BINDING OXIDOREDUCTASE, PUTATIVE (AFU_ORTHOLOGUE AFUA_1G17690)-RELATED; 1. DR PANTHER; PTHR42973:SF39; FAD-BINDING PCMH-TYPE DOMAIN-CONTAINING PROTEIN; 1. DR Pfam; PF08031; BBE; 1. DR Pfam; PF01565; FAD_binding_4; 1. DR SUPFAM; SSF56176; FAD-binding/transporter-associated domain-like; 1. DR PROSITE; PS51387; FAD_PCMH; 1. PE 1: Evidence at protein level; KW 3D-structure; Direct protein sequencing; FAD; Flavoprotein; Glycoprotein; KW Metal-binding; Nucleotide-binding; Oxidoreductase; Secreted; Signal; Zinc. FT SIGNAL 1..22 FT /evidence="ECO:0000269|PubMed:11179980" FT CHAIN 23..495 FT /note="Carbohydrate oxidase" FT /id="PRO_0000446664" FT DOMAIN 55..229 FT /note="FAD-binding PCMH-type" FT /evidence="ECO:0000255|PROSITE-ProRule:PRU00718" FT CARBOHYD 244 FT /note="N-linked (GlcNAc...) asparagine" FT /evidence="ECO:0007744|PDB:3RJ8, ECO:0007744|PDB:3RJA" FT CARBOHYD 417 FT /note="N-linked (GlcNAc...) asparagine" FT /evidence="ECO:0000255|PROSITE-ProRule:PRU00498" FT CROSSLNK 92..154 FT /note="6-(S-cysteinyl)-8alpha-(pros-histidyl)-FAD (His- FT Cys)" FT /evidence="ECO:0000269|Ref.6" FT HELIX 24..31 FT /evidence="ECO:0007829|PDB:3RJA" FT HELIX 42..47 FT /evidence="ECO:0007829|PDB:3RJA" FT STRAND 60..64 FT /evidence="ECO:0007829|PDB:3RJA" FT HELIX 68..80 FT /evidence="ECO:0007829|PDB:3RJA" FT STRAND 85..90 FT /evidence="ECO:0007829|PDB:3RJA" FT HELIX 97..99 FT /evidence="ECO:0007829|PDB:3RJA" FT STRAND 101..104 FT /evidence="ECO:0007829|PDB:3RJA" Query Match 100.0%; Score 2630; Length 495; Best Local Similarity 100.0%; Matches 495; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MRSAFILALGLITASADALVTRGAIEACLSAAGVPIDIPGTADYERDVEPFNIRLPYIPT 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MRSAFILALGLITASADALVTRGAIEACLSAAGVPIDIPGTADYERDVEPFNIRLPYIPT 60 Qy 61 AIA QTQTTAHIQSAVQCAKKLNLKVSAKSGGHSYASFGFGGENGHLMVQLDRMIDVISYN 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 AIA QTQTTAHIQSAVQCAKKLNLKVSAKSGGHSYASFGFGGENGHLMVQLDRMIDVISYN 120 Qy 121 DKTGIAHVEPGARLGHLATVLNDKYGRAISHGTCPGVGISGHFAHGGFGFSSHMHGLAVD 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 DKTGIAHVEPGARLGHLATVLNDKYGRAISHGTCPGVGISGHFAHGGFGFSSHMHGLAVD 180 Qy 181 SVVGVTVVLADGRIVEASATENADLFWGIKGAGSNFGIVAVWKLATFPAPKVLTRFGVTL 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 SVVGVTVVLADGRIVEASATENADLFWGIKGAGSNFGIVAVWKLATFPAPKVLTRFGVTL 240 Qy 241 NWKNKTSALKGIEAVEDYARWVAPREVNFRIGDYGAGNPGIEGLYYGTPEQWRAAFQPLL 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 NWKNKTSALKGIEAVEDYARWVAPREVNFRIGDYGAGNPGIEGLYYGTPEQWRAAFQPLL 300 Qy 301 DTLPAGYVVNPTTSLNWIESVLSYSNFDHVDFITPQPVENFYAKSLTLKSIKGDAVKNFV 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 DTLPAGYVVNPTTSLNWIESVLSYSNFDHVDFITPQPVENFYAKSLTLKSIKGDAVKNFV 360 Qy 361 DYYFDVSNKVKDRFWFYQLDVHGGKNSQVTKVTNAETAYPHRDKLWLIQFYDRYDNNQTY 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 DYYFDVSNKVKDRFWFYQLDVHGGKNSQVTKVTNAETAYPHRDKLWLIQFYDRYDNNQTY 420 Qy 421 PETSFKFLDGWVNSVTKALPKSDWGMYINYADPRMDRDYATKVYYGENLARLQKLKAKFD 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 PETSFKFLDGWVNSVTKALPKSDWGMYINYADPRMDRDYATKVYYGENLARLQKLKAKFD 480 Qy 481 PTDRFYYPQAVRPVK 495 ||||||||||||||| Db 481 PTDRFYYPQAVRPVK 495
Read full office action

Prosecution Timeline

Dec 14, 2023
Application Filed
Feb 24, 2026
Non-Final Rejection — §103, §112 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12595472
MANNANASE VARIANTS
2y 5m to grant Granted Apr 07, 2026
Patent 12590301
METHODS FOR SAFE AND EFFECTIVE THROMBOLYSIS USING SEQUENTIAL ADMINISTRATION OF TISSUE PLASMINOGEN ACTIVATOR AND MUTANT PRO-UROKINASE
2y 5m to grant Granted Mar 31, 2026
Patent 12570964
Bacterium And Obtaining Method And Application Thereof
2y 5m to grant Granted Mar 10, 2026
Patent 12559734
Reverse Transcriptase Mutants with Increased Activity and Thermostability
2y 5m to grant Granted Feb 24, 2026
Patent 12540160
METHODS FOR THE PURIFICATION OF REFOLDED FC-PEPTIDE FUSION PROTEIN
2y 5m to grant Granted Feb 03, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

AI Strategy Recommendation

Get an AI-powered prosecution strategy using examiner precedents, rejection analysis, and claim mapping.
Powered by AI — typically takes 5-10 seconds

Prosecution Projections

1-2
Expected OA Rounds
74%
Grant Probability
88%
With Interview (+14.0%)
3y 0m
Median Time to Grant
Low
PTA Risk
Based on 924 resolved cases by this examiner. Grant probability derived from career allow rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month