Prosecution Insights
Last updated: October 02, 2026
Application No. 18/630,379

Optimized CD3 Antigen Binding Domains

Non-Final OA §101§112§DP
Filed
Apr 09, 2024
Priority
Apr 10, 2023 — provisional 63/495,127
Examiner
GUSTILO, ESTELLA M
Art Unit
Tech Center
Assignee
MEDIMMUNE Limited
OA Round
1 (Non-Final)
54%
Grant Probability
Moderate
1-2
OA Rounds
1y 0m
Est. Remaining
88%
With Interview

Examiner Intelligence

Grants 54% of resolved cases
54%
Career Allowance Rate
37 granted / 69 resolved
-6.4% vs TC avg
Strong +34% interview lift
Without
With
+34.5%
Interview Lift
resolved cases with interview
Typical timeline
3y 6m
Avg Prosecution
42 currently pending
Career history
102
Total Applications
across all art units

Statute-Specific Performance

§101
4.2%
-35.8% vs TC avg
§103
30.8%
-9.2% vs TC avg
§102
13.8%
-26.2% vs TC avg
§112
27.2%
-12.8% vs TC avg
Black line = Tech Center average estimate • Based on career data from 69 resolved cases

Office Action

§101 §112 §DP
Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Status of the Claims Claims 1 – 4, 6 – 8, 10 – 20, 25 – 33, and 36 – 41 are currently pending and are the subject of this Office Action. This is the first Office Action on the merits of the claims. Information Disclosure Statement The information disclosure statement (IDS) submitted on 09/27/2024 follows the provisions of 37 CFR 1.97 and has been considered. Claim Rejections - 35 USC § 101 35 U.S.C. 101 reads as follows: Whoever invents or discovers any new and useful process, machine, manufacture, or composition of matter, or any new and useful improvement thereof, may obtain a patent therefor, subject to the conditions and requirements of this title. Claim 41 is rejected under 35 U.S.C. 101 because the claimed invention is directed to non-statutory subject matter. The claim(s) does/do not fall within at least one of the four categories of patent eligible subject matter because the claimed recitation of a use, without setting forth any steps involved in the process, results in an improper definition of a process, i.e., results in a claim which is not a proper process claim under 35 U.S.C. 101. See for example Ex parte Dunki, 153 USPQ 678 (Bd.App. 1967) and Clinical Products, Ltd. v. Brenner, 255 F. Supp. 131, 149 USPQ 475 (D.D.C. 1966). Claim Rejections - 35 USC § 112 The following is a quotation of 35 U.S.C. 112(b): (b) CONCLUSION.—The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the inventor or a joint inventor regards as the invention. The following is a quotation of 35 U.S.C. 112 (pre-AIA ), second paragraph: The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the applicant regards as his invention. Claims 10, 14 – 20, 25 – 29, and 41 rejected under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter which the inventor or a joint inventor (or for applications subject to pre-AIA 35 U.S.C. 112, the applicant), regards as the invention. Claim 10 recites carcinoembryonic antigen (CEA), e.g. carcinoembryonic antigen-related cell adhesion molecule 5 (CEACAM5), glycolipids such as gangliosides, carbohydrates such as CA-125, which are indefinite. The phrases “for example” (“e.g”.) and "such as" render the claims indefinite because it is unclear whether the limitations following the phrases are part of the claimed invention. See MPEP § 2173.05(d). Claim 10 also recites anb3 (vitronectin receptor), which is indefinite because it is unclear if the parenthetical structure is limiting. Claims 14 – 16, 18, 20, 25 – 27 each recites positions on a polypeptide without disclosing the sequence of the polypeptide (for example, CLλ). Thus, the structure of the claimed polypeptide is not clear and thus the recited position on the claimed polypeptide is also not clear. Claims 28 and 29 depend from claim 27 and thus inherit the deficiencies of claim 27. Claim 17 recites CLκ of SEQ ID NO: 106, which has 107 amino acids; however, claim 18 (which depends from claim 17) recites position 133 in the CLκ. Claim 19 recites the limitation "the disulfide link" in lines 3 and 8. There is insufficient antecedent basis for this limitation in the claim. Claim 41 attempts to claim a process without setting forth any steps involved in the process and is indefinite because it merely recites a use without any active, positive steps delimiting how this use is actually practiced. See MPEP 2173.05(q). The following is a quotation of 35 U.S.C. 112(d): (d) REFERENCE IN DEPENDENT FORMS.—Subject to subsection (e), a claim in dependent form shall contain a reference to a claim previously set forth and then specify a further limitation of the subject matter claimed. A claim in dependent form shall be construed to incorporate by reference all the limitations of the claim to which it refers. The following is a quotation of pre-AIA 35 U.S.C. 112, fourth paragraph: Subject to the following paragraph [i.e., the fifth paragraph of pre-AIA 35 U.S.C. 112], a claim in dependent form shall contain a reference to a claim previously set forth and then specify a further limitation of the subject matter claimed. A claim in dependent form shall be construed to incorporate by reference all the limitations of the claim to which it refers. Claim 11 is rejected under 35 U.S.C. 112(d) or pre-AIA 35 U.S.C. 112, 4th paragraph, as being of improper dependent form for failing to further limit the subject matter of the claim upon which it depends, or for failing to include all the limitations of the claim upon which it depends. Claim 11 is not further limiting because it recites STEAP2 which is not in claim 10. Applicant may cancel the claim(s), amend the claim(s) to place the claim(s) in proper dependent form, rewrite the claim(s) in independent form, or present a sufficient showing that the dependent claim(s) complies with the statutory requirements. Double Patenting The nonstatutory double patenting rejection is based on a judicially created doctrine grounded in public policy (a policy reflected in the statute) so as to prevent the unjustified or improper timewise extension of the “right to exclude” granted by a patent and to prevent possible harassment by multiple assignees. A nonstatutory double patenting rejection is appropriate where the conflicting claims are not identical, but at least one examined application claim is not patentably distinct from the reference claim(s) because the examined application claim is either anticipated by, or would have been obvious over, the reference claim(s). See, e.g., In re Berg, 140 F.3d 1428, 46 USPQ2d 1226 (Fed. Cir. 1998); In re Goodman, 11 F.3d 1046, 29 USPQ2d 2010 (Fed. Cir. 1993); In re Longi, 759 F.2d 887, 225 USPQ 645 (Fed. Cir. 1985); In re Van Ornum, 686 F.2d 937, 214 USPQ 761 (CCPA 1982); In re Vogel, 422 F.2d 438, 164 USPQ 619 (CCPA 1970); In re Thorington, 418 F.2d 528, 163 USPQ 644 (CCPA 1969). A timely filed terminal disclaimer in compliance with 37 CFR 1.321(c) or 1.321(d) may be used to overcome an actual or provisional rejection based on nonstatutory double patenting provided the reference application or patent either is shown to be commonly owned with the examined application, or claims an invention made as a result of activities undertaken within the scope of a joint research agreement. See MPEP § 717.02 for applications subject to examination under the first inventor to file provisions of the AIA as explained in MPEP § 2159. See MPEP § 2146 et seq. for applications not subject to examination under the first inventor to file provisions of the AIA . A terminal disclaimer must be signed in compliance with 37 CFR 1.321(b). The filing of a terminal disclaimer by itself is not a complete reply to a nonstatutory double patenting (NSDP) rejection. A complete reply requires that the terminal disclaimer be accompanied by a reply requesting reconsideration of the prior Office action. Even where the NSDP rejection is provisional the reply must be complete. See MPEP § 804, subsection I.B.1. For a reply to a non-final Office action, see 37 CFR 1.111(a). For a reply to final Office action, see 37 CFR 1.113(c). A request for reconsideration while not provided for in 37 CFR 1.113(c) may be filed after final for consideration. See MPEP §§ 706.07(e) and 714.13. The USPTO Internet website contains terminal disclaimer forms which may be used. Please visit www.uspto.gov/patent/patents-forms. The actual filing date of the application in which the form is filed determines what form (e.g., PTO/SB/25, PTO/SB/26, PTO/AIA /25, or PTO/AIA /26) should be used. A web-based eTerminal Disclaimer may be filled out completely online using web-screens. An eTerminal Disclaimer that meets all requirements is auto-processed and approved immediately upon submission. For more information about eTerminal Disclaimers, refer to www.uspto.gov/patents/apply/applying-online/eterminal-disclaimer. Claims 1 – 4, 6 – 12, 14, 15, 30 – 33, and 36 – 40 are provisionally rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1 – 11, 37 – 39, and 76 – 81 of copending Application No. 18/631,627 (reference application, published as US 2025/0059295). Although the claims at issue are not identical, they are not patentably distinct from each other because copending claim 1 recites a T cell engaging molecule comprising:(a) an antigen binding arm that binds an epitope on human six transmembrane epithelial antigen of prostate-2 (STEAP2). . . ; (b) a first T cell binding arm that binds to cluster of differentiation 3 (CD3) . . . Copending claim 37 recites that the trivalent T cell engaging molecule comprises SEQ ID NOs: 25,26, 35, 55 and 58. Copending claim 76 recites that the tetravalent T cell engaging molecule comprises SEQ ID NOs: 25, 35, 81, 25, and 87, or wherein the tetravalent T cell engaging molecule comprises SEQ ID NOs: 151, 152, 153, 154, and 152. Copending SEQ ID NO: 151 teaches present anti-CD3 VH CDRs having the amino acid sequences of present SEQ ID NOs: 90, 91, and 92 or the anti-CD3 VH CDRs having the amino acid sequences of present SEQ ID NOs: 78, 79, and 80 of present claim 1 with 100% identity, and copending SEQ ID NO: 154 teaches present anti-CD3 VL CDRs having the amino acid sequences of present SEQ ID NOs: 46, 47, and 48 of present claim 1 with 100% identity. See Appendix. Copending SEQ ID NOs: 58 and 81 each discloses the sequence of present SEQ ID NO: 77 of present claim 3 with 100% identity. See Appendix. Copending SEQ ID NO: 151 discloses the sequence of present SEQ ID NO: 89 of present claim 3 with 100% identity. See Appendix. Copending SEQ ID NO: 154 discloses the sequence of present SEQ ID NO: 45 of present claim 4 with 100% identity. See Appendix. Copending SEQ ID NO: 35 discloses the sequence of present SEQ ID NO: 61 of present claim 4 with 100% identity. See Appendix. Thus, the copending claims anticipates present claims 1 – 4, 8, and 10 – 11. Regarding claims 6 – 7, because the antibodies of the copending claims have the same structure as that of the present claims, the antibodies of the copending claims would also have the properties, such as the Kds, of present claims 6 – 7. Regarding claims 12, 14, and 15, the ‘627 claims 9-11 teach the CH1 and CL lambda limitations. Regarding claim 30, copending claim 2 recites a CD8 antigen binding domain. Regarding claims 31 – 33 and 36 – 37, copending claims 77 – 81, respectively, recites the presently claimed limitations. Regarding claim 38 – 40, copending claim 81 recites a method of treating a disease. According to the copending disclosure, the disease is cancer (see paragraph 0131 of the copending pre-grant publication). Alternatively, use as a medicament (of present claim 39) or use in the treatment of cancer (present claim 40) are only suggestive of an intended use of the cells that does not change the structure of the antibody. This is a provisional nonstatutory double patenting rejection because the patentably indistinct claims have not in fact been patented. Claims 13 and 16 – 17 are provisionally rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1 – 11, 37 – 39, and 76 – 81 of copending Application No. 18/631,627 as applied to claims 1 – 4, 6 – 12, 14, 15, 30 – 33, and 36 – 40 above in further view of CN110172100A, published 03/19/2021, English translation; see PTO-892: Notice of References Cited. The teaching so of the copending claims discussed above are fully incorporated here. Although the copending claims recite the antibody of the present claims, the copending claims do not recite the limitations of present claims 13 and 16 – 19. CN110172100A is directed to human CD3 antibody. See CN110172100A at claim 1. Regarding claim 13, CN110172100A teaches the sequence of presently claimed SEQ ID NO: 105 with 100% identity. CN110172100A’s SEQ ID NO: 15 is identical to presently claimed SEQ ID NO: 105. See Appendix. Regarding claim 16, CN110172100A teaches that each heavy chain contains a heavy chain variable region (VH) and first, second and third constant regions (CH1, CH2 and CH3). Each light chain contains a light chain variable region (VL) and a constant region (CL) (see CN110172100A at p. 5, second paragraph under “definition” of the English translation) and that the antibody further comprises a light chain constant region selected from a kappa subtype or a lambda subtype (see CN110172100A at p. 3, sixteenth paragraph under “Summary of the invention” of the English translation). Regarding claim 17, CN110172100A teaches the sequence of presently claimed SEQ ID NO: 106 with 100% identity. CN110172100A’s SEQ ID NO: 14 is identical to presently claimed SEQ ID NO: 106. See Appendix. At the effective filing date of the present claims, it would have been prima facie obvious to the person of ordinary skill in the art to arrive at the claimed invention from the disclosures of the copending claims and CN110172100A. The artisan would have been motivated to make and use the antibody of claims 13 and 16 – 19 because the copending claims teaches the structure of the anti-CD3 antibody and CN110172100A teaches an anti-human CD3 antibody effective in preventing or treating tumors. Thus, the artisan would have a reasonable expectation of success from the combined teachings of the copending claims and CN110172100A. Conclusion Claims 1 – 4, 6 – 20, 25 – 33, and 36 – 41 are rejected. Any inquiry concerning this communication or earlier communications from the examiner should be directed to Estella Gustilo whose telephone number is (703)756-1706. The examiner can normally be reached Monday - Friday 9:30 AM - 5:30 PM. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Gregory Emch can be reached at 571-272-8149. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /ESTELLA M. GUSTILO/Examiner, Art Unit 1646 /PETER J REDDIG/Primary Examiner, Art Unit 1646 APPENDIX Alignment with SEQ ID NOs: 90, 91, 92 US-18-631-627-151 Sequence 151, US/18631627 Publication No. US20250059295A1 GENERAL INFORMATION APPLICANT: MedImmune, LLC (en) TITLE OF INVENTION: STEAP2 DIRECTED T-CELL ENGAGERS AND COMPOSITIONS THEREOF (en) FILE REFERENCE: STEAP2TED-100-US-NP CURRENT APPLICATION NUMBER: US/18/631,627 CURRENT FILING DATE: 2024-04-10 NUMBER OF SEQ ID NOS: 155 SEQ ID NO 151 LENGTH: 689 TYPE: PRT FEATURE: NAME/KEY: source LOCATION: 1..689 QUALIFIERS: mol_type = protein note = TED4 LO12 Knob Heavy Chain organism = synthetic construct Query Match 88.1%; Score 179.7; Length 689; Best Local Similarity 46.2%; Matches 37; Conservative 0; Mismatches 0; Indels 43; Gaps 2; Qy 1 EAWMH--------------QIKDRSQTYATYYAESVKGR--------------------- 25 ||||| |||||||||||||||||||| Db 270 EAWMHWVRQAPGKQLEWVAQIKDRSQTYATYYAESVKGRFTISRDDSKNTLYLQMNSLKT 329 Qy 26 --------RGVYYANAPFDY 37 |||||||||||| Db 330 EDTAVYYCRGVYYANAPFDY 349 Alignment with SEQ ID NOs: 46, 47, 48 US-18-631-627-154 Sequence 154, US/18631627 Publication No. US20250059295A1 GENERAL INFORMATION APPLICANT: MedImmune, LLC (en) TITLE OF INVENTION: STEAP2 DIRECTED T-CELL ENGAGERS AND COMPOSITIONS THEREOF (en) FILE REFERENCE: STEAP2TED-100-US-NP CURRENT APPLICATION NUMBER: US/18/631,627 CURRENT FILING DATE: 2024-04-10 NUMBER OF SEQ ID NOS: 155 SEQ ID NO 154 LENGTH: 218 TYPE: PRT FEATURE: NAME/KEY: source LOCATION: 1..218 QUALIFIERS: mol_type = protein note = TED4 LO12 Lambda Chain organism = synthetic construct Query Match 84.8%; Score 137.3; Length 218; Best Local Similarity 40.5%; Matches 32; Conservative 0; Mismatches 0; Indels 47; Gaps 2; Qy 1 RSSQSLVHNTGNTYLS---------------KVSNRAS---------------------- 23 |||||||||||||||| ||||||| Db 24 RSSQSLVHNTGNTYLSWYLQKPGQSPQSLIYKVSNRASGVPDRFSGSGSGTDFTLKISRV 83 Qy 24 ----------GQGTQAPFT 32 ||||||||| Db 84 EAEDVGVYYCGQGTQAPFT 102 Alignment with SEQ ID NO: 77 US-18-631-627-58 Sequence 58, US/18631627 Publication No. US20250059295A1 GENERAL INFORMATION APPLICANT: MedImmune, LLC (en) TITLE OF INVENTION: STEAP2 DIRECTED T-CELL ENGAGERS AND COMPOSITIONS THEREOF (en) FILE REFERENCE: STEAP2TED-100-US-NP CURRENT APPLICATION NUMBER: US/18/631,627 CURRENT FILING DATE: 2024-04-10 NUMBER OF SEQ ID NOS: 155 SEQ ID NO 58 LENGTH: 686 TYPE: PRT FEATURE: NAME/KEY: source LOCATION: 1..686 QUALIFIERS: mol_type = protein note = knob HC SEQ ID NO: 56 CD8 VH + SEQ ID NO: 57 CD8 CH1 + SEQ ID NO: 89 linker + SEQ ID NO: 39 CD3 VH SN75 + SEQ ID NO: 79 IgG1 HC organism = synthetic construct Query Match 100.0%; Score 643; Length 686; Best Local Similarity 100.0%; Matches 121; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 EVQLVESGGALVKPGGSLRLSCAASGFTFSNAWMHWVRQAPGKQLEWVAQIKDRSQTYAT 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 236 EVQLVESGGALVKPGGSLRLSCAASGFTFSNAWMHWVRQAPGKQLEWVAQIKDRSQTYAT 295 Qy 61 YYAESVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCRGVYYANAPFDYWGQGTLVTVS 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 296 YYAESVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCRGVYYANAPFDYWGQGTLVTVS 355 Qy 121 S 121 | Db 356 S 356 US-18-631-627-81 Sequence 81, US/18631627 Publication No. US20250059295A1 GENERAL INFORMATION APPLICANT: MedImmune, LLC (en) TITLE OF INVENTION: STEAP2 DIRECTED T-CELL ENGAGERS AND COMPOSITIONS THEREOF (en) FILE REFERENCE: STEAP2TED-100-US-NP CURRENT APPLICATION NUMBER: US/18/631,627 CURRENT FILING DATE: 2024-04-10 NUMBER OF SEQ ID NOS: 155 SEQ ID NO 81 LENGTH: 686 TYPE: PRT FEATURE: NAME/KEY: source LOCATION: 1..686 QUALIFIERS: mol_type = protein note = STEAP2/CD3 knob HC: SEQ ID NO: 7 VH STEAP2 + SEQ ID NO: 67 wt CH1 w/ S183K + D + SEQ ID NO: 86 linker + SEQ ID NO: 39 CD3 VH SN75 + SEQ ID NO: 82. organism = synthetic construct Query Match 100.0%; Score 643; Length 686; Best Local Similarity 100.0%; Matches 121; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 EVQLVESGGALVKPGGSLRLSCAASGFTFSNAWMHWVRQAPGKQLEWVAQIKDRSQTYAT 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 237 EVQLVESGGALVKPGGSLRLSCAASGFTFSNAWMHWVRQAPGKQLEWVAQIKDRSQTYAT 296 Qy 61 YYAESVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCRGVYYANAPFDYWGQGTLVTVS 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 297 YYAESVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCRGVYYANAPFDYWGQGTLVTVS 356 Qy 121 S 121 | Db 357 S 357 Alignment with SEQ ID NO: 89 US-18-631-627-151 Sequence 151, US/18631627 Publication No. US20250059295A1 GENERAL INFORMATION APPLICANT: MedImmune, LLC (en) TITLE OF INVENTION: STEAP2 DIRECTED T-CELL ENGAGERS AND COMPOSITIONS THEREOF (en) FILE REFERENCE: STEAP2TED-100-US-NP CURRENT APPLICATION NUMBER: US/18/631,627 CURRENT FILING DATE: 2024-04-10 NUMBER OF SEQ ID NOS: 155 SEQ ID NO 151 LENGTH: 689 TYPE: PRT FEATURE: NAME/KEY: source LOCATION: 1..689 QUALIFIERS: mol_type = protein note = TED4 LO12 Knob Heavy Chain organism = synthetic construct Query Match 100.0%; Score 643; Length 689; Best Local Similarity 100.0%; Matches 121; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 EVQLVESGGALVKPGGSLRLSCAASGFTFTEAWMHWVRQAPGKQLEWVAQIKDRSQTYAT 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 240 EVQLVESGGALVKPGGSLRLSCAASGFTFTEAWMHWVRQAPGKQLEWVAQIKDRSQTYAT 299 Qy 61 YYAESVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCRGVYYANAPFDYWGQGTLVTVS 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 300 YYAESVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCRGVYYANAPFDYWGQGTLVTVS 359 Qy 121 S 121 | Db 360 S 360 Alignment with SEQ ID NO: 45 US-18-631-627-154 Sequence 154, US/18631627 Publication No. US20250059295A1 GENERAL INFORMATION APPLICANT: MedImmune, LLC (en) TITLE OF INVENTION: STEAP2 DIRECTED T-CELL ENGAGERS AND COMPOSITIONS THEREOF (en) FILE REFERENCE: STEAP2TED-100-US-NP CURRENT APPLICATION NUMBER: US/18/631,627 CURRENT FILING DATE: 2024-04-10 NUMBER OF SEQ ID NOS: 155 SEQ ID NO 154 LENGTH: 218 TYPE: PRT FEATURE: NAME/KEY: source LOCATION: 1..218 QUALIFIERS: mol_type = protein note = TED4 LO12 Lambda Chain organism = synthetic construct Query Match 100.0%; Score 584; Length 218; Best Local Similarity 100.0%; Matches 112; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 DIVMTQSPLSLPVTPGEPASISCRSSQSLVHNTGNTYLSWYLQKPGQSPQSLIYKVSNRA 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 DIVMTQSPLSLPVTPGEPASISCRSSQSLVHNTGNTYLSWYLQKPGQSPQSLIYKVSNRA 60 Qy 61 SGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCGQGTQAPFTFGSGTKVEIK 112 |||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 SGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCGQGTQAPFTFGSGTKVEIK 112 Alignment with SEQ ID NO: 61 US-18-631-627-35 Sequence 35, US/18631627 Publication No. US20250059295A1 GENERAL INFORMATION APPLICANT: MedImmune, LLC (en) TITLE OF INVENTION: STEAP2 DIRECTED T-CELL ENGAGERS AND COMPOSITIONS THEREOF (en) FILE REFERENCE: STEAP2TED-100-US-NP CURRENT APPLICATION NUMBER: US/18/631,627 CURRENT FILING DATE: 2024-04-10 NUMBER OF SEQ ID NOS: 155 SEQ ID NO 35 LENGTH: 218 TYPE: PRT FEATURE: NAME/KEY: source LOCATION: 1..218 QUALIFIERS: mol_type = protein note = TED3 CD3 Light Chain K29 organism = synthetic construct Query Match 100.0%; Score 586; Length 218; Best Local Similarity 100.0%; Matches 112; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 DIVMTQSPLSLPVTPGEPASISCRSSQSLVHNTGNTYLSWYLQKPGQSPQSLIYKVSNRA 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 DIVMTQSPLSLPVTPGEPASISCRSSQSLVHNTGNTYLSWYLQKPGQSPQSLIYKVSNRA 60 Qy 61 SGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCGQGTQFPFTFGSGTKVEIK 112 |||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 SGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCGQGTQFPFTFGSGTKVEIK 112 Alignment with SEQ ID NO: 105 BGR38078 ID BGR38078 standard; protein; 106 AA. XX AC BGR38078; XX DT 17-OCT-2019 (first entry) XX DE Human lambda subtype light chain constant region, SEQ ID 15. XX KW Immunoglobulin lambda; antibody therapy; cancer; cytostatic; KW light chain constant region; prophylactic to disease; therapeutic. XX OS Homo sapiens. XX CC PN CN110172100-A. XX CC PD 27-AUG-2019. XX CC PF 06-MAY-2019; 2019CN-10372193. XX PR 06-MAY-2019; 2019CN-10372193. XX CC PA (BEIJ-) BEIJING ZHIREN MEIBO BIOTECHNOLOGY CO. XX CC PI Liu Z, Liu Y, Hao X, Guo J; XX DR WPI; 2019-75271B/74. XX CC PT New antibody useful for the preparation of a medicament for preventing or CC PT treating a tumor. XX CC PS Example 1; SEQ ID NO 15; 36pp; Chinese. XX CC The present invention relates to a novel antibody useful for preparing a CC medicament for preventing or treating tumor such as malignant tumor. The CC antibody specifically binds to human CD3 epsilon (CD3E). The invention CC further provides: a nucleic acid molecule encoding the antibody or CC antigen-binding portion; a bispecific antibody comprising a first arm CC directed against human CD3E and a second arm against tumor cell surface CC antigen (TAA); and a composition comprising antibody, bispecific CC antibody, excipient and diluted agent or carrier. XX SQ Sequence 106 AA; ALIGNMENT: Query Match 100.0%; Score 554; Length 106; Best Local Similarity 100.0%; Matches 106; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSK 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSK 60 Qy 61 QSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS 106 |||||||||||||||||||||||||||||||||||||||||||||| Db 61 QSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS 106 Alignment with SEQ ID NO: 106 BGR38077 ID BGR38077 standard; protein; 107 AA. XX AC BGR38077; XX DT 17-OCT-2019 (first entry) XX DE Human kappa subtype light chain constant region, SEQ ID 14. XX KW Immunoglobulin kappa; antibody therapy; cancer; cytostatic; KW light chain constant region; prophylactic to disease; therapeutic. XX OS Homo sapiens. XX CC PN CN110172100-A. XX CC PD 27-AUG-2019. XX CC PF 06-MAY-2019; 2019CN-10372193. XX PR 06-MAY-2019; 2019CN-10372193. XX CC PA (BEIJ-) BEIJING ZHIREN MEIBO BIOTECHNOLOGY CO. XX CC PI Liu Z, Liu Y, Hao X, Guo J; XX DR WPI; 2019-75271B/74. XX CC PT New antibody useful for the preparation of a medicament for preventing or CC PT treating a tumor. XX CC PS Example 1; SEQ ID NO 14; 36pp; Chinese. XX CC The present invention relates to a novel antibody useful for preparing a CC medicament for preventing or treating tumor such as malignant tumor. The CC antibody specifically binds to human CD3 epsilon (CD3E). The invention CC further provides: a nucleic acid molecule encoding the antibody or CC antigen-binding portion; a bispecific antibody comprising a first arm CC directed against human CD3E and a second arm against tumor cell surface CC antigen (TAA); and a composition comprising antibody, bispecific CC antibody, excipient and diluted agent or carrier. XX SQ Sequence 107 AA; ALIGNMENT: Query Match 100.0%; Score 553; Length 107; Best Local Similarity 100.0%; Matches 107; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQD 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 RTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQD 60 Qy 61 SKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 107 ||||||||||||||||||||||||||||||||||||||||||||||| Db 61 SKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC 107
Read full office action

Prosecution Timeline

Apr 09, 2024
Application Filed
Sep 08, 2026
Non-Final Rejection mailed — §101, §112, §DP (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12735721
ENGINEERED ADENO-ASSOCIATED (AAV) VECTORS FOR TRANSGENE EXPRESSION
4y 11m to grant Granted Sep 15, 2026
Patent 12662543
ANTI-CD40 BINDING MOLECULES AND BI-SPECIFIC ANTIBODIES COMPRISING SUCH
4y 2m to grant Granted Jun 23, 2026
Patent 12655227
MODIFIED FC REGION
5y 0m to grant Granted Jun 16, 2026
Patent 12606605
ULTRA-LONG ACTING INSULIN-FC FUSION PROTEINS AND METHODS OF USE
3y 3m to grant Granted Apr 21, 2026
Patent 12595306
TREM2 STABILIZING ANTIBODIES
1y 3m to grant Granted Apr 07, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

Strategy Recommendation AI-generated — please review before filing

Get a prosecution strategy drawn from examiner precedents, rejection analysis, and claim mapping.
Typically takes 5-10 seconds — AI-generated, attorney review required before filing

Prosecution Projections

1-2
Expected OA Rounds
54%
Grant Probability
88%
With Interview (+34.5%)
3y 6m (~1y 0m remaining)
Median Time to Grant
Low
PTA Risk
Based on 69 resolved cases by this examiner. Grant probability derived from career allowance rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month