Prosecution Insights
Last updated: July 17, 2026
Application No. 18/732,821

Proteins and nucleic acids useful in vaccines targeting Pseudomonas aeruginosa

Non-Final OA §102§103§112
Filed
Jun 04, 2024
Priority
Jul 04, 2015 — EU 15175365.4 +3 more
Examiner
ZEMAN, ROBERT A
Art Unit
1645
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Evaxion Biotech A/S
OA Round
3 (Non-Final)
54%
Grant Probability
Moderate
3-4
OA Rounds
1y 6m
Est. Remaining
82%
With Interview

Examiner Intelligence

Grants 54% of resolved cases
54%
Career Allowance Rate
420 granted / 777 resolved
-5.9% vs TC avg
Strong +28% interview lift
Without
With
+27.9%
Interview Lift
resolved cases with interview
Typical timeline
3y 8m
Avg Prosecution
44 currently pending
Career history
836
Total Applications
across all art units

Statute-Specific Performance

§101
1.4%
-38.6% vs TC avg
§103
34.6%
-5.4% vs TC avg
§102
16.6%
-23.4% vs TC avg
§112
45.3%
+5.3% vs TC avg
Black line = Tech Center average estimate • Based on career data from 777 resolved cases

Office Action

§102 §103 §112
The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . DETAILED ACTION The amendment filed on 8-8-2025 is acknowledged. Claims 1 and 3-5 have been amended. Claims 7-9 have been canceled. Claims 38-40 have been added. Claims 1-6, 9-27 and 29-40 are pending. Claims 10-27 and 30-37 are withdrawn from further consideration pursuant to 37 CFR 1.142(b) as being drawn to a nonelected invention, there being no allowable generic or linking claim. Claims 1-6, 29 and 38-40 are currently under examination. Claim Rejections Withdrawn The rejection of claims 7-9 under 35 U.S.C. 112(a) or 35 U.S.C. 112 (pre-AIA ), first paragraph, as failing to comply with the written description requirement is withdrawn. Cancellation of said claims has rendered the rejection moot. Claims 5-9 are rejected under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter which the inventor or a joint inventor (or for applications subject to pre-AIA 35 U.S.C. 112, the applicant), regards as the invention. The rejection of claim 5 under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite rendered vague and indefinite by the use of the phrase “…the pharmaceutical composition according to claim 1, which is fused or conjugated to an immunogenic carrier molecule” is withdrawn in light of the amendment thereto. The rejection of claim 7 under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite the phrase "in particular" is withdrawn. Cancellation of said claim has rendered the rejection moot. The rejection of claims 1-5, 7-9 and 29 under 35 U.S.C. 102(a)(1) as being anticipated by Rubenfield et al. (U.S. Patent 6,551,795 – IDS filed on 7-9-2024) is withdrawn in light of the amendment thereto. The rejection of claims 1-9 and 29 under 35 U.S.C. 103 as being unpatentable over Rubenfield et al. (U.S. Patent 6,551,795 – IDS filed on 7-9-2024) is withdrawn in light of the amendment thereto. Claim Rejections Maintained 35 USC § 112 The following is a quotation of 35 U.S.C. 112(b): (b) CONCLUSION.—The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the inventor or a joint inventor regards as the invention. The following is a quotation of 35 U.S.C. 112 (pre-AIA ), second paragraph: The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the applicant regards as his invention. Claim 6 is rejected under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter which the inventor or a joint inventor (or for applications subject to pre-AIA 35 U.S.C. 112, the applicant), regards as the invention. Regarding claim 6, the phrase "such as" renders the claim indefinite because it is unclear whether the limitations following the phrase are part of the claimed invention. See MPEP § 2173.05(d). Applicant indicated that said claim was amended to remove the phrase “such as”. To date no such amendment has been made. New Grounds of Rejection 35 USC § 112 The following is a quotation of 35 U.S.C. 112(b): (b) CONCLUSION.—The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the inventor or a joint inventor regards as the invention. The following is a quotation of 35 U.S.C. 112 (pre-AIA ), second paragraph: The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the applicant regards as his invention. Claims 38-40 are rejected under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter which the inventor or a joint inventor (or for applications subject to pre-AIA 35 U.S.C. 112, the applicant), regards as the invention. Claim 38 is rendered vague and indefinite by the use of the phrase “…the sequence identity is at least 75%..”. It is unclear whether said phrase is referring to the polypeptide of section “c)” or section “d)” of claim 1. Consequently, it is impossible to determine the metes and bounds of the claimed invention. Claim 39 is rendered vague and indefinite by the use of the phrase “…the sequence identity is at least 80%..”. It is unclear whether said phrase is referring to the polypeptide of section “c)” or section “d)” of claim 1. Consequently, it is impossible to determine the metes and bounds of the claimed invention. Claim 0is rendered vague and indefinite by the use of the phrase “…the sequence identity is at least 90%..”. It is unclear whether said phrase is referring to the polypeptide of section “c)” or section “d)” of claim 1. Consequently, it is impossible to determine the metes and bounds of the claimed invention. 35 USC § 102 In the event the determination of the status of the application as subject to AIA 35 U.S.C. 102 and 103 (or as subject to pre-AIA 35 U.S.C. 102 and 103) is incorrect, any correction of the statutory basis for the rejection will not be considered a new ground of rejection if the prior art relied upon, and the rationale supporting the rejection, would be the same under either status. The following is a quotation of the appropriate paragraphs of 35 U.S.C. 102 that form the basis for the rejections under this section made in this Office action: A person shall be entitled to a patent unless – (a)(1) the claimed invention was patented, described in a printed publication, or in public use, on sale or otherwise available to the public before the effective filing date of the claimed invention. Claims 1-5, 29 and 38-40 are rejected under 35 U.S.C. 102(a)(1) as being anticipated by Rubenfield et al. (U.S. Patent 6,551,795 – IDS filed on 7-9-2024). Rubenfield et al. disclose a polypeptide with 97.4% sequence identity to amino acids 1-1355 of the PA0931 protein (SEQ ID NO:29)[see SEQ ID NO:21919 and the alignment below]. Rubenfield et al. further disclose that their polypeptides can be used as human vaccines against Pseudomonas aeruginosa (see column 10, lines 18-26) or for the production of antibodies (see column 8, lines 52-60). Finally, Rubenfield et al. disclose that their vaccine compositions can comprise a pharmaceutical carrier (see column 38, lines 54-58) and/ or an adjuvant (see column 39, lines 2-3); the adjuvant can be aluminum hydroxide (see column 39, lines 25-26) or cholera toxin (see column 39, lines 51-52); and that their polypeptides can be in the form of a fusion protein (see column 39, lines 61-62). Consequently, Rubenfield et al. anticipates all the limitations of the rejected claims. RESULT 2 DE Pseudomonas aeruginosa polypeptide #5348. XX KW Bacterial infection; Pseudomonas aeruginosa infection; antibacterial. XX OS Pseudomonas aeruginosa. XX CC PN US6551795-B1. XX CC PD 22-APR-2003. XX CC PA (GENO-) GENOME THERAPEUTICS CORP. XX CC PI Rubenfield MJ, Nolling J, Deloughery C, Bush D; XX CC PS Disclosure; SEQ ID NO 21919; 455pp; English. XX SQ Sequence 1385 AA; Query Match 97.4%; Score 6477.5; Length 1385; Best Local Similarity 97.4%; Matches 1321; Conservative 12; Mismatches 22; Indels 1; Gaps 1; Qy 1 MDIRSPLNQCIALSLAGILFLNPIVAAAAGLALDKAAGGNTGLGQAGNGVPIVNIATPND 60 ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 29 MDIRSPLNQCIALSLAGILFLNPIVAAAAGLALDKAAGGNTGLGQAGNGVPIVNIATPNG 88 Qy 61 AGLSNNHFRDYNVGANGLILNNATGKTQGTQLGGIILGNPNLKGQAAQVILNQVTGGNRS 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 89 AGLSNNHFRDYNVGANGLILNNATGKTQGTQLGGIILGNPNLKGQAAQVILNQVTGGNRS 148 Qy 121 TLAGYTEVAGQSARVIVANPHGITCQGCGFINTPRATLTTGKPIMDGQRLERFQVDGGDI 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 149 TLAGYTEVAGQSARVIVANPHGITCQGCGFINTPRATLTTGKPIMDGQRLERFQVDGGDI 208 Qy 181 VVEGAELNVGNLEQFDLITRSAKLNAKLYAKNLNIVTGRNDVQADSLQATPRAADGSEKP 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 209 VVEGAELNVGNLEQFDLITRSAKLNAKLYAKNLNIVTGRNDVQADSLQATPRAADGSEKP 268 Qy 241 QLAIDSSALGGMYAGAIRLVGTEQGVGVRLAGDMAASGGDIRIDASGKLSLAQASSQGDL 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 269 QLAIDSSALGGMYAGAIRLVGTEQGVGVRLAGDMAASGGDIRIDASGKLSLAQASSQGDL 328 Qy 301 KIAAQAVELNGKTYAGGSAEIRSAEELVNRQSLAARERIVLEAAHIDNAGVIEAGVEPDE 360 ||||||||||||||||||||||||||||||||||||||| |:|| :|||||||||||||| Db 329 KIAAQAVELNGKTYAGGSAEIRSAEELVNRQSLAARERIALDAARLDNAGVIEAGVEPDE 388 Qy 361 RRNARGDLELRSGTLRNAGSLVASRALEAKASQALDNQGGSLKGATVRVDAGHLDNRGGK 420 |||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||| Db 389 RRNARGDLELRSGTLRNAGSLVASRALEAKASQALDNQGGSLKGATVRVDGGHLDNRGGK 448 Qy 421 LLAEGELRVEASSLDNRQDGLLQSRDRAVVKTRGDLDNRGGQVIGLNDLEVGAATLDNGQ 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 449 LLAEGELRVEASSLDNRQDGLLQSRDRAVVKTRGDLDNRGGQVIGLNDLEVGAATLDNGQ 508 Qy 481 QGLLGSQQSTRVSAQALVNRGDGEVSGKRVEARVGSLDNRGGKLIGDDLLVVASGAIDNR 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 509 QGLLGSQQSTRVSAQALVNRGDGEVSGKRVEARVGSLDNRGGKLIGDDLLVVASGAIDNR 568 Qy 541 LGLFSAANRLDLRARSLDNSGKGTLSSRGGLEVSLGGLLDNRDEGNLLSQGAQRVTVGQL 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 569 LGLFSAANRLDLRARSLDNSGKGTLSSRGGLEVSLGGLLDNRDEGNLLSQGAQRVTVGQL 628 Qy 601 DNRAGGLLSSRSELNVHGASLDNRGGVLVADAGLSATGGAFDNRDGGSASGKAGVRVEVA 660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 629 DNRAGGLLSSRSELNVHGASLDNRGGVLVADAGLSATGGAFDNRDGGSASGKAGVRVEVA 688 Qy 661 SLRNDQGGKLLSDGRLDLAANAVGNAGGRIAAKGDLQATLGSLAQQGGELVSEKTLKVAA 720 |||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||| Db 689 SLRNDQGGKLFSDGRLDLAANAVGNAGGRIAAKGDLQATLGSLAQQGGELVSEKTLKVAA 748 Qy 721 DTLDNSQSGLIAANGGIAIEARQVDNRAGEISSTSKVAVNAREQLDNRGGKVIGDSGLRL 780 ||:||||| ||||||||||||||||||||||||||||||||||||||||||||||||||| Db 749 DTIDNSQSWLIAANGGIAIEARQVDNRAGEISSTSKVAVNAREQLDNRGGKVIGDSGLRL 808 Qy 781 TVQRLLNQAKGVLAGRDGLSLDGGELFNGDGGRLDSQNSLSVSLGGVLDNQGGALVSEGS 840 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 809 TVQRLLNQAKGVLAGRDGLSLDGGELFNGDGGRLDSQNSLSVSLGGVLDNQGGALVSEGS 868 Qy 841 LTARAARLDNRGGTFSSAGALALTSQAALDNQGGRLLSDAGVTLQGASLDNSRSGVISAK 900 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 869 LTARAARLDNRGGTFSSAGALALTSQAALDNQGGRLLSDAGVTLQGASLDNSRSGVISAK 928 Qy 901 GAVDIRTGVLDNSRNGGIGSNAGITLVAARLDNGQQGRVSAKGLLDANLKGLDQRGGGVL 960 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 929 GAVDIRTGVLDNSRNGGIGSNAGITLVAARLDNGQQGRVSAKGLLDANLKGLDQRGGGVL 988 Qy 961 ISETGVTLDLNGGTLVNRDGGLIATPGALLLRQLGAVDNGAGGEISSDRAFTLAAASLDN 1020 :||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 989 VSETGVTLDLNGGTLVNRDGGLIATPGALLLRQLGAVDNGAGGEISSDRAFTLAAASLDN 1048 Qy 1021 RGGRLIGAANLTLRIAQALDNSLAGVISGAAGLDIAAARLDNSAKGTLASRAGIDLRVDG 1080 |||||||||:|||||||||||||||||||||||||||||||||||||||||||||||||| Db 1049 RGGRLIGAASLTLRIAQALDNSLAGVISGAAGLDIAAARLDNSAKGTLASRAGIDLRVDG 1108 Qy 1081 ALDNHAEGTVSGARLTLASASLDNSGKGLLSGNAGLSVATGALDNAEGGQLISQGVLDVS 1140 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1109 ALDNHAEGTVSGARLTLASASLDNSGKGLLSGNAGLSVATGALDNAEGGQLISQGVLDVS 1168 Qy 1141 SADLDNRGGALSGKQSLRLSAANLDNRGGLLTSDGELELTAGRVDSADGGEISARGDLRL 1200 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1169 SADLDNRGGALSGKQSLRLSAANLDNRGGLLTSDGELELTAGRVDSADGGEISARGDLRL 1228 Qy 1201 TVERLVQRQGRLVGERGVSLDLRGGDLDNQGGLISARGPLSIERLSVLDNRQGGEISSQQ 1260 |||||||||||||||||||||||||||||||||||||||||||||:|||||||||||||| Db 1229 TVERLVQRQGRLVGERGVSLDLRGGDLDNQGGLISARGPLSIERLNVLDNRQGGEISSQQ 1288 Qy 1261 GFELLARRIDNGQQGRIISAGKLRLDADALGNAGAGLLSGWQGLT-VTGGSLDNSAGGTL 1319 ||||||||||||||||||||||||||||||||||||||||| | |: : Db 1289 GFELLARRIDNGQQGRIISAGKLRLDADALGNAGAGLLSGWPGPDGDQAGAWTTAPAAPF 1348 Qy 1320 SSKDGELAISLGGALDNHGQGALVSKGAQRIDAASL 1355 ::||||||:|||||||||||| |||||||:||||| Db 1349 RARDGELAITLGGALDNHGQGAWVSKGAQRMDAASL 1384 35 USC § 103 In the event the determination of the status of the application as subject to AIA 35 U.S.C. 102 and 103 (or as subject to pre-AIA 35 U.S.C. 102 and 103) is incorrect, any correction of the statutory basis for the rejection will not be considered a new ground of rejection if the prior art relied upon, and the rationale supporting the rejection, would be the same under either status. The following is a quotation of 35 U.S.C. 103 which forms the basis for all obviousness rejections set forth in this Office action: A patent for a claimed invention may not be obtained, notwithstanding that the claimed invention is not identically disclosed as set forth in section 102, if the differences between the claimed invention and the prior art are such that the claimed invention as a whole would have been obvious before the effective filing date of the claimed invention to a person having ordinary skill in the art to which the claimed invention pertains. Patentability shall not be negated by the manner in which the invention was made. This application currently names joint inventors. In considering patentability of the claims the examiner presumes that the subject matter of the various claims was commonly owned as of the effective filing date of the claimed invention(s) absent any evidence to the contrary. Applicant is advised of the obligation under 37 CFR 1.56 to point out the inventor and effective filing dates of each claim that was not commonly owned as of the effective filing date of the later invention in order for the examiner to consider the applicability of 35 U.S.C. 102(b)(2)(C) for any potential 35 U.S.C. 102(a)(2) prior art against the later invention. Claims 1-6, 29 and 38-40 are rejected under 35 U.S.C. 103 as being unpatentable over Rubenfield et al. (U.S. Patent 6,551,795 – IDS filed on 7-9-2024). Rubenfield et al. disclose a polypeptide with 97.4% sequence identity to amino acids 1-1355 of the PA0931 protein (SEQ ID NO:29)[see SEQ ID NO:21919 and the alignment below]. Rubenfield et al. further disclose that their polypeptides can be used as human vaccines against Pseudomonas aeruginosa (see column 10, lines 18-26) or for the production of antibodies (see column 8, lines 52-60). Finally, Rubenfield et al. disclose that their vaccine compositions can comprise a pharmaceutical carrier (see column 38, lines 54-58) and/ or an adjuvant (see column 39, lines 2-3); the adjuvant can be aluminum hydroxide (see column 39, lines 25-26) or cholera toxin (see column 39, lines 51-52); and that their polypeptides can be in the form of a fusion protein (see column 39, lines 61-62). Rubenfield et al. differs from the instant invention in that they don’t explicitly disclose the use of keyhole limpet hemocyanin, tetanus toxoid or diphtheria toxoid as a carrier protein. The KSR decision sets forth “if a technique has been used to improve one device, and a person of skill in the art would recognize that it would improve similar devices in the same way, using the technique is obvious unless its actual application is beyond that person’s skill”. Given that Rubenfield et al. discloses the use of multiple protein carriers and the use of keyhole limpet hemocyanin, tetanus toxoid or diphtheria toxoid as a carrier protein is well established in the art, the use of keyhole limpet hemocyanin, tetanus toxoid or diphtheria toxoid as a carrier protein for the polypeptides of Rubenfield et al. is well within the capabilities of one of ordinary skill in the art. Hence, the requirements of obviousness under the KSR decision are met. RESULT 2 DE Pseudomonas aeruginosa polypeptide #5348. XX KW Bacterial infection; Pseudomonas aeruginosa infection; antibacterial. XX OS Pseudomonas aeruginosa. XX CC PN US6551795-B1. XX CC PD 22-APR-2003. XX CC PA (GENO-) GENOME THERAPEUTICS CORP. XX CC PI Rubenfield MJ, Nolling J, Deloughery C, Bush D; XX CC PS Disclosure; SEQ ID NO 21919; 455pp; English. XX SQ Sequence 1385 AA; Query Match 97.4%; Score 6477.5; Length 1385; Best Local Similarity 97.4%; Matches 1321; Conservative 12; Mismatches 22; Indels 1; Gaps 1; Qy 1 MDIRSPLNQCIALSLAGILFLNPIVAAAAGLALDKAAGGNTGLGQAGNGVPIVNIATPND 60 ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 29 MDIRSPLNQCIALSLAGILFLNPIVAAAAGLALDKAAGGNTGLGQAGNGVPIVNIATPNG 88 Qy 61 AGLSNNHFRDYNVGANGLILNNATGKTQGTQLGGIILGNPNLKGQAAQVILNQVTGGNRS 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 89 AGLSNNHFRDYNVGANGLILNNATGKTQGTQLGGIILGNPNLKGQAAQVILNQVTGGNRS 148 Qy 121 TLAGYTEVAGQSARVIVANPHGITCQGCGFINTPRATLTTGKPIMDGQRLERFQVDGGDI 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 149 TLAGYTEVAGQSARVIVANPHGITCQGCGFINTPRATLTTGKPIMDGQRLERFQVDGGDI 208 Qy 181 VVEGAELNVGNLEQFDLITRSAKLNAKLYAKNLNIVTGRNDVQADSLQATPRAADGSEKP 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 209 VVEGAELNVGNLEQFDLITRSAKLNAKLYAKNLNIVTGRNDVQADSLQATPRAADGSEKP 268 Qy 241 QLAIDSSALGGMYAGAIRLVGTEQGVGVRLAGDMAASGGDIRIDASGKLSLAQASSQGDL 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 269 QLAIDSSALGGMYAGAIRLVGTEQGVGVRLAGDMAASGGDIRIDASGKLSLAQASSQGDL 328 Qy 301 KIAAQAVELNGKTYAGGSAEIRSAEELVNRQSLAARERIVLEAAHIDNAGVIEAGVEPDE 360 ||||||||||||||||||||||||||||||||||||||| |:|| :|||||||||||||| Db 329 KIAAQAVELNGKTYAGGSAEIRSAEELVNRQSLAARERIALDAARLDNAGVIEAGVEPDE 388 Qy 361 RRNARGDLELRSGTLRNAGSLVASRALEAKASQALDNQGGSLKGATVRVDAGHLDNRGGK 420 |||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||| Db 389 RRNARGDLELRSGTLRNAGSLVASRALEAKASQALDNQGGSLKGATVRVDGGHLDNRGGK 448 Qy 421 LLAEGELRVEASSLDNRQDGLLQSRDRAVVKTRGDLDNRGGQVIGLNDLEVGAATLDNGQ 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 449 LLAEGELRVEASSLDNRQDGLLQSRDRAVVKTRGDLDNRGGQVIGLNDLEVGAATLDNGQ 508 Qy 481 QGLLGSQQSTRVSAQALVNRGDGEVSGKRVEARVGSLDNRGGKLIGDDLLVVASGAIDNR 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 509 QGLLGSQQSTRVSAQALVNRGDGEVSGKRVEARVGSLDNRGGKLIGDDLLVVASGAIDNR 568 Qy 541 LGLFSAANRLDLRARSLDNSGKGTLSSRGGLEVSLGGLLDNRDEGNLLSQGAQRVTVGQL 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 569 LGLFSAANRLDLRARSLDNSGKGTLSSRGGLEVSLGGLLDNRDEGNLLSQGAQRVTVGQL 628 Qy 601 DNRAGGLLSSRSELNVHGASLDNRGGVLVADAGLSATGGAFDNRDGGSASGKAGVRVEVA 660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 629 DNRAGGLLSSRSELNVHGASLDNRGGVLVADAGLSATGGAFDNRDGGSASGKAGVRVEVA 688 Qy 661 SLRNDQGGKLLSDGRLDLAANAVGNAGGRIAAKGDLQATLGSLAQQGGELVSEKTLKVAA 720 |||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||| Db 689 SLRNDQGGKLFSDGRLDLAANAVGNAGGRIAAKGDLQATLGSLAQQGGELVSEKTLKVAA 748 Qy 721 DTLDNSQSGLIAANGGIAIEARQVDNRAGEISSTSKVAVNAREQLDNRGGKVIGDSGLRL 780 ||:||||| ||||||||||||||||||||||||||||||||||||||||||||||||||| Db 749 DTIDNSQSWLIAANGGIAIEARQVDNRAGEISSTSKVAVNAREQLDNRGGKVIGDSGLRL 808 Qy 781 TVQRLLNQAKGVLAGRDGLSLDGGELFNGDGGRLDSQNSLSVSLGGVLDNQGGALVSEGS 840 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 809 TVQRLLNQAKGVLAGRDGLSLDGGELFNGDGGRLDSQNSLSVSLGGVLDNQGGALVSEGS 868 Qy 841 LTARAARLDNRGGTFSSAGALALTSQAALDNQGGRLLSDAGVTLQGASLDNSRSGVISAK 900 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 869 LTARAARLDNRGGTFSSAGALALTSQAALDNQGGRLLSDAGVTLQGASLDNSRSGVISAK 928 Qy 901 GAVDIRTGVLDNSRNGGIGSNAGITLVAARLDNGQQGRVSAKGLLDANLKGLDQRGGGVL 960 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 929 GAVDIRTGVLDNSRNGGIGSNAGITLVAARLDNGQQGRVSAKGLLDANLKGLDQRGGGVL 988 Qy 961 ISETGVTLDLNGGTLVNRDGGLIATPGALLLRQLGAVDNGAGGEISSDRAFTLAAASLDN 1020 :||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 989 VSETGVTLDLNGGTLVNRDGGLIATPGALLLRQLGAVDNGAGGEISSDRAFTLAAASLDN 1048 Qy 1021 RGGRLIGAANLTLRIAQALDNSLAGVISGAAGLDIAAARLDNSAKGTLASRAGIDLRVDG 1080 |||||||||:|||||||||||||||||||||||||||||||||||||||||||||||||| Db 1049 RGGRLIGAASLTLRIAQALDNSLAGVISGAAGLDIAAARLDNSAKGTLASRAGIDLRVDG 1108 Qy 1081 ALDNHAEGTVSGARLTLASASLDNSGKGLLSGNAGLSVATGALDNAEGGQLISQGVLDVS 1140 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1109 ALDNHAEGTVSGARLTLASASLDNSGKGLLSGNAGLSVATGALDNAEGGQLISQGVLDVS 1168 Qy 1141 SADLDNRGGALSGKQSLRLSAANLDNRGGLLTSDGELELTAGRVDSADGGEISARGDLRL 1200 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1169 SADLDNRGGALSGKQSLRLSAANLDNRGGLLTSDGELELTAGRVDSADGGEISARGDLRL 1228 Qy 1201 TVERLVQRQGRLVGERGVSLDLRGGDLDNQGGLISARGPLSIERLSVLDNRQGGEISSQQ 1260 |||||||||||||||||||||||||||||||||||||||||||||:|||||||||||||| Db 1229 TVERLVQRQGRLVGERGVSLDLRGGDLDNQGGLISARGPLSIERLNVLDNRQGGEISSQQ 1288 Qy 1261 GFELLARRIDNGQQGRIISAGKLRLDADALGNAGAGLLSGWQGLT-VTGGSLDNSAGGTL 1319 ||||||||||||||||||||||||||||||||||||||||| | |: : Db 1289 GFELLARRIDNGQQGRIISAGKLRLDADALGNAGAGLLSGWPGPDGDQAGAWTTAPAAPF 1348 Qy 1320 SSKDGELAISLGGALDNHGQGALVSKGAQRIDAASL 1355 ::||||||:|||||||||||| |||||||:||||| Db 1349 RARDGELAITLGGALDNHGQGAWVSKGAQRMDAASL 1384 Conclusion No claim is allowed. Applicant's amendment necessitated the new ground(s) of rejection presented in this Office action. Accordingly, THIS ACTION IS MADE FINAL. See MPEP § 706.07(a). Applicant is reminded of the extension of time policy as set forth in 37 CFR 1.136(a). A shortened statutory period for reply to this final action is set to expire THREE MONTHS from the mailing date of this action. In the event a first reply is filed within TWO MONTHS of the mailing date of this final action and the advisory action is not mailed until after the end of the THREE-MONTH shortened statutory period, then the shortened statutory period will expire on the date the advisory action is mailed, and any nonprovisional extension fee (37 CFR 1.17(a)) pursuant to 37 CFR 1.136(a) will be calculated from the mailing date of the advisory action. In no event, however, will the statutory period for reply expire later than SIX MONTHS from the mailing date of this final action. Any inquiry concerning this communication or earlier communications from the examiner should be directed to ROBERT A ZEMAN whose telephone number is (571)272-0866. The examiner can normally be reached Monday thru Friday; 6:30 am - 3pm EST. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Vanessa Ford can be reached on 571-272-00857. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /ROBERT A ZEMAN/Primary Examiner, Art Unit 1645 November 14, 2025
Read full office action

Prosecution Timeline

Show 1 earlier event
Apr 10, 2025
Non-Final Rejection mailed — §102, §103, §112
Aug 08, 2025
Response Filed
Nov 18, 2025
Final Rejection mailed — §102, §103, §112
Mar 16, 2026
Response after Non-Final Action
Mar 17, 2026
Request for Continued Examination
Mar 18, 2026
Response after Non-Final Action
Mar 24, 2026
Response Filed
Jul 15, 2026
Non-Final Rejection mailed — §102, §103, §112 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12667610
VACCINE COMPOSITION COMPRISING RECOMBINANT PROTEIN OF STAPHYLOCOCCUS AUREUS ATTENUATED ENTEROTOXIN AND CYTOTOXIN
4y 3m to grant Granted Jun 30, 2026
Patent 12667595
COMPOSITION FOR PREVENTING, IMPROVING OR TREATING BENIGN PROSTATIC HYPERPLASIA OR ALOPECIA, COMPRISING HEAT-KILLED PROBIOTICS AS ACTIVE INGREDIENT
3y 4m to grant Granted Jun 30, 2026
Patent 12653878
VACCINE COMPOSITION AGAINST STREPTOCOCCUS SUIS INFECTION
3y 10m to grant Granted Jun 16, 2026
Patent 12638447
Compositions, Methods, and Systems for Detecting Methicillin-Resistant Staphylococcus Aureus
5y 0m to grant Granted May 26, 2026
Patent 12637656
RECOMBINANT YEAST CAPABLE OF PRODUCING CAFFEIC ACID AND/OR FERULIC ACID
4y 0m to grant Granted May 26, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

Strategy Recommendation AI-generated — please review before filing

Get a prosecution strategy drawn from examiner precedents, rejection analysis, and claim mapping.
Typically takes 5-10 seconds — AI-generated, attorney review required before filing

Prosecution Projections

3-4
Expected OA Rounds
54%
Grant Probability
82%
With Interview (+27.9%)
3y 8m (~1y 6m remaining)
Median Time to Grant
High
PTA Risk
Based on 777 resolved cases by this examiner. Grant probability derived from career allowance rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month