Prosecution Insights
Last updated: July 17, 2026
Application No. 18/652,232

METHOD FOR PROMOTING PROLIFERATION OF IMMUNE CELLS

Non-Final OA §112§DP
Filed
May 01, 2024
Priority
Mar 26, 2018 — CN 201810251875.7 +2 more
Examiner
WESTON, ALYSSA G
Art Unit
1633
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Oricell Therapeutics Co. Ltd.
OA Round
1 (Non-Final)
61%
Grant Probability
Moderate
1-2
OA Rounds
1y 3m
Est. Remaining
99%
With Interview

Examiner Intelligence

Grants 61% of resolved cases
61%
Career Allowance Rate
65 granted / 106 resolved
+1.3% vs TC avg
Strong +49% interview lift
Without
With
+49.2%
Interview Lift
resolved cases with interview
Typical timeline
3y 5m
Avg Prosecution
47 currently pending
Career history
170
Total Applications
across all art units

Statute-Specific Performance

§101
0.2%
-39.8% vs TC avg
§103
29.7%
-10.3% vs TC avg
§102
48.4%
+8.4% vs TC avg
§112
2.8%
-37.2% vs TC avg
Black line = Tech Center average estimate • Based on career data from 106 resolved cases

Office Action

§112 §DP
DETAILED ACTION Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Priority The instant application is a continuation-in-part of US Application No. 17/040865 (now US Patent No. 12,005,080 B2), filed 23 September 2020, which is a national stage entry under 35 USC 371 of PCT/CN2019/079576, filed 25 March 2019. Acknowledgment is made of Applicant’s claim for foreign priority under 35 USC 119(a)-(d) to Application No. CN201810251875.7, filed 26 March 2018. Receipt is acknowledged of the certified copy of papers filed, in a non-English language, required by 37 CFR 1.55 within parent Application No. 17/040865, filed on 23 September 2020. Election/Restrictions Applicant's election with traverse of Group I encompassing claims 1-11 is acknowledged, as Applicant has timely traversed the restriction (election) requirement in the reply filed on 26 May 2026. The traversal is on the grounds that there would not be a serious burden on the Examiner to search the two restricted groups, as they appear to be part of an overlapping search area. See Page 2 of the Response filed 26 May 2026. This is not found persuasive, as the Examiner respectfully submits that there would be an undue burden on the Examiner to search the two restricted groups for the reasons of record set forth on Pages 3-4 of the Restriction requirement filed 15 April 2026. Therefore, the requirement is still deemed proper and is thereby made FINAL. Furthermore, Applicant's election with traverse of LRP6 as the species is acknowledged, as Applicant has timely traversed the restriction (election) requirement in the reply filed on 26 May 2026. The traversal is on the grounds that it is unnecessary to elect between LRP5 and LRP6, as the intracellular regions of each LRP exhibits the same functional effect on the biological activity of the genetically modified immune cell. See Pages 3-4 of the Response filed 26 May 2026, as well as Examples 9-13 of the instant disclosure. In response, the Examiner finds this persuasive and withdraws the species election requirement. Consequently, claims 12-20 are withdrawn from further consideration pursuant to 37 CFR 1.142(b), as being drawn to a nonelected invention, there being no allowable generic or linking claim. Prosecution on the merits commences for claims 1-11. Drawings The replacement drawing sheets filed 13 June 2024 and 15 July 2024 are acknowledged and entered into the application file. Specification The substitute Specification filed 13 August 2024 is acknowledged and entered into the application file. Claim Objections Claims 5-6 and 11 are objected to because of the following informalities: Regarding claim 5: The instant claim is objected to for reciting “SEQ NO.” instead of “SEQ ID NO:” in Line 3. See MPEP § 608.01(m) and 2412.04. Appropriate correction is required. Regarding claim 6: The instant claim is objected to for reciting “SEQ NO.” instead of “SEQ ID NO:” in Line 3. See MPEP § 608.01(m) and 2412.04. Appropriate correction is required. Regarding claim 11: The instant claim is objected to for reciting “and optionally pharmaceutically acceptable carrier” instead of “and optionally a pharmaceutically acceptable carrier”. Appropriate correction is required. Claim Interpretation The instant claims recite “low density lipoprotein receptor-associated protein” whereas the instant Specification filed 13 August 2024 recites the “low density lipoprotein receptor-related protein” within Paragraph [0135]. For purposes of prosecution, these terms will be interpreted as being synonymous. Furthermore, claim 7 recites the limitation “…or the amino acid sequence having at least 80% homology thereof”. This is interpreted as meaning “80% homology of any one of SEQ ID NOs: 22, 24, 26 or 28”. Likewise, claim 8 regarding SEQ ID NOs: 21, 23, 25, and 27 will be interpreted as such. In addition, under the broadest reasonable interpretation of claim 11, the optional limitation is not required. Claim Rejections - 35 USC § 112 The following is a quotation of the first paragraph of 35 U.S.C. 112(a): (a) IN GENERAL. —The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor or joint inventor of carrying out the invention. The following is a quotation of the first paragraph of pre-AIA 35 U.S.C. 112: The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor of carrying out his invention. Claims 1-4 and 9-11 are rejected under 35 U.S.C. 112(a) or 35 U.S.C. 112 (pre-AIA ), first paragraph, as failing to comply with the written description requirement. The claims contain subject matter which was not described in the Specification in such a way as to reasonably convey to one skilled in the relevant art that the inventor or a joint inventor, or for applications subject to pre-AIA 35 U.S.C. 112, the inventors, at the time the application was filed, had possession of the claimed invention. The claims under rejection are directed to a genetically modified immune cell comprising a low density lipoprotein receptor-associated protein or a fragment thereof, wherein the low density lipoprotein receptor-associated protein or fragment thereof comprises an intracellular region of the low density lipoprotein receptor-associated protein (LRP). Thus, to satisfy the written description aspect of 35 U.S.C. 112(a) for a claimed group – or genus – of fragments, it must be clear that: (1) the identifying characteristics of the claimed fragments have been disclosed, e.g., structure or other physical and/or chemical properties, by functional characteristics coupled with a known or disclosed cor-relation between function and structure, or by a com-bination of such identifying characteristics; or (2) a representative number of species within the genus must be disclosed. See MPEP 2163, Eli Lilly, 119 F.3d at 1568, 43 USPQ2d at 1406; In re Baird, 16 F.3d 380, 382, 29 USPQ2d 1550, 1552 (Fed. Cir. 1994). In giving the term ‘fragment [of a low density lipoprotein receptor-associated protein] comprising an intracellular region of the LRP’ its broadest reasonable interpretation, the number and types of proteins which can be considered a fragment of a low density lipoprotein receptor-associated protein is extraordinarily great, and can be interpreted to even include a single amino acid of the intracellular domain. Applicant’s disclosure of such fragments is limited to a single defined sequence for a truncated LRP5 and a truncated LRP6, therefore there is limited disclosure of acceptable fragments of a low density lipoprotein receptor-associated protein comprising an intracellular region of the LRP. Regarding disclosure of identifying characteristics of the claimed fragments, Applicant has amended the claim to necessitate the low density lipoprotein receptor-associated protein or fragment thereof to comprise an intracellular region of the low density lipoprotein receptor-associated protein, as supported by Example 5 of the instant disclosure. However, Applicant has not identified any particular core function (along with a correlation between function and a specific conserved structure) of the low density lipoprotein receptor-associated protein which must be shared by all fragments thereof; and thus one of ordinary skill in the art would not immediately envisage all fragments of the low density lipoprotein receptor-associated protein, as currently claimed. Therefore, Applicant has not disclosed the identifying characteristics of the claimed fragments. Regarding disclosure of a representative number of species within the genus, a review of the specification shows that Applicant has disclosed one acceptable fragment each for LRP5 and LRP6, as dictated in SEQ ID NOs: 28 and 24, respectively. Disclosure of a single species does not constitute a representative number for such a broad genus as is encompassed by the breadth of ‘fragments of a low density lipoprotein receptor-associated protein comprising an intracellular region of the LRP’. Therefore, Applicant has not disclosed a representative number of species, as would be required to support description and to show possession of the entire genus. Thus, one of ordinary skill in the art, in looking to the instant Specification, would not be able to determine that Applicant was in possession of the invention, as claimed, at the time the invention was made. Accordingly, the claims are considered to lack sufficient written description and are properly rejected under 35 USC 112(a). It is of note that instant claims 5-8 are not included within the rejection of record, as they specifically define the sequence with which the low density lipoprotein receptor-associated protein or fragment thereof must comprise. The following is a quotation of 35 U.S.C. 112(b): (b) CONCLUSION.—The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the inventor or a joint inventor regards as the invention. The following is a quotation of 35 U.S.C. 112 (pre-AIA ), second paragraph: The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the applicant regards as his invention. Claims 1-11 are rejected under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter which the inventor or a joint inventor (or for applications subject to pre-AIA 35 U.S.C. 112, the applicant), regards as the invention. Regarding claim 1: The instant claim recites the limitation "the fragment thereof" in Line 3. There is insufficient antecedent basis for this limitation in the claim, as there is no prior recitation of a low density lipoprotein receptor-associated protein fragment within the instant claim. See MPEP § 2173.05(e). Therefore, the metes and bounds of the claim cannot be determined, thus rendering the scope of the claim indefinite. The instant claim further recites the limitation "the low density lipoprotein receptor-associated protein 5" in Line 5. There is insufficient antecedent basis for this limitation in the claim, as there is no prior recitation of a low density lipoprotein receptor-associated protein 5 within the instant claim. See MPEP § 2173.05(e). Therefore, the metes and bounds of the claim cannot be determined, thus rendering the scope of the claim indefinite. Instant claims 2-11 are either dependent upon or fully incorporate the limitations of independent claim 1, thus rendering them indefinite as well. Appropriate correction is required. Regarding claim 2: The instant claim defines the genetically modified immune cell as having “one or more properties selected from the group consisting of: 1) a promoted proliferation of the immune cell; 2) a promoted production of a memory cell; 3) an inhibited differentiation of the immune cell to a regulatory T cell (Treg); 4) an enhanced release of a cytokine from the immune cell; or 5) an enhanced ability of the immune cell to kill a tumor, compared with an unmodified immune cell” (emphasis added). Claim language defined by a Markush grouping requires selection from a closed group "consisting of" the alternative members. See MPEP § 2117(I): Id. at 1280, 67 USPQ2d at 1196. The recitation of “or” indicates that the Markush group is open, thus rendering the metes and bounds of the claim indefinite. Appropriate correction is required. Double Patenting The nonstatutory double patenting rejection is based on a judicially created doctrine grounded in public policy (a policy reflected in the statute) so as to prevent the unjustified or improper timewise extension of the “right to exclude” granted by a patent and to prevent possible harassment by multiple assignees. A nonstatutory double patenting rejection is appropriate where the conflicting claims are not identical, but at least one examined application claim is not patentably distinct from the reference claim(s) because the examined application claim is either anticipated by, or would have been obvious over, the reference claim(s). See, e.g., In re Berg, 140 F.3d 1428, 46 USPQ2d 1226 (Fed. Cir. 1998); In re Goodman, 11 F.3d 1046, 29 USPQ2d 2010 (Fed. Cir. 1993); In re Longi, 759 F.2d 887, 225 USPQ 645 (Fed. Cir. 1985); In re Van Ornum, 686 F.2d 937, 214 USPQ 761 (CCPA 1982); In re Vogel, 422 F.2d 438, 164 USPQ 619 (CCPA 1970); In re Thorington, 418 F.2d 528, 163 USPQ 644 (CCPA 1969). A timely filed terminal disclaimer in compliance with 37 CFR 1.321(c) or 1.321(d) may be used to overcome an actual or provisional rejection based on nonstatutory double patenting provided the reference application or patent either is shown to be commonly owned with the examined application, or claims an invention made as a result of activities undertaken within the scope of a joint research agreement. See MPEP § 717.02 for applications subject to examination under the first inventor to file provisions of the AIA as explained in MPEP § 2159. See MPEP § 2146 et seq. for applications not subject to examination under the first inventor to file provisions of the AIA . A terminal disclaimer must be signed in compliance with 37 CFR 1.321(b). The filing of a terminal disclaimer by itself is not a complete reply to a nonstatutory double patenting (NSDP) rejection. A complete reply requires that the terminal disclaimer be accompanied by a reply requesting reconsideration of the prior Office action. Even where the NSDP rejection is provisional the reply must be complete. See MPEP § 804, subsection I.B.1. For a reply to a non-final Office action, see 37 CFR 1.111(a). For a reply to final Office action, see 37 CFR 1.113(c). A request for reconsideration while not provided for in 37 CFR 1.113(c) may be filed after final for consideration. See MPEP §§ 706.07(e) and 714.13. The USPTO Internet website contains terminal disclaimer forms which may be used. Please visit www.uspto.gov/patent/patents-forms. The actual filing date of the application in which the form is filed determines what form (e.g., PTO/SB/25, PTO/SB/26, PTO/AIA /25, or PTO/AIA /26) should be used. A web-based eTerminal Disclaimer may be filled out completely online using web-screens. An eTerminal Disclaimer that meets all requirements is auto-processed and approved immediately upon submission. For more information about eTerminal Disclaimers, refer to www.uspto.gov/patents/apply/applying-online/eterminal-disclaimer. Claims 1-11 are rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1-6 of U.S. Patent No. 12,005,080 B2. It is of note that the instant application is a CONTINUATION-IN-PART of the now patent. Although the claims at issue are not identical, they are not patentably distinct from each other because the patent claims either anticipate or render obvious the instant claims. In addition, the prohibition of nonstatutory Double Patenting Rejections under USC 1.121 does not apply for applications filed as continuation-in-parts, even if a Restriction Requirement was made in the parent Application (MPEP § 804.01 (E)). Patent claim 1 is directed to a genetically modified human immune cell, wherein the genetic modification up-regulates an expression of a low density lipoprotein receptor-associated protein or fragment thereof in the genetically modified immune cell, wherein the low density lipoprotein receptor-associated protein is low density lipoprotein receptor-associated protein 6 or the low density lipoprotein receptor-associated protein 5, wherein the low density lipoprotein receptor-associated protein or fragment thereof comprises an intracellular region of the low density lipoprotein receptor-associated protein, and wherein the low density lipoprotein receptor-associated protein or fragment thereof comprises an amino acid sequence as set forth in any one of SEQ ID NO: 22, 24, 26, and 28, or an amino acid sequence having at least 80% homology thereof. As the sequences of patent SEQ ID NOs: 22, 24, 26, and 28 are identical to instant SEQ ID NOs: 22, 24, 26, and 28, patent claim 1 therefore anticipates the limitations of instant claims 1 and 5-7. See sequence alignment at end of document. With that, patent claims 2-6 are each substantially identical to and thus anticipate instant claims 3-4, 8, and 10. See sequence alignment at end of document regarding SEQ ID NOs: 21, 23, 25, and 27 in instant claim 8. In addition, since the genetically modified human immune cell of patent claim 1 is structurally identical to the genetically modified immune cell of the instant claim, the genetically modified human immune cell will inherently have one or more of the properties recited in instant claim 2. Likewise, the ordinary artisan would have recognized that the genetically modified human immune cell of patent claim 1 could be any one of a T cell, an NK cell, a B cell, a dendritic cell, or a macrophage, as those are well-known immune cells within the art. See Paragraph [0018] of the instant Specification. This therefore renders obvious the genetically modified immune cell instant claim 10. Lastly, the ordinary artisan also would have recognized that the genetically modified human immune cell of patent claim 1 can be comprised within a composition, as that is a product variant of the patent claim. This therefore renders obvious the composition of instant claim 11. Conclusion Any inquiry concerning this communication or earlier communications from the examiner should be directed to ALYSSA G WESTON whose telephone number is (571)272-0337. The examiner can normally be reached Monday-Thursday 8AM - 4PM (CT); Friday 8AM - 11AM (CT). Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Christopher Babic can be reached at (571) 272-8507. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /ALYSSA G WESTON/Examiner, Art Unit 1633 Sequence Alignments Query Match 100.0%; Length 1167; Matches 1167; Mismatches 0; Gaps 0; Qy 1 ATGGGGGCCGTCCTGAGGAGCCTCCTGGCCTGCAGCTTCTGTGTGCTCCTGAGAGCGGAA 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 ATGGGGGCCGTCCTGAGGAGCCTCCTGGCCTGCAGCTTCTGTGTGCTCCTGAGAGCGGAA 60 Qy 61 CCTCCAACATGTTCTCCTCAGCAGTTTACTTGTTTCACGGGGGAAATTGACTGTATCCCT 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 CCTCCAACATGTTCTCCTCAGCAGTTTACTTGTTTCACGGGGGAAATTGACTGTATCCCT 120 Qy 121 GTGGCTTGGCGGTGCGATGGGTTTACTGAATGTGAAGACCACAGTGATGAACTCAATTGT 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 GTGGCTTGGCGGTGCGATGGGTTTACTGAATGTGAAGACCACAGTGATGAACTCAATTGT 180 Qy 181 CCTGTATGCTCAGAGTCCCAGTTCCAGTGTGCCAGTGGGCAGTGTATTGATGGTGCCCTC 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 CCTGTATGCTCAGAGTCCCAGTTCCAGTGTGCCAGTGGGCAGTGTATTGATGGTGCCCTC 240 Qy 241 CGATGCAATGGAGATGCAAACTGCCAGGACAAATCAGATGAGAAGAACTGTGAAGTGCTT 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 CGATGCAATGGAGATGCAAACTGCCAGGACAAATCAGATGAGAAGAACTGTGAAGTGCTT 300 Qy 301 TGTTTAATTGATCAGTTCCGCTGTGCCAATGGTCAGTGCATTGGAAAGCACAAGAAGTGT 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 TGTTTAATTGATCAGTTCCGCTGTGCCAATGGTCAGTGCATTGGAAAGCACAAGAAGTGT 360 Qy 361 GATCATAATGTGGATTGCAGTGACAAGTCAGATGAACTGGATTGTTATCCGACTGAAGAA 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 GATCATAATGTGGATTGCAGTGACAAGTCAGATGAACTGGATTGTTATCCGACTGAAGAA 420 Qy 421 CCAGCACCACAGGCCACCAATACAGTTGGTTCTGTTATTGGCGTAATTGTCACCATTTTT 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 CCAGCACCACAGGCCACCAATACAGTTGGTTCTGTTATTGGCGTAATTGTCACCATTTTT 480 Qy 481 GTGTCTGGAACTGTATACTTTATCTGCCAGAGGATGTTGTGTCCACGTATGAAGGGAGAT 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 481 GTGTCTGGAACTGTATACTTTATCTGCCAGAGGATGTTGTGTCCACGTATGAAGGGAGAT 540 Qy 541 GGGGAAACTATGACTAATGACTATGTAGTTCATGGACCAGCTTCTGTGCCTCTTGGTTAT 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 541 GGGGAAACTATGACTAATGACTATGTAGTTCATGGACCAGCTTCTGTGCCTCTTGGTTAT 600 Qy 601 GTGCCACACCCAAGTTCTTTGTCAGGATCTCTTCCAGGAATGTCTCGAGGTAAATCAATG 660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 601 GTGCCACACCCAAGTTCTTTGTCAGGATCTCTTCCAGGAATGTCTCGAGGTAAATCAATG 660 Qy 661 ATCAGCTCCCTCAGTATCATGGGGGGAAGCAGTGGACCCCCCTATGACCGAGCCCATGTT 720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 661 ATCAGCTCCCTCAGTATCATGGGGGGAAGCAGTGGACCCCCCTATGACCGAGCCCATGTT 720 Qy 721 ACAGGAGCATCATCAAGTAGTTCTTCAAGCACCAAAGGCACTTACTTCCCTGCAATTTTG 780 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 721 ACAGGAGCATCATCAAGTAGTTCTTCAAGCACCAAAGGCACTTACTTCCCTGCAATTTTG 780 Qy 781 AACCCTCCACCATCCCCAGCCACAGAGCGATCACATTACACTATGGAATTTGGATATTCT 840 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 781 AACCCTCCACCATCCCCAGCCACAGAGCGATCACATTACACTATGGAATTTGGATATTCT 840 Qy 841 TCAAACAGTCCTTCCACTCATAGGTCATACAGCTACAGGCCATATAGCTACCGGCACTTT 900 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 841 TCAAACAGTCCTTCCACTCATAGGTCATACAGCTACAGGCCATATAGCTACCGGCACTTT 900 Qy 901 GCACCCCCCACCACACCCTGCAGCACAGATGTTTGTGACAGTGACTATGCTCCTAGTCGG 960 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 901 GCACCCCCCACCACACCCTGCAGCACAGATGTTTGTGACAGTGACTATGCTCCTAGTCGG 960 Qy 961 AGAATGACCTCAGTGGCAACAGCCAAGGGCTATACCAGTGACTTGAACTATGATTCAGAA 1020 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 961 AGAATGACCTCAGTGGCAACAGCCAAGGGCTATACCAGTGACTTGAACTATGATTCAGAA 1020 Qy 1021 CCTGTGCCCCCACCTCCCACACCCCGAAGCCAATACTTGTCAGCAGAGGAGAACTATGAA 1080 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1021 CCTGTGCCCCCACCTCCCACACCCCGAAGCCAATACTTGTCAGCAGAGGAGAACTATGAA 1080 Qy 1081 AGCTGCCCACCTTCTCCATACACAGAGAGGAGCTATTCTCATCACCTCTACCCACCGCCA 1140 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1081 AGCTGCCCACCTTCTCCATACACAGAGAGGAGCTATTCTCATCACCTCTACCCACCGCCA 1140 Qy 1141 CCCTCTCCCTGTACAGACTCCTCCTGA 1167 (INSTANT SEQ ID NO: 21) ||||||||||||||||||||||||||| Db 1141 CCCTCTCCCTGTACAGACTCCTCCTGA 1167 (PATENT SEQ ID NO: 21) Query Match 100.0%; Length 370; Matches 370; Mismatches 0; Gaps 0; Qy 1 GEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDG 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 GEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDG 60 Qy 61 ALRCNGDANCQDKSDEKNCEVLCLIDQFRCANGQCIGKHKKCDHNVDCSDKSDELDCYPT 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 ALRCNGDANCQDKSDEKNCEVLCLIDQFRCANGQCIGKHKKCDHNVDCSDKSDELDCYPT 120 Qy 121 EEPAPQATNTVGSVIGVIVTIFVSGTVYFICQRMLCPRMKGDGETMTNDYVVHGPASVPL 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 EEPAPQATNTVGSVIGVIVTIFVSGTVYFICQRMLCPRMKGDGETMTNDYVVHGPASVPL 180 Qy 181 GYVPHPSSLSGSLPGMSRGKSMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPA 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 GYVPHPSSLSGSLPGMSRGKSMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPA 240 Qy 241 ILNPPPSPATERSHYTMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAP 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 ILNPPPSPATERSHYTMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAP 300 Qy 301 SRRMTSVATAKGYTSDLNYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYP 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 SRRMTSVATAKGYTSDLNYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYP 360 Qy 361 PPPSPCTDSS 370 (INSTANT SEQ ID NO: 22) |||||||||| Db 361 PPPSPCTDSS 370 (PATENT SEQ ID NO: 22) Query Match 100.0%; Length 804; Matches 804; Mismatches 0; Gaps 0; Qy 1 ATGGGGGCCGTCCTGAGGAGCCTCCTGGCCTGCAGCTTCTGTGTGCTCCTGAGAGCGCCA 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 ATGGGGGCCGTCCTGAGGAGCCTCCTGGCCTGCAGCTTCTGTGTGCTCCTGAGAGCGCCA 60 Qy 61 GCACCACAGGCCACCAATACAGTTGGTTCTGTTATTGGCGTAATTGTCACCATTTTTGTG 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 GCACCACAGGCCACCAATACAGTTGGTTCTGTTATTGGCGTAATTGTCACCATTTTTGTG 120 Qy 121 TCTGGAACTGTATACTTTATCTGCCAGAGGATGTTGTGTCCACGTATGAAGGGAGATGGG 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 TCTGGAACTGTATACTTTATCTGCCAGAGGATGTTGTGTCCACGTATGAAGGGAGATGGG 180 Qy 181 GAAACTATGACTAATGACTATGTAGTTCATGGACCAGCTTCTGTGCCTCTTGGTTATGTG 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 GAAACTATGACTAATGACTATGTAGTTCATGGACCAGCTTCTGTGCCTCTTGGTTATGTG 240 Qy 241 CCACACCCAAGTTCTTTGTCAGGATCTCTTCCAGGAATGTCTCGAGGTAAATCAATGATC 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 CCACACCCAAGTTCTTTGTCAGGATCTCTTCCAGGAATGTCTCGAGGTAAATCAATGATC 300 Qy 301 AGCTCCCTCAGTATCATGGGGGGAAGCAGTGGACCCCCCTATGACCGAGCCCATGTTACA 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 AGCTCCCTCAGTATCATGGGGGGAAGCAGTGGACCCCCCTATGACCGAGCCCATGTTACA 360 Qy 361 GGAGCATCATCAAGTAGTTCTTCAAGCACCAAAGGCACTTACTTCCCTGCAATTTTGAAC 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 GGAGCATCATCAAGTAGTTCTTCAAGCACCAAAGGCACTTACTTCCCTGCAATTTTGAAC 420 Qy 421 CCTCCACCATCCCCAGCCACAGAGCGATCACATTACACTATGGAATTTGGATATTCTTCA 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 CCTCCACCATCCCCAGCCACAGAGCGATCACATTACACTATGGAATTTGGATATTCTTCA 480 Qy 481 AACAGTCCTTCCACTCATAGGTCATACAGCTACAGGCCATATAGCTACCGGCACTTTGCA 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 481 AACAGTCCTTCCACTCATAGGTCATACAGCTACAGGCCATATAGCTACCGGCACTTTGCA 540 Qy 541 CCCCCCACCACACCCTGCAGCACAGATGTTTGTGACAGTGACTATGCTCCTAGTCGGAGA 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 541 CCCCCCACCACACCCTGCAGCACAGATGTTTGTGACAGTGACTATGCTCCTAGTCGGAGA 600 Qy 601 ATGACCTCAGTGGCAACAGCCAAGGGCTATACCAGTGACTTGAACTATGATTCAGAACCT 660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 601 ATGACCTCAGTGGCAACAGCCAAGGGCTATACCAGTGACTTGAACTATGATTCAGAACCT 660 Qy 661 GTGCCCCCACCTCCCACACCCCGAAGCCAATACTTGTCAGCAGAGGAGAACTATGAAAGC 720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 661 GTGCCCCCACCTCCCACACCCCGAAGCCAATACTTGTCAGCAGAGGAGAACTATGAAAGC 720 Qy 721 TGCCCACCTTCTCCATACACAGAGAGGAGCTATTCTCATCACCTCTACCCACCGCCACCC 780 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 721 TGCCCACCTTCTCCATACACAGAGAGGAGCTATTCTCATCACCTCTACCCACCGCCACCC 780 Qy 781 TCTCCCTGTACAGACTCCTCCTGA 804 (INSTANT SEQ ID NO: 23) |||||||||||||||||||||||| Db 781 TCTCCCTGTACAGACTCCTCCTGA 804 (PATENT SEQ ID NO: 23) Query Match 100.0%; Length 243; Matches 243; Mismatches 0; Gaps 0; Qy 1 TNTVGSVIGVIVTIFVSGTVYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPS 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 TNTVGSVIGVIVTIFVSGTVYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPS 60 Qy 61 SLSGSLPGMSRGKSMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPS 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 SLSGSLPGMSRGKSMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPS 120 Qy 121 PATERSHYTMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSV 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 PATERSHYTMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSV 180 Qy 181 ATAKGYTSDLNYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCT 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 ATAKGYTSDLNYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCT 240 Qy 241 DSS 243(INSTANT SEQ ID NO: 24) ||| Db 241 DSS 243 PATENT SEQ ID NO: 24) Query Match 100.0%; Length 1089; Matches 1089; Mismatches 0; Gaps 0; Qy 1 GGAGAGCCGCCCACCTGCTCCCCGGACCAGTTTGCATGTGCCACAGGGGAGATCGACTGT 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 GGAGAGCCGCCCACCTGCTCCCCGGACCAGTTTGCATGTGCCACAGGGGAGATCGACTGT 60 Qy 61 ATCCCCGGGGCCTGGCGCTGTGACGGCTTTCCCGAGTGCGATGACCAGAGCGACGAGGAG 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 ATCCCCGGGGCCTGGCGCTGTGACGGCTTTCCCGAGTGCGATGACCAGAGCGACGAGGAG 120 Qy 121 GGCTGCCCCGTGTGCTCCGCCGCCCAGTTCCCCTGCGCGCGGGGTCAGTGTGTGGACCTG 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 GGCTGCCCCGTGTGCTCCGCCGCCCAGTTCCCCTGCGCGCGGGGTCAGTGTGTGGACCTG 180 Qy 181 CGCCTGCGCTGCGACGGCGAGGCAGACTGTCAGGACCGCTCAGACGAGGCGGACTGTGAC 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 CGCCTGCGCTGCGACGGCGAGGCAGACTGTCAGGACCGCTCAGACGAGGCGGACTGTGAC 240 Qy 241 GCCATCTGCCTGCCCAACCAGTTCCGGTGTGCGAGCGGCCAGTGTGTCCTCATCAAACAG 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 GCCATCTGCCTGCCCAACCAGTTCCGGTGTGCGAGCGGCCAGTGTGTCCTCATCAAACAG 300 Qy 301 CAGTGCGACTCCTTCCCCGACTGTATCGACGGCTCCGACGAGCTCATGTGTGAAATCACC 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 CAGTGCGACTCCTTCCCCGACTGTATCGACGGCTCCGACGAGCTCATGTGTGAAATCACC 360 Qy 361 AAGCCGCCCTCAGACGACAGCCCGGCCCACAGCAGTGCCATCGGGCCCGTCATTGGCATC 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 AAGCCGCCCTCAGACGACAGCCCGGCCCACAGCAGTGCCATCGGGCCCGTCATTGGCATC 420 Qy 421 ATCCTCTCTCTCTTCGTCATGGGTGGTGTCTATTTTGTGTGCCAGCGCGTGGTGTGCCAG 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 ATCCTCTCTCTCTTCGTCATGGGTGGTGTCTATTTTGTGTGCCAGCGCGTGGTGTGCCAG 480 Qy 481 CGCTATGCGGGGGCCAACGGGCCCTTCCCGCACGAGTATGTCAGCGGGACCCCGCACGTG 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 481 CGCTATGCGGGGGCCAACGGGCCCTTCCCGCACGAGTATGTCAGCGGGACCCCGCACGTG 540 Qy 541 CCCCTCAATTTCATAGCCCCGGGCGGTTCCCAGCATGGCCCCTTCACAGGCATCGCATGC 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 541 CCCCTCAATTTCATAGCCCCGGGCGGTTCCCAGCATGGCCCCTTCACAGGCATCGCATGC 600 Qy 601 GGAAAGTCCATGATGAGCTCCGTGAGCCTGATGGGGGGCCGGGGCGGGGTGCCCCTCTAC 660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 601 GGAAAGTCCATGATGAGCTCCGTGAGCCTGATGGGGGGCCGGGGCGGGGTGCCCCTCTAC 660 Qy 661 GACCGGAACCACGTCACAGGGGCCTCGTCCAGCAGCTCGTCCAGCACGAAGGCCACGCTG 720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 661 GACCGGAACCACGTCACAGGGGCCTCGTCCAGCAGCTCGTCCAGCACGAAGGCCACGCTG 720 Qy 721 TACCCGCCGATCCTGAACCCGCCGCCCTCCCCGGCCACGGACCCCTCCCTGTACAACATG 780 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 721 TACCCGCCGATCCTGAACCCGCCGCCCTCCCCGGCCACGGACCCCTCCCTGTACAACATG 780 Qy 781 GACATGTTCTACTCTTCAAACATTCCGGCCACTGCGAGACCGTACAGGCCCTACATCATT 840 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 781 GACATGTTCTACTCTTCAAACATTCCGGCCACTGCGAGACCGTACAGGCCCTACATCATT 840 Qy 841 CGAGGAATGGCGCCCCCGACGACGCCCTGCAGCACCGACGTGTGTGACAGCGACTACAGC 900 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 841 CGAGGAATGGCGCCCCCGACGACGCCCTGCAGCACCGACGTGTGTGACAGCGACTACAGC 900 Qy 901 GCCAGCCGCTGGAAGGCCAGCAAGTACTACCTGGATTTGAACTCGGACTCAGACCCCTAT 960 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 901 GCCAGCCGCTGGAAGGCCAGCAAGTACTACCTGGATTTGAACTCGGACTCAGACCCCTAT 960 Qy 961 CCACCCCCACCCACGCCCCACAGCCAGTACCTGTCGGCGGAGGACAGCTGCCCGCCCTCG 1020 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 961 CCACCCCCACCCACGCCCCACAGCCAGTACCTGTCGGCGGAGGACAGCTGCCCGCCCTCG 1020 Qy 1021 CCCGCCACCGAGAGGAGCTACTTCCATCTCTTCCCGCCCCCTCCGTCCCCCTGCACGGAC 1080 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1021 CCCGCCACCGAGAGGAGCTACTTCCATCTCTTCCCGCCCCCTCCGTCCCCCTGCACGGAC 1080 Qy 1081 TCATCCTGA 1089 (INSTANT SEQ ID NO: 25) ||||||||| Db 1081 TCATCCTGA 1089 (PATENT SEQ ID NO: 25) Query Match 100.0%; Length 362; Matches 362; Mismatches 0; Gaps 0; Qy 1 GEPPTCSPDQFACATGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSAAQFPCARGQCVDL 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 GEPPTCSPDQFACATGEIDCIPGAWRCDGFPECDDQSDEEGCPVCSAAQFPCARGQCVDL 60 Qy 61 RLRCDGEADCQDRSDEADCDAICLPNQFRCASGQCVLIKQQCDSFPDCIDGSDELMCEIT 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 RLRCDGEADCQDRSDEADCDAICLPNQFRCASGQCVLIKQQCDSFPDCIDGSDELMCEIT 120 Qy 121 KPPSDDSPAHSSAIGPVIGIILSLFVMGGVYFVCQRVVCQRYAGANGPFPHEYVSGTPHV 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 KPPSDDSPAHSSAIGPVIGIILSLFVMGGVYFVCQRVVCQRYAGANGPFPHEYVSGTPHV 180 Qy 181 PLNFIAPGGSQHGPFTGIACGKSMMSSVSLMGGRGGVPLYDRNHVTGASSSSSSSTKATL 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 PLNFIAPGGSQHGPFTGIACGKSMMSSVSLMGGRGGVPLYDRNHVTGASSSSSSSTKATL 240 Qy 241 YPPILNPPPSPATDPSLYNMDMFYSSNIPATARPYRPYIIRGMAPPTTPCSTDVCDSDYS 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 YPPILNPPPSPATDPSLYNMDMFYSSNIPATARPYRPYIIRGMAPPTTPCSTDVCDSDYS 300 Qy 301 ASRWKASKYYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPATERSYFHLFPPPPSPCTD 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 ASRWKASKYYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPATERSYFHLFPPPPSPCTD 360 Qy 361 SS 362 (INSTANT SEQ ID NO: 26) || Db 361 SS 362 (PATENT SEQ ID NO: 26) Query Match 100.0%; Length 696; Matches 696; Mismatches 0; Gaps 0; Qy 1 AGTGCCATCGGGCCCGTCATTGGCATCATCCTCTCTCTCTTCGTCATGGGTGGTGTCTAT 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 AGTGCCATCGGGCCCGTCATTGGCATCATCCTCTCTCTCTTCGTCATGGGTGGTGTCTAT 60 Qy 61 TTTGTGTGCCAGCGCGTGGTGTGCCAGCGCTATGCGGGGGCCAACGGGCCCTTCCCGCAC 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 TTTGTGTGCCAGCGCGTGGTGTGCCAGCGCTATGCGGGGGCCAACGGGCCCTTCCCGCAC 120 Qy 121 GAGTATGTCAGCGGGACCCCGCACGTGCCCCTCAATTTCATAGCCCCGGGCGGTTCCCAG 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 GAGTATGTCAGCGGGACCCCGCACGTGCCCCTCAATTTCATAGCCCCGGGCGGTTCCCAG 180 Qy 181 CATGGCCCCTTCACAGGCATCGCATGCGGAAAGTCCATGATGAGCTCCGTGAGCCTGATG 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 CATGGCCCCTTCACAGGCATCGCATGCGGAAAGTCCATGATGAGCTCCGTGAGCCTGATG 240 Qy 241 GGGGGCCGGGGCGGGGTGCCCCTCTACGACCGGAACCACGTCACAGGGGCCTCGTCCAGC 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 GGGGGCCGGGGCGGGGTGCCCCTCTACGACCGGAACCACGTCACAGGGGCCTCGTCCAGC 300 Qy 301 AGCTCGTCCAGCACGAAGGCCACGCTGTACCCGCCGATCCTGAACCCGCCGCCCTCCCCG 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 AGCTCGTCCAGCACGAAGGCCACGCTGTACCCGCCGATCCTGAACCCGCCGCCCTCCCCG 360 Qy 361 GCCACGGACCCCTCCCTGTACAACATGGACATGTTCTACTCTTCAAACATTCCGGCCACT 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 GCCACGGACCCCTCCCTGTACAACATGGACATGTTCTACTCTTCAAACATTCCGGCCACT 420 Qy 421 GCGAGACCGTACAGGCCCTACATCATTCGAGGAATGGCGCCCCCGACGACGCCCTGCAGC 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 GCGAGACCGTACAGGCCCTACATCATTCGAGGAATGGCGCCCCCGACGACGCCCTGCAGC 480 Qy 481 ACCGACGTGTGTGACAGCGACTACAGCGCCAGCCGCTGGAAGGCCAGCAAGTACTACCTG 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 481 ACCGACGTGTGTGACAGCGACTACAGCGCCAGCCGCTGGAAGGCCAGCAAGTACTACCTG 540 Qy 541 GATTTGAACTCGGACTCAGACCCCTATCCACCCCCACCCACGCCCCACAGCCAGTACCTG 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 541 GATTTGAACTCGGACTCAGACCCCTATCCACCCCCACCCACGCCCCACAGCCAGTACCTG 600 Qy 601 TCGGCGGAGGACAGCTGCCCGCCCTCGCCCGCCACCGAGAGGAGCTACTTCCATCTCTTC 660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 601 TCGGCGGAGGACAGCTGCCCGCCCTCGCCCGCCACCGAGAGGAGCTACTTCCATCTCTTC 660 Qy 661 CCGCCCCCTCCGTCCCCCTGCACGGACTCATCCTGA 696 (INSTANT SEQ ID NO: 27) |||||||||||||||||||||||||||||||||||| Db 661 CCGCCCCCTCCGTCCCCCTGCACGGACTCATCCTGA 696 (PATENT SEQ ID NO: 27) Query Match 100.0%; Length 231; Matches 231; Mismatches 0; Gaps 0; Qy 1 SAIGPVIGIILSLFVMGGVYFVCQRVVCQRYAGANGPFPHEYVSGTPHVPLNFIAPGGSQ 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 SAIGPVIGIILSLFVMGGVYFVCQRVVCQRYAGANGPFPHEYVSGTPHVPLNFIAPGGSQ 60 Qy 61 HGPFTGIACGKSMMSSVSLMGGRGGVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSP 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 HGPFTGIACGKSMMSSVSLMGGRGGVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSP 120 Qy 121 ATDPSLYNMDMFYSSNIPATARPYRPYIIRGMAPPTTPCSTDVCDSDYSASRWKASKYYL 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 ATDPSLYNMDMFYSSNIPATARPYRPYIIRGMAPPTTPCSTDVCDSDYSASRWKASKYYL 180 Qy 181 DLNSDSDPYPPPPTPHSQYLSAEDSCPPSPATERSYFHLFPPPPSPCTDSS 231 (INSTANT SEQ ID NO: 28) ||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 DLNSDSDPYPPPPTPHSQYLSAEDSCPPSPATERSYFHLFPPPPSPCTDSS 231 (PATENT SEQ ID NO: 28)
Read full office action

Prosecution Timeline

May 01, 2024
Application Filed
Jun 17, 2026
Non-Final Rejection mailed — §112, §DP (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12668781
MATERIALS AND METHODS FOR THE MANUFACTURE OF PLURIPOTENT STEM CELLS
2y 2m to grant Granted Jun 30, 2026
Patent 12624338
METHOD AND DEVICE FOR TARGET CELL SEPARATION
2y 10m to grant Granted May 12, 2026
Patent 12599678
METHODS AND COMPOSITIONS FOR GENOMIC INTEGRATION
2y 11m to grant Granted Apr 14, 2026
Patent 12569539
Adipocytes Over-Expressing FFAR4 and Use Thereof
3y 3m to grant Granted Mar 10, 2026
Patent 12473342
Chimeric Antigen Receptor T Regulatory Cells for the Treatment of Atherosclerosis
5y 0m to grant Granted Nov 18, 2025
Study what changed to get past this examiner. Based on 5 most recent grants.

Strategy Recommendation AI-generated — please review before filing

Get a prosecution strategy drawn from examiner precedents, rejection analysis, and claim mapping.
Typically takes 5-10 seconds — AI-generated, attorney review required before filing

Prosecution Projections

1-2
Expected OA Rounds
61%
Grant Probability
99%
With Interview (+49.2%)
3y 5m (~1y 3m remaining)
Median Time to Grant
Low
PTA Risk
Based on 106 resolved cases by this examiner. Grant probability derived from career allowance rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month