Prosecution Insights
Last updated: July 17, 2026
Application No. 18/723,206

COMPOSITIONS AND METHODS FOR MODIFYING GENOMES

Final Rejection §103
Filed
Jun 21, 2024
Priority
Dec 21, 2021 — provisional 63/292,074 +1 more
Examiner
KUMAR, VINOD
Art Unit
1663
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
BENSON HILL, INC.
OA Round
2 (Final)
83%
Grant Probability
Favorable
3-4
OA Rounds
0m
Est. Remaining
99%
With Interview

Examiner Intelligence

Grants 83% — above average
83%
Career Allowance Rate
1183 granted / 1430 resolved
+22.7% vs TC avg
Strong +20% interview lift
Without
With
+20.3%
Interview Lift
resolved cases with interview
Fast prosecutor
2y 1m
Avg Prosecution
41 currently pending
Career history
1459
Total Applications
across all art units

Statute-Specific Performance

§101
1.2%
-38.8% vs TC avg
§103
35.7%
-4.3% vs TC avg
§102
16.3%
-23.7% vs TC avg
§112
40.3%
+0.3% vs TC avg
Black line = Tech Center average estimate • Based on career data from 1430 resolved cases

Office Action

§103
Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . DETAILED ACTION Status of objections and rejections 1. Claims 1-18 are pending. Accordingly, claims 1-18 are examined on merits in the present Office action. Applicant’s response filed April 8, 2026 is entered. 2. The text of those sections of Title 35, U.S. Code not included in this action can be found in a prior Office action. 3. Rejection of claims 1–18 under 35 U.S.C. §103(a) as being unpatentable over Begemann et al. (U.S. Patent No. 10,113,179 B2, Issued October 30, 2018) in view of Yamano et al. (Cell, 67(4):633–645, 2017; doi:10.1016/j.molcel.2017.06.035 (pages1-24 and supplementary data included)) and further in view of Kleinstiver et al. (Nature Biotechnology, 37:276–282, 2019) is withdrawn in light of Applicant’s arguments filed in the papers of April 8, 2026 and upon further consideration. Claim Rejections - 35 USC § 103 4A. Claims 1–18 remain rejected under 35 U.S.C. §103(a) as being obvious Begemann et al. (U.S. Patent No. 10,113,179 B2, Issued October 30, 2018) in view of Gao et al. (Nature Biotechnology, 35(8): 789-792, 2017; XP055396069, New York ISSN: 1087-0156, DOI: 10.1038/nbt.38900) and Toth et al. (Nucleic Acids Research, 46(19)10272-10285, 2018, 37:276-282,2019 with supplemental data) for the reasons of record stated in the Office action mailed January 8, 2026. Begemann et al. teach methods of modifying a nucleotide sequence at a target site in a eukaryotic or prokaryotic cell using a CRISPR-Cpf1 system comprising introduction of a Cpf1 nuclease and a DNA-targeting RNA into a cell. Begemann et al. further teach Cpf1 polypeptides comprising an RNA-binding portion and an enzymatic activity portion that exhibits site-directed DNA cleavage. Begemann et al. also teach SEQ ID NO:133, which shares 99.7% sequence identity with instant SEQ ID NO:2, thereby teaching a Cpf1 polypeptide having well above 95% identity to the claimed sequence Begemann et al. also teach introduction of a DNA-targeting RNA (crRNA) comprising a segment complementary to a target genomic sequence. Begemann et al. further teach that the genomic target may be located in chromosomal, plasmid, mitochondrial, plastid, or other intracellular DNA. Begemann et al. also teach that Cpf1 recognizes a PAM sequence adjacent to the target site and cleaves DNA in a site-specific manner. Begemann et al. also teach that Cpf1-mediated cleavage results in insertions, deletions, or mutations via endogenous DNA repair mechanisms. Begemann et al also teach insertion of heterologous DNA, including sequences encoding proteins conferring antibiotic or herbicide tolerance, particularly in plant cells. Furthermore, Begemann et al. teach expression of Cpf1 from polynucleotides operably linked to heterologous promoters, including codon-optimized constructs for plant expression Additionally, Begemann et al. also teach regeneration of plants and production of seeds comprising Cpf1 constructs. See examples 1-14, Tables I-II, claims 1-25; See in particular, col. 5, lines 10–40; col. 7, lines 10–40; col. 4, lines 20–55; col. 6, lines 5–25; Sequence Listing; col. 7, lines 10–25; col. 5, lines 20–45; col. 3, lines 15–45; col. 6, lines 45–65; Fig. 2; col. 8, lines 25–55; Examples 3–5; col. 12, lines 20–45; col. 13, lines 5–35; col. 14, lines 10–30; cols 18-22, part IV; Example 7. The sequence homology between instant SEQ ID NO: 2 and Begemann et al. SEQ ID NO: 133 is shown as below: Qy: SEQ ID NO: 2 (instant); Db: SEQ ID NO: 133 (US PATENT 10,113,179 B2) Query Match 99.7%; Score 6635; DB 1; Length 1264; Best Local Similarity 99.6%; Matches 1259; Conservative 2; Mismatches 3; Indels 0; Gaps 0; Qy 1 MLFQDFTHLYPLSKTMRFELKPIGKTLEHIHAKNFLSQDETMADMYQKVKAILDDYHRDF 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MLFQDFTHLYPLSKTMRFELKPIGKTLEHIHAKNFLSQDETMADMYQKVKAILDDYHRDF 60 Qy 61 IADMMGEVKLTKLAEFYDVYLKFRKNPKDDGLQKQLKDLQAVLRKEIVKPIGNGGKYKAG 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 IADMMGEVKLTKLAEFYDVYLKFRKNPKDDGLQKQLKDLQAVLRKEIVKPIGNGGKYKAG 120 Qy 121 YDRLFGAKLFKDGKELGDLAKFVIAQEGESSPKLAHLAHFEKFSTYFTGFHRNRKNMYSD 180 ||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||| Db 121 YDRLFGAKLFKDGKELGDLAKFVIAQEGESSPKLAHLAHFEKFSTYFTGFHDNRKNMYSD 180 Qy 181 EDKHTAITYRLIHENLPRFIDNLQILATIKQKHSALYDQIINELTASGLDVSLASHLDGY 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 EDKHTAITYRLIHENLPRFIDNLQILATIKQKHSALYDQIINELTASGLDVSLASHLDGY 240 Qy 241 HKLLTQEGITAYNTLLGGISGEAGSRKIQGINELINSHHNQHCHKSERIAKLRPLHKQIL 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 HKLLTQEGITAYNTLLGGISGEAGSRKIQGINELINSHHNQHCHKSERIAKLRPLHKQIL 300 Qy 301 SDGMGVSFLPSKFADDSEMCQAVNEFYRHYADVFAKVQSLFDGFDDHQKDGIYVEHKNLN 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 SDGMGVSFLPSKFADDSEMCQAVNEFYRHYADVFAKVQSLFDGFDDHQKDGIYVEHKNLN 360 Qy 361 ELSKQAFGDFALLGRVLDGYYVDVVNPEFNERFAKAKTDNAKAKLTKEKDKFIKGVHSLA 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 ELSKQAFGDFALLGRVLDGYYVDVVNPEFNERFAKAKTDNAKAKLTKEKDKFIKGVHSLA 420 Qy 421 SLEQAIEHYTARHDDESVQAGKLGQYFKHGLAGVDNPIQKIHNNHSTIKGFLERERPAGE 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 SLEQAIEHYTARHDDESVQAGKLGQYFKHGLAGVDNPIQKIHNNHSTIKGFLERERPAGE 480 Qy 481 RALPKIKSGKNPEMTQLRQLKELLDNALNVAHFAKLLTTKTTLDNQDGNFYGEFGALYDE 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 481 RALPKIKSGKNPEMTQLRQLKELLDNALNVAHFAKLLTTKTTLDNQDGNFYGEFGALYDE 540 Qy 541 LAKIPTLYNKVRDYLSQKPFSTEKYKLNFGRPTLLRGWDLNKEKDNFGIILQKDGCYYLA 600 |||||||||||||||||||||||||||||| |||| |||||||||||||||||||||||| Db 541 LAKIPTLYNKVRDYLSQKPFSTEKYKLNFGNPTLLNGWDLNKEKDNFGIILQKDGCYYLA 600 Qy 601 LLDKAHKKVFDNAPNTGKNVYQKMIYKLLPGPNKMLPRVFFAKSNLDYYNPSAELLDKYA 660 |||||||||||||||||||||||||||||||||||||:|||||||||||||||||||||| Db 601 LLDKAHKKVFDNAPNTGKNVYQKMIYKLLPGPNKMLPKVFFAKSNLDYYNPSAELLDKYA 660 Qy 661 QGTHKKGNNFNLKDCHALIDFFKAGINKHPEWQHFGFKFSPTSSYQDLSDFYREVEPQGY 720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 661 QGTHKKGNNFNLKDCHALIDFFKAGINKHPEWQHFGFKFSPTSSYQDLSDFYREVEPQGY 720 Qy 721 QVKFVDINADYINELVEQGQLYLFQIYNKDFSPKAHGKPNLHTLYFKALFSKDNLANPIY 780 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 721 QVKFVDINADYINELVEQGQLYLFQIYNKDFSPKAHGKPNLHTLYFKALFSKDNLANPIY 780 Qy 781 KLNGEAQIFYRKASLDMNETTIHRAGEVLENKNPDNPKKRQFVYDIIKDKRYTQDKFLLH 840 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||:|| Db 781 KLNGEAQIFYRKASLDMNETTIHRAGEVLENKNPDNPKKRQFVYDIIKDKRYTQDKFMLH 840 Qy 841 VPITMNFGVQGMTIKEFNKKVNQSIQQYDEVNVIGIDRGERHLLYLTVINSKGEILEQRS 900 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 841 VPITMNFGVQGMTIKEFNKKVNQSIQQYDEVNVIGIDRGERHLLYLTVINSKGEILEQRS 900 Qy 901 LNDITTASANGTQMTTPYHKILDKREIERLNARVGWGEIETIKELKSGYLSHVVHQISQL 960 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 901 LNDITTASANGTQMTTPYHKILDKREIERLNARVGWGEIETIKELKSGYLSHVVHQISQL 960 Qy 961 MLKYNAIVVLEDLNFGFKRGRFKVEKQIYQNFENALIKKLNHLVLKDEADDEIGSYKNAL 1020 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 961 MLKYNAIVVLEDLNFGFKRGRFKVEKQIYQNFENALIKKLNHLVLKDEADDEIGSYKNAL 1020 Qy 1021 QLTNNFTDLKSIGKQTGFLFYVPAWNTSKIDPETGFVDLLKPRYENIAQSQAFFGKFDKI 1080 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1021 QLTNNFTDLKSIGKQTGFLFYVPAWNTSKIDPETGFVDLLKPRYENIAQSQAFFGKFDKI 1080 Qy 1081 CYNADKDYFEFHIDYAKFTDKAKNSRQIWKICSHGDKRYVYDKTANQNKGATKGINVNDE 1140 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1081 CYNADKDYFEFHIDYAKFTDKAKNSRQIWKICSHGDKRYVYDKTANQNKGATKGINVNDE 1140 Qy 1141 LKSLFARHHINDKQPNLVMDICQNNDKEFHKSLIYLLKTLLALRYSNASSDEDFILSPVA 1200 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1141 LKSLFARHHINDKQPNLVMDICQNNDKEFHKSLIYLLKTLLALRYSNASSDEDFILSPVA 1200 Qy 1201 NDEGMFFNSALADDTQPQNADANGAYHIALKGLWVLEQIKNSDDLNKVKLAIDNQTWLNF 1260 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1201 NDEGMFFNSALADDTQPQNADANGAYHIALKGLWVLEQIKNSDDLNKVKLAIDNQTWLNF 1260 Qy 1261 AQNR 1264 |||| Db 1261 AQNR 1264 Begemann et al. do no expressly teach (i) specific crRNA second-segment sequences recited as SEQ ID NOs:3-8; (ii) recognition of a YCCV PAM; (iii) the specific combination of arginine substitutions corresponding to D172, N571, N576, and K638 and leucine at M838 of SEQ ID NO:2; and (iv) performance of the method at temperatures below 32°C. Gao et al. teach engineered Cpf1 variants with altered PAM specificities generated by introducing positively charged amino acid substitutions into PAM-interacting residues. Gao et al. specifically teach a Cpf1 variant from Acidaminococcus sp. comprising mutations S542R and K607R, which, when aligned to SEQ ID NO: 2 of the instant claims, correspond to positions N576 and K638, respectively. Gao et al. further teach that these arginine substitutions significantly enhance cleavage activity at TCCC PAM sites, as demonstrated by comparative activity assays. Gao et al. further teach that the engineered Cpf1 variants also cleave targets adjacent to ACCC and CCCC PAM sequences, demonstrating expanded PAM recognition consistent with a YCCV motif. See in particular, abstract; 790, right column, paragraph 1; page 790, right column, paragraphs 1–2; Fig. 1 and Fig. 2; page 790, right column, paragraph 3; pages 791-792; Figs. 1, 3. Toth et al. teach engineered Cpf1 nucleases from Moraxella bovoculi with altered PAM specificity achieved by introducing arginine substitutions at residues involved in PAM interaction. Toth et al. specifically teach a double-arginine mutant comprising substitutions N576R and K637R, which correspond to N576 and K638 when aligned to SEQ ID NO: 2 of the instant claims. Toth et al. further teach that the resulting “RR MbCpf1” variant recognizes and cleaves DNA adjacent to a TCCC PAM with high efficiency, thereby confirming that such arginine substitutions confer expanded PAM recognition and are transferable across Cpf1 orthologs. See in particular, abstract; page 10280, left column, paragraph 2; Supplementary Fig. S13; Fig.11; pages 10273-10279, pages 10281-10283 through first paragraph of left column at page 10284; Figs. 1-12. Given (i) Begemann et al. teach a complete Cpf1-based genome-editing system, including a Cpf1 polypeptide having 99.7% identity to SEQ ID NO:2, crRNA-guided DNA cleavage, and genome modification outcomes; and (ii) Gao et al. and Toth et al. teach that introducing arginine substitutions at positions corresponding to N576 and K638 predictably alters PAM specificity to include TCCC-type PAMs, which fall within the claimed YCCV PAM sequence. The combination therefore teaches a Cpf1 polypeptide sharing high sequence identity with a reference sequence such as SEQ ID NO: 2 and comprising the claimed arginine substitutions, as well as the associated methods, nucleic acids, cells, plants, and progeny. One of ordinary skill in the art would have been motivated to combine the teachings of Begemann et al. with those of Gao et al. and Toth et al. because all three references address improving Cpf1-based genome editing by optimizing PAM recognition, which Begemann et al. teach is a critical determinant of target site selection. Gao et al. teach that specific arginine substitutions at PAM-interacting residues expand PAM compatibility while maintaining nuclease activity (Gao et al., page 790), and Toth et al. teach that analogous substitutions function across different Cpf1 orthologs (Toth et al., Fig. 11). Applying the PAM-altering substitutions taught by Gao et al. and Toth et al. to the Cpf1 system of Begemann et al. would have been a predictable modification yielding a Cpf1 nuclease capable of recognizing YCCV PAM sequences with a reasonable expectation of success. It would have been obvious and within the scope of an ordinary skill in the art to have performed instantly claimed method at an optimum temperature, such as less than 32oC, which is compatible for growth of living cells (e.g. plant cells of economically important plant species), and enzymes therein, including recombinant Cas9 nucleases, and thus arrive at the Applicant’s invention with a reasonable expectation of success and without any surprising results. Such a combination represents the routine optimization of a known genome editing system using known techniques to achieve a predictable result, consistent with KSR Int’l Co. v. Teleflex Inc., 550 U.S. 398 (2007). It would have been also prima facie obvious, and within the scope of an ordinary skill in the art prior to instantly claimed invention to have chosen from a finite number of predictable variants of Begemann et al. Cpf1 polypeptide (SEQ ID NO: 133, 99.7% identity to instant SEQ ID NO: 2), including the one having 100% identity to instant SEQ ID NO: 2, and thus arrive at the instantly claimed method comprising Cpf1 polypeptide of SEQ ID NO: 2 with a reasonable expectation of success without any unexpected or surprising results. See the recent Board decision Ex parte Smith, -- USPQ2d --, slip op. at 20, (Bd. Pat. App. & Interf. June 25, 2007) (citing KSR, 82 USPQ2d at 1396). KSR forecloses the argument that a specific teaching, suggestion or motivation is required to support a finding of obviousness. Therefore, the claimed invention as a whole is prima facie obvious over the combined teachings of the prior art. 4B. Response to Applicant’s Arguments: Begemann et al. teach a Cpf1 nuclease having 99.7% identity to SEQ ID NO: 2 and establish a suitable scaffold for genome editing. Gao et al. and Toth et al. teach that arginine substitutions at PAM-interacting residues (corresponding to N576 and K638) expand PAM recognition to include C-rich PAMs (e.g., TCCC, ACCC, CCCC), which fall within the claimed YCCV motif. Toth et al. further demonstrate that such substitutions are transferable across Cpf1 orthologs. Applicant argues that the prior art does not disclose the full set of five substitutions. However, the prior art need not disclose the claimed invention in haec verba. Rather, the question is whether the claimed combination would have been obvious to try with a reasonable expectation of success. See KSR Int’l Co. v. Teleflex Inc.. Here, the prior art identifies: (a) Key residues affecting PAM recognition, and (b) Arginine substitution as a predictable modification strategy. Thus, one of ordinary skill in the art would have been motivated to introduce additional substitutions, including at other positions, to further optimize PAM specificity. Such iterative modification constitutes routine optimization of result-effective variables. See In re Aller, 220 F.2d 454 (CCPA 1955). Applicant’s argument regarding unpredictability is not persuasive because the cited references demonstrate consistent PAM expansion upon arginine substitution, establishing a reasonable expectation of success. Absolute predictability is not required. See In re O’Farrell, 853 F.2d 894 (Fed. Cir. 1988). Applicant’s “large number of variants” argument is also unpersuasive. The relevant inquiry is whether the prior art provided direction to a finite set of identified modifications, not the total theoretical possibilities. See KSR Int’l Co. v. Teleflex Inc.. Here, the art clearly directs modification of PAM-interacting residues using arginine substitutions. Applicant’s evidence of unexpected results has been considered but is not sufficient. The observed YCCV PAM recognition is consistent with the C-rich PAM expansion trends taught by Gao et al. and Toth et al. Moreover, the comparison to partial variants does not demonstrate unexpected results where the prior art suggests that multiple substitutions may be required for altered specificity. The evidence is also not commensurate in scope with the claims. See In re Dillon, 919 F.2d 688 (Fed. Cir. 1990). The claimed invention represents the predictable combination of known elements (Cpf1 scaffold and PAM-altering substitutions) to achieve expected results. Accordingly, the rejection under 35 U.S.C. §103(a) is maintained. Double Patenting 5A. Claims 1-18 remain provisionally rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1-6 and 8-19 of copending Application No.17/638,605 (‘605 thereafter) in view of Toth et al. (Nucleic Acids Research, 46(19)10272-10285, 2018, 37:276-282,2019 with supplemental data) for the reasons of record stated in the Office action mailed January 8, 2026. Although the conflicting claims are not identical, they are not patentably distinct from each other because the copending application ’605 claims subject matter directed to: a CRISPR-Cpf1 (Cas12a) genome editing method in eukaryotic and prokaryotic cells (Claims 1–5), and nucleic acid compositions (claims 6, 13, 15, 18, 19)encoding engineered, non-naturally occurring Cpf1 variants sharing ≥95% identity to selected ortholog sequences including SEQ ID NO:52, wherein the nuclease comprises arginine at residue corresponding to the position 172 and leucine at residue corresponding to the position 838. However, SEQ ID NO: 52 comprises asparagine at residues corresponding to positions 571 and 576, respectively, and lysine at residue corresponding to position 638 of SEQ ID NO: 52 (Claims 1-6, 8–19), and transformed cells, regenerated plants, seeds, and compositions using such variants (Claims 8–12, 13–19). The instant application likewise claims: the same genome editing method steps (Claims 1–5, 18), the same Cpf1 nuclease genus defined by ≥95% identity to SEQ ID NO:2, with arginine residues at positions corresponding to D172, N576, N576, and K638, and leucine at M838 (Claim 1-18), and cells, plants, seeds, and polypeptide products comprising the identical engineered nuclease construct (Claims 10–14), and express recitation of SEQ ID NO:2 and SEQ ID NO:8, which are 99.7% identical to SEQ ID NO: 52 and 100% identical to SEQ ID NO:17, respectively, of the copending ‘605 case or differ only by predictable, routine PAM-engineering substitutions at 571, 576 and 638. Toth et al. confirm that: double arginine substitutions at residues N576R/K637R (aligned to instant N576/K638) confer high-efficiency cleavage at TCCC PAMs, and arginine substitutions at residue 571 enhance editing efficiency, and such substitutions are transferable across orthologs and represent predictable design choices. See in particular, abstract; page 10280, left column, paragraph 2; Supplementary Fig. S13; Fig.11; pages 10273-10279, pages 10281-10283 through first paragraph of left column at page 10284; Figs. 1-12. Thus, the only sequence differences between instant SEQ ID NO:2 (571R, 576R, 638R) and copending ‘605 SEQ ID NO:52 (571N, 576N, 638L positions) fall within a class of routine and predictable PAM-interacting residue substitutions previously validated to expand YCCV/TCCC recognition. These substitutions would have been obvious variant selections from the copending ‘605 genus, and therefore do not render the claims patentably distinct. This is a provisional nonstatutory double patenting rejection. 5B. Response to Applicant’s arguments: The rejection is based on obviousness-type double patenting, which does not require that the conflicting claims be identical, but only that the later claims are not patentably distinct from the earlier claims. See In re Longi (United States Court of Appeals, Federal Circuit 759 F.2d 887 (Fed. Cir. 1985). The claims of the copending ‘605 application recite a genus of Cpf1 nucleases having ≥95% identity and comprising substitutions at positions corresponding to D172 and M838, encompassing sequences highly similar to the presently claimed polypeptide. The instant claims differ primarily by additional substitutions at residues corresponding to N571, N576, and K638. As evidenced by Toth et al., these residues are known PAM-interacting positions, and substitution with arginine at such positions was a recognized and predictable strategy for altering PAM specificity and improving activity. Toth et al. further demonstrate that such substitutions are transferable across Cpf1 orthologs. Accordingly, the claimed modifications represent obvious variants of the genus claimed in the ‘605 application, and do not render the claims patentably distinct. See In re Basell Poliolefine Italia S.P.A. (No. 2007-1450; 2008). Applicant’s argument that the prior art does not disclose the exact combination of substitutions is not persuasive, as obviousness-type double patenting does not require express disclosure of the claimed subject matter, but rather considers whether the differences would have been obvious. Applicant’s argument regarding different PAM specificity (TTTC versus YCCV) is also not persuasive, as the prior art teaches that such specificity can be altered through substitutions at the identified residues, and thus represents an expected result of the claimed modifications. Accordingly, the rejection of claims 1–18 on the ground of nonstatutory double patenting is maintained. Conclusions 6. Claims 1-18 remain ejected. THIS ACTION IS MADE FINAL. Applicant is reminded of the extension of time policy as set forth in 37 CFR 1.136(a). A shortened statutory period for reply to this final action is set to expire THREE MONTHS from the mailing date of this action. In the event a first reply is filed within TWO MONTHS of the mailing date of this final action and the advisory action is not mailed until after the end of the THREE-MONTH shortened statutory period, then the shortened statutory period will expire on the date the advisory action is mailed, and any nonprovisional extension fee (37 CFR 1.17(a)) pursuant to 37 CFR 1.136(a) will be calculated from the mailing date of the advisory action. In no event, however, will the statutory period for reply expire later than SIX MONTHS from the mailing date of this final action. Contact Information Any inquiry concerning this communication or earlier communications from the examiner should be directed to Vinod Kumar whose telephone number is (571) 272-4445. The examiner can normally be reached on 8.30 a.m. to 5.00 p.m. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Amjad A. Abraham can be reached on (571) 270-7058 The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of an application may be obtained from the Patent Application Information Retrieval (PAIR) system. Status information for published applications may be obtained from either Private PAIR or Public PAIR. Status information for unpublished applications is available through Private PAIR only. For more information about the PAIR system, see http://pair-direct.uspto.gov. Should you have questions on access to the Private PAIR system, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative or access to the automated information system, call 800-786-9199 (IN USA OR CANADA). /VINOD KUMAR/Primary Examiner, Art Unit 1663
Read full office action

Prosecution Timeline

Jun 21, 2024
Application Filed
Jan 08, 2026
Non-Final Rejection mailed — §103
Apr 08, 2026
Response Filed
May 29, 2026
Final Rejection mailed — §103 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12677790
SOYBEAN VARIETY 01098315
2y 7m to grant Granted Jul 14, 2026
Patent 12677772
Lettuce Variety Thunderstruck
2y 2m to grant Granted Jul 14, 2026
Patent 12672629
SOYBEAN CULTIVAR 25430122
2y 6m to grant Granted Jul 07, 2026
Patent 12660776
WHEAT VARIETY 6PYKM33B
2y 5m to grant Granted Jun 23, 2026
Patent 12660785
SOYBEAN VARIETY 5PUEL09
2y 3m to grant Granted Jun 23, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

Strategy Recommendation AI-generated — please review before filing

Get a prosecution strategy drawn from examiner precedents, rejection analysis, and claim mapping.
Typically takes 5-10 seconds — AI-generated, attorney review required before filing

Prosecution Projections

3-4
Expected OA Rounds
83%
Grant Probability
99%
With Interview (+20.3%)
2y 1m (~0m remaining)
Median Time to Grant
Moderate
PTA Risk
Based on 1430 resolved cases by this examiner. Grant probability derived from career allowance rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month