Prosecution Insights
Last updated: October 04, 2026
Application No. 18/704,129

COMPOSITION COMPRISING BOTULINUM-DERIVED PEPTIDE FOR PAIN RELIEF

Non-Final OA §102
Filed
Apr 24, 2024
Priority
Oct 25, 2021 — RE 10-2021-0143024 +2 more
Examiner
GOUGH, TIFFANY MAUREEN
Art Unit
1651
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
BPMED CO., LTD.
OA Round
1 (Non-Final)
32%
Grant Probability
At Risk
1-2
OA Rounds
2y 1m
Est. Remaining
78%
With Interview

Examiner Intelligence

Grants only 32% of cases
32%
Career Allowance Rate
165 granted / 522 resolved
-28.4% vs TC avg
Strong +47% interview lift
Without
With
+46.8%
Interview Lift
resolved cases with interview
Typical timeline
4y 6m
Avg Prosecution
34 currently pending
Career history
560
Total Applications
across all art units

Statute-Specific Performance

§101
5.3%
-34.7% vs TC avg
§103
39.7%
-0.3% vs TC avg
§102
17.3%
-22.7% vs TC avg
§112
21.9%
-18.1% vs TC avg
Black line = Tech Center average estimate • Based on career data from 522 resolved cases

Office Action

§102
DETAILED ACTION Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Election/Restrictions Applicant's election with traverse of SEQ ID NO:45, SEQ ID NO:3 and Serotype A in the reply filed on 6/25/2026 is acknowledged. The traversal is on the ground(s) that the proteins share a common structure comprising a light chain and operate under the same mechanism. Applicants do however state that the species differ in the type of toxin and structural variations. This is not found persuasive because as acknowledged by applicant and as presented in the Species Election, the species of Group A lack unity of invention because they do not share the same or corresponding technical feature, for example the amino acid sequences of SEQ ID NO:31-58 are different. The same is true for the sequences of Group B and the serotypes of Group C. The requirement is still deemed proper and is therefore made FINAL. Claims 1-10, 17 are pending and have been considered on the merits herein. Priority Receipt is acknowledged of certified copies of papers required by 37 CFR 1.55. It is noted that neither of the certified priority documents are in English. Should applicant desire to obtain the benefit of foreign priority under 35 U.S.C. 119(a)-(d) prior to declaration of an interference, a certified English translation of the foreign application must be submitted in reply to this action. 37 CFR 41.154(b) and 41.202(e). Failure to provide a certified translation may result in no benefit being accorded for the non-English application. Claim Rejections - 35 USC § 102 In the event the determination of the status of the application as subject to AIA 35 U.S.C. 102 and 103 (or as subject to pre-AIA 35 U.S.C. 102 and 103) is incorrect, any correction of the statutory basis (i.e., changing from AIA to pre-AIA ) for the rejection will not be considered a new ground of rejection if the prior art relied upon, and the rationale supporting the rejection, would be the same under either status. The following is a quotation of the appropriate paragraphs of 35 U.S.C. 102 that form the basis for the rejections under this section made in this Office action: A person shall be entitled to a patent unless – (a)(1) the claimed invention was patented, described in a printed publication, or in public use, on sale, or otherwise available to the public before the effective filing date of the claimed invention. (a)(2) the claimed invention was described in a patent issued under section 151, or in an application for patent published or deemed published under section 122(b), in which the patent or application, as the case may be, names another inventor and was effectively filed before the effective filing date of the claimed invention. Claim(s) 1-10, 17 is/are rejected under 35 U.S.C. 102(a)(1) and (a)(2) as being anticipated by Lee et al. (US10300118). Regarding claim 1, Lee teaches a method of treating pain comprising administering a therapeutically effective amount of a composition comprising a botulinum toxin recombinant protein, wherein the recombinant protein has a cell penetrating peptide fused to the light chain of the botulinum toxin (abstract, col. 1, lines 17-21, col. 9, lines 33-38). The composition is for transdermal delivery of the cell penetrating botulinum toxin recombinant protein used to treat the skin (abstract, col. 3, lines 51-col. 4, lines 1-4, col. 7, lines 35-42). The cell penetrating peptide consists of the amino acid sequence of SEQ ID NO:1 (see SEQ ID NO:1 of Lee). Query Match 100.0%; Score 69; Length 13; Best Local Similarity 100.0%; Matches 13; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 KAMININKFLNQC 13 ||||||||||||| Db 1 KAMININKFLNQC 13 Regarding claim 2, the botulinum toxin recombinant protein consists of the amino acid sequence of SEQ ID NO:45 (see SEQ ID NO:45 of Lee). OTHER INFORMATION: TD1-BoNT/A Light chain Amino Acid Sequence with hexahistidine Query Match 100.0%; Score 2480; Length 469; Best Local Similarity 100.0%; Matches 469; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MKAMININKFLNQCPFVNKQFNYKDPVNGVDIAYIKIPNAGQMQPVKAFKIHNKIWVIPE 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MKAMININKFLNQCPFVNKQFNYKDPVNGVDIAYIKIPNAGQMQPVKAFKIHNKIWVIPE 60 Qy 61 RDTFTNPEEGDLNPPPEAKQVPVSYYDSTYLSTDNEKDNYLKGVTKLFERIYSTDLGRML 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 RDTFTNPEEGDLNPPPEAKQVPVSYYDSTYLSTDNEKDNYLKGVTKLFERIYSTDLGRML 120 Qy 121 LTSIVRGIPFWGGSTIDTELKVIDTNCINVIQPDGSYRSEELNLVIIGPSADIIQFECKS 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 LTSIVRGIPFWGGSTIDTELKVIDTNCINVIQPDGSYRSEELNLVIIGPSADIIQFECKS 180 Qy 181 FGHEVLNLTRNGYGSTQYIRFSPDFTFGFEESLEVDTNPLLGAGKFATDPAVTLAHELIH 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 FGHEVLNLTRNGYGSTQYIRFSPDFTFGFEESLEVDTNPLLGAGKFATDPAVTLAHELIH 240 Qy 241 AGHRLYGIAINPNRVFKVNTNAYYEMSGLEVSFEELRTFGGHDAKFIDSLQENEFRLYYY 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 AGHRLYGIAINPNRVFKVNTNAYYEMSGLEVSFEELRTFGGHDAKFIDSLQENEFRLYYY 300 Qy 301 NKFKDIASTLNKAKSIVGTTASLQYMKNVFKEKYLLSEDTSGKFSVDKLKFDKLYKMLTE 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 NKFKDIASTLNKAKSIVGTTASLQYMKNVFKEKYLLSEDTSGKFSVDKLKFDKLYKMLTE 360 Qy 361 IYTEDNFVKFFKVLNRKTYLNFDKAVFKINIVPKVNYTIYDGFNLRNTNLAANFNGQNTE 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 IYTEDNFVKFFKVLNRKTYLNFDKAVFKINIVPKVNYTIYDGFNLRNTNLAANFNGQNTE 420 Qy 421 INNMNFTKLKNFTGLFEFYKLLCVRGIITSKTKSLDKGYNKLEHHHHHH 469 ||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 INNMNFTKLKNFTGLFEFYKLLCVRGIITSKTKSLDKGYNKLEHHHHHH 469 Regarding claim 3, the botulinum toxin light chain consists of the amino acid sequence of SEQ ID NO:3 (SEQ ID NO:17, 38, 52). OTHER INFORMATION: BoNT/A Light chain Amino Acid Sequence with hexahistidine Query Match 100.0%; Score 2354; Length 468; Best Local Similarity 100.0%; Matches 448; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MPFVNKQFNYKDPVNGVDIAYIKIPNAGQMQPVKAFKIHNKIWVIPERDTFTNPEEGDLN 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 21 MPFVNKQFNYKDPVNGVDIAYIKIPNAGQMQPVKAFKIHNKIWVIPERDTFTNPEEGDLN 80 Qy 61 PPPEAKQVPVSYYDSTYLSTDNEKDNYLKGVTKLFERIYSTDLGRMLLTSIVRGIPFWGG 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 81 PPPEAKQVPVSYYDSTYLSTDNEKDNYLKGVTKLFERIYSTDLGRMLLTSIVRGIPFWGG 140 Qy 121 STIDTELKVIDTNCINVIQPDGSYRSEELNLVIIGPSADIIQFECKSFGHEVLNLTRNGY 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 141 STIDTELKVIDTNCINVIQPDGSYRSEELNLVIIGPSADIIQFECKSFGHEVLNLTRNGY 200 Qy 181 GSTQYIRFSPDFTFGFEESLEVDTNPLLGAGKFATDPAVTLAHELIHAGHRLYGIAINPN 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 201 GSTQYIRFSPDFTFGFEESLEVDTNPLLGAGKFATDPAVTLAHELIHAGHRLYGIAINPN 260 Qy 241 RVFKVNTNAYYEMSGLEVSFEELRTFGGHDAKFIDSLQENEFRLYYYNKFKDIASTLNKA 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 261 RVFKVNTNAYYEMSGLEVSFEELRTFGGHDAKFIDSLQENEFRLYYYNKFKDIASTLNKA 320 Qy 301 KSIVGTTASLQYMKNVFKEKYLLSEDTSGKFSVDKLKFDKLYKMLTEIYTEDNFVKFFKV 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 321 KSIVGTTASLQYMKNVFKEKYLLSEDTSGKFSVDKLKFDKLYKMLTEIYTEDNFVKFFKV 380 Qy 361 LNRKTYLNFDKAVFKINIVPKVNYTIYDGFNLRNTNLAANFNGQNTEINNMNFTKLKNFT 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 381 LNRKTYLNFDKAVFKINIVPKVNYTIYDGFNLRNTNLAANFNGQNTEINNMNFTKLKNFT 440 Qy 421 GLFEFYKLLCVRGIITSKTKSLDKGYNK 448 |||||||||||||||||||||||||||| Db 441 GLFEFYKLLCVRGIITSKTKSLDKGYNK 468 Regarding claim 4, the botulinum toxin light chain further includes a hexahistidine tag at one end (col. 9, lines 63, 64, and SEQ ID NO:17 and 52 as seen above). Regarding claim 5, the botulinum toxin light chain is selected from serotypes A, B, C, D, E, F, and G (col. 9, lines 58-60). Regarding claim 6, the cell penetrating peptide is fused to a carboxyl, an amino terminus (col. 8, lines 62-65, col. 9, lines 33-52). Regarding claim 7, the fusion is achieved by a peptide bond or a covalent bond (col. 9, lines 39-43). Regarding claim 8, the protein relieves muscle tension as it treats migraines (col. 5, line 4, for example). Regarding claim 9, the pain to be treated includes migraines, physical pain as it treats dystonia, torticollis, temporomandibular disorder, facial and eyelid spasms, for example (col. 5, lines 18-35, 50). Regarding claim 10, the composition is for transdermal administration (col. 5, lines 5-7, 22-23, col. 6, lines 1-7, for example) Regarding claim 17, the composition is a pharmaceutical composition (col. 5, lines 5-7) or cosmetic composition (col. 5, lines 11-13). Thus, the reference anticipates the claimed subject matter. Claim(s) 1, 3-10, 17 is/are rejected under 35 U.S.C. 102(a)(1) and (a)(2) as being anticipated by Collier et al. (US20180251740). Collier teaches a method of treating pain comprising administering a composition comprising a fusion protein comtaining a botulinum toxin recombinant protein and a cell-penetrating peptide consisting of the amino acid sequence of SEQ ID NO:1 fused to the end or both ends of a botulinum toxin light chain (abstract, 0004-0006, 0099). Regarding claims 1, 3, the cell-penetrating peptide consists of the amino acid sequence of SEQ ID NO:1 and contains the botulinum light chain of SEQ ID NO:3. See Collier SEQ ID NO:20, 30. (0210). Query Match 100.0%; Score 69; Length 842; Best Local Similarity 100.0%; Matches 13; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 KAMININKFLNQC 13 ||||||||||||| Db 779 KAMININKFLNQC 791 Query Match 99.8%; Score 2350; Length 448; Best Local Similarity 99.8%; Matches 447; Conservative 0; Mismatches 1; Indels 0; Gaps 0; Qy 1 MPFVNKQFNYKDPVNGVDIAYIKIPNAGQMQPVKAFKIHNKIWVIPERDTFTNPEEGDLN 60 |||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||| Db 1 MPFVNKQFNYKDPVNGVDIAYIKIPNVGQMQPVKAFKIHNKIWVIPERDTFTNPEEGDLN 60 Qy 61 PPPEAKQVPVSYYDSTYLSTDNEKDNYLKGVTKLFERIYSTDLGRMLLTSIVRGIPFWGG 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 PPPEAKQVPVSYYDSTYLSTDNEKDNYLKGVTKLFERIYSTDLGRMLLTSIVRGIPFWGG 120 Qy 121 STIDTELKVIDTNCINVIQPDGSYRSEELNLVIIGPSADIIQFECKSFGHEVLNLTRNGY 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 STIDTELKVIDTNCINVIQPDGSYRSEELNLVIIGPSADIIQFECKSFGHEVLNLTRNGY 180 Qy 181 GSTQYIRFSPDFTFGFEESLEVDTNPLLGAGKFATDPAVTLAHELIHAGHRLYGIAINPN 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 GSTQYIRFSPDFTFGFEESLEVDTNPLLGAGKFATDPAVTLAHELIHAGHRLYGIAINPN 240 Qy 241 RVFKVNTNAYYEMSGLEVSFEELRTFGGHDAKFIDSLQENEFRLYYYNKFKDIASTLNKA 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 RVFKVNTNAYYEMSGLEVSFEELRTFGGHDAKFIDSLQENEFRLYYYNKFKDIASTLNKA 300 Qy 301 KSIVGTTASLQYMKNVFKEKYLLSEDTSGKFSVDKLKFDKLYKMLTEIYTEDNFVKFFKV 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 KSIVGTTASLQYMKNVFKEKYLLSEDTSGKFSVDKLKFDKLYKMLTEIYTEDNFVKFFKV 360 Qy 361 LNRKTYLNFDKAVFKINIVPKVNYTIYDGFNLRNTNLAANFNGQNTEINNMNFTKLKNFT 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 LNRKTYLNFDKAVFKINIVPKVNYTIYDGFNLRNTNLAANFNGQNTEINNMNFTKLKNFT 420 Qy 421 GLFEFYKLLCVRGIITSKTKSLDKGYNK 448 |||||||||||||||||||||||||||| Db 421 GLFEFYKLLCVRGIITSKTKSLDKGYNK 448 Regarding claim 4, the light chain includes a hexahistidine tag, i.e., HHHHHH (SEQ ID NO:61, 0305) Regarding claim 5, the botulinum toxin light chain is from serotypes, A-G (0210, for example). Regarding claim 6, the peptide is fused to at least the N or C-terminus (0199, 0207). Regarding claim 7, the fusion is by a peptide bond (0199). Regarding claims 8 and 9, the relieves muscle tension and the pain is chronic pain, diabetic neuropathy, fibromyalgia, pain disorders, cancer pain and nociception (0004-0006, 0099, 0101, 0102). Regarding claim 10, the composition is for transdermal administration (0424). Regarding claim 17, the composition is a pharmaceutical composition (0116, for example). Thus, the reference anticipates the claimed subject matter. Conclusion Any inquiry concerning this communication or earlier communications from the examiner should be directed to TIFFANY MAUREEN GOUGH whose telephone number is (571)272-0697. The examiner can normally be reached M-Thu 8-5. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Melenie Gordon can be reached at 571-272-8037. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /TIFFANY M GOUGH/Examiner, Art Unit 1651 /MELENIE L GORDON/Supervisory Patent Examiner, Art Unit 1651
Read full office action

Prosecution Timeline

Apr 24, 2024
Application Filed
Sep 16, 2026
Non-Final Rejection mailed — §102 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12642821
USE OF AKKERMANSIA FOR TREATING METABOLIC DISORDERS
1y 0m to grant Granted Jun 02, 2026
Patent 12584113
METHOD OF CELL CULTURE
6y 3m to grant Granted Mar 24, 2026
Patent 12576138
COMPOUNDS AND METHODS FOR THE IMMOBILIZATION OF MYOSTATIN-INHIBITORS ON THE EXTRACELLULAR MATRIX BY TRANSGLUTAMINASE
5y 5m to grant Granted Mar 17, 2026
Patent 12553902
Methods, Kits and Compositions for Diagnosing and Treating Renal Disease
3y 8m to grant Granted Feb 17, 2026
Patent 12553903
IVALTINOSTAT COMBINATION THERAPY FOR TREATING PANCREATIC CANCER
1y 9m to grant Granted Feb 17, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

Strategy Recommendation AI-generated — please review before filing

Get a prosecution strategy drawn from examiner precedents, rejection analysis, and claim mapping.
Typically takes 5-10 seconds — AI-generated, attorney review required before filing

Prosecution Projections

1-2
Expected OA Rounds
32%
Grant Probability
78%
With Interview (+46.8%)
4y 6m (~2y 1m remaining)
Median Time to Grant
Low
PTA Risk
Based on 522 resolved cases by this examiner. Grant probability derived from career allowance rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month