Prosecution Insights
Last updated: April 19, 2026
Application No. 18/740,126

METHODS FOR IMPROVING GENOME ENGINEERING AND REGENERATION IN PLANT

Non-Final OA §112§DP
Filed
Jun 11, 2024
Examiner
ZHONG, WAYNESHAOBIN
Art Unit
1662
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Kws Saat SE & Co. Kgaa
OA Round
1 (Non-Final)
72%
Grant Probability
Favorable
1-2
OA Rounds
3y 0m
To Grant
94%
With Interview

Examiner Intelligence

Grants 72% — above average
72%
Career Allow Rate
377 granted / 524 resolved
+11.9% vs TC avg
Strong +22% interview lift
Without
With
+22.3%
Interview Lift
resolved cases with interview
Typical timeline
3y 0m
Avg Prosecution
28 currently pending
Career history
552
Total Applications
across all art units

Statute-Specific Performance

§101
8.0%
-32.0% vs TC avg
§103
29.4%
-10.6% vs TC avg
§102
13.6%
-26.4% vs TC avg
§112
34.3%
-5.7% vs TC avg
Black line = Tech Center average estimate • Based on career data from 524 resolved cases

Office Action

§112 §DP
DETAILED ACTION Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Information Disclosure Statement The Information Disclosure Statements filed on 6/11/2024, 9/24/2024, 12/20/2024, 6/17/2025, 8/29/2025 and 12/29/2025 have been entered and considered. Initialed copies of the form PTO-1449 are enclosed with this action. Status of Claims On 6/11/2024, the applicant amended the claim set. Claims 1-33, 38-41 were canceled. New claims 42-47 were added. In summary, claims 34-37, 42-47 are pending and examined in this office action. Priority Instant application 18740126, filed 06/11/2024, is a Divisional of 17251633, filed 12/11/2020, now U.S. Patent # 12043837. 17251633 is a National Stage entry of PCT/EP2019/065645, International Filing Date: 06/14/2019. PCT/EP2019/065645 claims Priority from Provisional Application 62728445, filed 09/07/2018. PCT/EP2019/065645 claims Priority from Provisional Application 62685626, filed 06/15/2018. 62685626 did not disclose the claimed SEQ ID NOS. Thus, the prior date of 06/15/2018 is not recognized. 62728445 disclosed the claimed subject matter including the SEQ ID NOS. Thus, the prior date of 09/07/2018 is recognized. Claim Objections Claim 34 (and dependent claims 35-37, 42-47) are objected for informality: Claim 34 recites “A microparticle coated with a coating comprising: a); b); c); d); e); or f)”. In view of the specification (p24, last para), the term "particle bombardment" as used herein, also named "biolistic transfection" or "microparticle-mediated gene transfer" refers to a physical delivery method for transferring a coated microparticle or nanoparticle comprising boost genes, booster polypeptides, genome engineering components, and/or transgenes into a target cell or tissue, and the specification (p50, 3rd para), Microparticles In another aspect is provided a microparticle coated with at least one of the above booster polypeptides, nucleic acids, recombinant genes or DNA constructs. In some embodiments, the microparticle is further coated with a genome engineering component. Accordingly, in view of the specification, a); b); c); d); e); or f) refers to a coating component, not microparticle coated with a coating. Thus, rejection for indefiniteness is not made. However, it is suggested to amend the claim from “A microparticle coated with a coating comprising: a); b); c); d); e); or f)” to -- A microparticle coated with a coating, the coating comprising: a); b); c); d); e); or f) --, for being full, clear, and exact. See the requirement of 37 CFR 1.71(a) for “full, clear, and exact terms”. Appropriate correction is required. Claim Rejections - 35 USC § 112 Indefiniteness The following is a quotation of 35 U.S.C. 112(b): (b) CONCLUSION—The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the inventor or a joint inventor regards as the invention. Claims 36-37 are rejected under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter which the inventor or a joint inventor, or for pre-AIA the applicant regards as the invention. The claims recite “means for coating the microparticles”. According to MPEP 2173.05(g), “means for” invokes 35 USC 112(f): means plus function format, where “means for” acts as a generic placeholder for a function, not a specific structure. The specific structural definition or clarification in the specification is required for it to be definite. “A functional limitation must be evaluated and considered, just like any other limitation of the claim, for what it fairly conveys to a person of ordinary skill in the pertinent art in the context in which it is used. A functional limitation is often used in association with an element, ingredient, or step of a process to define a particular capability or purpose that is served by the recited element, ingredient or step.” If the specification does not clearly provide corresponding structure for that function, making it definite by linking it to specific, known components or algorithms, the use of "means for" without sufficient structural disclosure is an example of functional claiming as indefinite. “Notwithstanding the permissible instances, the use of functional language in a claim may fail “to provide a clear-cut indication of the scope of the subject matter embraced by the claim” and thus be indefinite.” In this particular case, the claim does not recite any element, ingredient or step of “means for”. Additionally and critically, the specification does not define “means for”. In fact, the term “means for” appears in the specification 5 times, which merely repeats the claim language. Accordingly, one skill in the art does not know the clear-cut indication of the scope of the subject matter embraced by the claim. In addition, claim 34 (I) recites “one or more microparticles”. It is unclear one or more microparticles of what, the microparticle of claim 34 or something else? Furthermore, claim 34 recites “a microparticle”, not “microparticles”. Thus, claim 36 does not have sufficient antecedent base in claim 34. Appropriate corrections are required. Note: the correction should be supported by the instant specification, and should not have new matter. Double Patenting The nonstatutory double patenting rejection is based on a judicially created doctrine grounded in public policy (a policy reflected in the statute) so as to prevent the unjustified or improper timewise extension of the “right to exclude” granted by a patent and to prevent possible harassment by multiple assignees. A nonstatutory double patenting rejection is appropriate where the claims at issue are not identical, but at least one examined application claim is not patentably distinct from the reference claim(s) because the examined application claim is either anticipated by, or would have been obvious over, the reference claim(s). See, e.g., In re Berg, 140 F.3d 1428, 46 USPQ2d 1226 (Fed. Cir. 1998); In re Goodman, 11 F.3d 1046, 29 USPQ2d 2010 (Fed. Cir. 1993); In re Longi, 759 F.2d 887, 225 USPQ 645 (Fed. Cir. 1985); In re Van Ornum, 686 F.2d 937, 214 USPQ 761 (CCPA 1982); In re Vogel, 422 F.2d 438, 164 USPQ 619 (CCPA 1970); and In re Thorington, 418 F.2d 528, 163 USPQ 644 (CCPA 1969). A timely filed terminal disclaimer in compliance with 37 CFR 1.321(c) or 1.321(d) may be used to overcome an actual or provisional rejection based on a nonstatutory double patenting ground provided the reference application or patent either is shown to be commonly owned with this application, or claims an invention made as a result of activities undertaken within the scope of a joint research agreement. A terminal disclaimer must be signed in compliance with 37 CFR 1.321(b). The USPTO internet Web site contains terminal disclaimer forms which may be used. Please visit http://www.uspto.gov/forms/. The filing date of the application will determine what form should be used. A web-based eTerminal Disclaimer may be filled out completely online using web-screens. An eTerminal Disclaimer that meets all requirements is auto-processed and approved immediately upon submission. For more information about eTerminal Disclaimers, refer to http://www.uspto.gov/patents/process/file/efs/guidance/eTD-info-I.jsp. Claims 34-37, 42-47 are rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1-7 of US Patent 12043837. The US Patent and instant application share inventor Meng Ling KWS SAAT SE & CO. KGAA is the applicant of both US Patent and instant application. The USP claims: Claim 1 (reference claim). A booster polypeptide comprising an amino acid sequence of SEQ ID NO: 2 or 48, or an amino acid sequence at least 93% identical to SEQ ID NO: 2 or 48. By the examiner’s sequence alignment and sequence search, SEQ ID NO: 2 is identical in the US Patent and in instant application. SEQ ID NO: 48 is also identical in the US Patent and in instant application. See “Sequence Matches” at the end of office action. Claim 34 recites “a) a booster polypeptide comprising the amino acid sequence of SEQ ID NO: 2 or 48, or an amino acid sequence at least 93% identical to SEQ ID NO: 2 or 48” as an option, the reference claim 1 teach the limitation of instant claim 34, except as a coating. Reference claims 2-3 teach the nucleic acids encoding SEQ ID NO: 2 or 48 including SEQ ID NOs: 1 and 47. Reference claims 4-6 recite a recombinant gene comprising the nucleic acids, reference claim 7 recite a DNA construct. Thus, the above reference claims additionally teach instant claim 34, except as a coating. According to the specification, the terms "booster", "booster gene", "booster polypeptide", "boost polypeptide", "boost gene" and "boost factor" refer to a protein/peptide(s) or a (poly)nucleic acid fragment encoding the protein/polypeptide causing improved genome engineering and/or improved plant regeneration of transformed or gene edited plant cells. According to the specification (p60, 1st para) and general knowledge in prior art, WUSCHEL (WUS) is a transcript factor involving regeneration. The specification does not define “coated”. In view of the specification (p24, last para), the term "particle bombardment" as used herein, also named "biolistic transfection" or "microparticle-mediated gene transfer" refers to a physical delivery method for transferring a coated microparticle comprising boost genes, booster polypeptides, genome engineering components, and/or transgenes into a target cell or tissue. Thus, in view of the specification, coated refers to being a part of the components to be bombarded into cells. For example, Ikeda et al (Arabidopsis WUSCHEL Is a Bifunctional Transcription Factor That Acts as a Repressor in Stem Cell Regulation and as an Activator in Floral Patterning. The Plant Cell, Vol. 21: 3493–3505, 2009) teach introducing WUSCHEL (WUS) into plant cells by particle bombardment (p3504, left col, 1st para), and the advantage/motivation of such introduction (whole page 3493). Thus, a booster/regeneration factor to serve as a coating for bombardment had been obvious to one ordinary skill in the art. Thus, the subject matter of claim 34 is deemed obvious over the USP in view of Ikeda et al. Regarding instant dependent claims, according to the specification (p6, last para; p7 1st to 2nd para), genome engineering components include endonuclease like Cas, ZFN or TAL. Bortesi et al (The CRISPR/Cas9 system for plant genome editing and beyond. Biotechnology Advances 33, p41–52, 2015) cite multiple references teaching and demonstrating using particle bombardment to deliver genes of interests and Crispr-Cas (genome engineer component) into plant cells (p45, Table 2; p46, Table 3). Bortesi et al teach the advantage/motivation of introducing Cas into plant cells (p41, Abstract). Thus, claims 35-37 are deemed obvious over the USP in view of Bortesi et al. Li et al (Plant-Specific Histone Deacetylases HDT1/2 Regulate GIBBERELLIN 2-OXIDASE2 Expression to Control Arabidopsis Root Meristem Cell Number. The Plant Cell, Vol. 29: 2183–2196, 2017) teach introducing trichostatin A (TSA) into plant cells and the advantage thereof (p2191, left col, last para; right col, 1st para). He et al (Regulation and function of DNA methylation in plants and Animals. Cell Research. 21:442-465, 2011) teach inhibiting DNA methylation and the mechanism and advantage thereof (whole article). Thus, claims 42-45 are deemed obvious over the USP in view of Li et al and He et al. Ma et al (Comprehensive insights on how 2,4-dichlorophenoxyacetic acid retards senescence in post-harvest citrus fruits using transcriptomic and proteomic approaches. Journal of Experimental Botany, Vol. 65, No. 1, pp. 61–74, 2014) teach introducing 2,4-D into plant cells and the advantage thereof (whole article). Thus, claims 46-47 are deemed obvious over the USP in view of Ma et al. Therefore, reference and instant claims are obvious over each other in view of the cited prior art. Claims 34-37, 42-47 are rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1, 3, 6 of US Patent 12146142. The US Patent and instant application share inventor Meng Ling. KWS SAAT SE & CO. KGAA is the applicant of both US Patent and instant application. The USP claims: Claim 1. A method for genetic modification in a plant cell, the method comprising (a) introducing into the plant cell (i) a component selected from the group consisting of: (i.a) a nucleic acid encoding a second booster polypeptide and a third booster polypeptide, wherein the second booster polypeptide comprises the amino acid sequence of SEQ ID NO: 4, 6 or 8, or an amino acid sequence at least 95% identical to SEQ ID NO: 4, 6 or 8, and wherein the third booster polypeptide comprises the amino acid sequence of SEQ ID NO: 16, or an amino acid sequence at least 95% identical to SEQ ID NO: 16, and wherein upon translation of the third booster polypeptide the expression of a first booster polypeptide is activated; wherein the first booster polypeptide comprises the amino acid sequence of SEQ ID NO: 2, or an amino acid sequence at least 95% identical to SEQ ID NO: 2; or (i.b1) a nucleic acid encoding the first booster polypeptide; a recombinant gene comprising the nucleic acid encoding the first booster polypeptide operably linked to a promoter, a vector, comprising the nucleic acid encoding the first booster polypeptide; and (i.b2) a nucleic acid encoding the second booster polypeptide; or (i.c1) a nucleic acid encoding a site-directed transcriptional activator suitable to increase transiently the expression of the first booster polypeptide, or a site-directed transcriptional activator suitable to increase transiently the expression of the first booster polypeptide; wherein the nucleic acid encoding the first booster polypeptide is an endogenous nucleic acid; and (i.c2) a nucleic acid encoding a site-directed transcriptional activator suitable to increase transiently the expression of the second booster polypeptide or a site-directed transcriptional activator suitable to increase transiently the expression of the second booster polypeptide; wherein the nucleic acid encoding the first booster polypeptide is an endogenous nucleic acid; or (i.d) a combination of (i.b1) and (i.c2), or (i.b2) and (i.c1); wherein the nucleic acid encoding the first booster polypeptide is operably linked to a native promoter or a first heterologous promoter and the nucleic acid encoding the second booster polypeptide is operably linked to the native promoter or a second heterologous promoter; or wherein the nucleic acid encoding the first booster polypeptide and the nucleic acid encoding the second booster polypeptide are operably linked to one heterologous promoter; or wherein the nucleic acid encoding the second booster polypeptide is operably linked to the native promoter or a first heterologous promoter and the nucleic acid encoding the third booster polypeptide is operably linked to the native promoter or a second heterologous promoter; or wherein the nucleic acid encoding the second booster polypeptide and the nucleic acid encoding the third booster polypeptide are operably linked to one heterologous promoter; and (ii) a transgene of interest and/or a genome engineering component; (b) optionally, cultivating the plant cell under conditions allowing the translation of the first and the second booster polypeptides, wherein the translation is increased compared to a plant cell in which (i.a), (i.b1) and (i.b2), (i.c1) and (i.c2), or (i.d) is/are not been introduced; (c) optionally, cultivating the plant cell under conditions allowing the genetic modification of the genome of said plant cell by integration of the transgene of interest or by activity of the genome engineering component in the presence of the booster polypeptides; and (d) regenerating a plant from the plant cell, wherein efficiency of plant regeneration or regeneration ability is improved relative to a plant cell in which (i.a), (i.b1) and (i.b2), (i.c1) and (i.c2), or (i.d) is/are not been introduced; or the method comprising (a) introducing into the plant cell (ii) a component selected from the group consisting of: (i.a) a nucleic acid, the nucleic acid encoding a second booster polypeptide and a third booster polypeptide, wherein the second booster polypeptide comprises the amino acid sequence of SEQ ID NO: 4, 6 or 8, or an amino acid sequence at least 95% identical to SEQ ID NO: 4, 6 or 8, and wherein the third booster polypeptide comprises the amino acid sequence of SEQ ID NO: 16, or an amino acid sequence at least 95% identical to SEQ ID NO: 16, and wherein upon translation of the third booster polypeptide the expression of a first booster polypeptide is activated; wherein the first booster polypeptide comprises the amino acid sequence of SEQ ID NO: 2, or an amino acid sequence at least 95% identical to SEQ ID NO: 2; or (i.b1) a nucleic acid encoding the third booster polypeptide; a recombinant gene comprising the nucleic acid encoding the third booster polypeptide, operably linked to a promoter, a vector, comprising the nucleic acid encoding the third booster polypeptide, or the third booster polypeptide; and (i.b2) a nucleic acid encoding the second booster polypeptide; a recombinant gene comprising the nucleic acid encoding the second booster polypeptide, operably linked to a promoter, or a vector, comprising the nucleic acid encoding the second booster polypeptide, or the second booster polypeptide; or (i.c1) a nucleic acid encoding a site-directed transcriptional activator suitable to increase transiently the expression of the third booster polypeptide, or a site-directed transcriptional activator suitable to increase transiently the expression of the third booster polypeptide; wherein the nucleic acid encoding the third booster polypeptide is an endogenous nucleic acid; and (i.c2) a nucleic acid encoding a site-directed transcriptional activator suitable to increase transiently the expression of the second booster polypeptide or a site-directed transcriptional activator suitable to increase transiently the expression of the second booster polypeptide; wherein the nucleic acid encoding the second booster polypeptide is an endogenous nucleic acid; or (i.d) a combination of (i.b1) and (i.c2), or (i.b2) and (i.c1), wherein the nucleic acid encoding the first booster polypeptide is operably linked to a native promoter or a first heterologous promoter and the nucleic acid encoding the second booster polypeptide is operably linked to the native promoter or a second heterologous promoter; or wherein the nucleic acid encoding the first booster polypeptide and the nucleic acid encoding the second booster polypeptide are operably linked to one heterologous promoter; or wherein the nucleic acid encoding the second booster polypeptide is operably linked to the native promoter or a first heterologous promoter and the nucleic acid encoding the third booster polypeptide is operably linked to the native promoter or a second heterologous promoter; or wherein the nucleic acid encoding the second booster polypeptide and the nucleic acid encoding the third booster polypeptide are operably linked to one heterologous promoter; and (iii) a transgene of interest and/or a genome engineering component; (b) optionally, cultivating the plant cell under conditions allowing the translation of the third and the second booster polypeptides, wherein the translation is increased compared to a plant cell in which (i.a), (i.b1) and (i.b2), (i.c1) and (i.c2), or (i.d) is/are not been introduced; (e) optionally, cultivating the plant cell under conditions allowing the genetic modification of the genome of said plant cell by integration of the transgene of interest or by activity of the genome engineering component in the presence of the booster polypeptides; and (c) regenerating a plant from the plant cell, wherein efficiency of plant regeneration or regeneration ability is improved relative to a plant cell in which (i.a), (i.b1) and (i.b2), (i.c1) and (i.c2), or (i.d) is/are not been introduced. Claim 3. The method of claim 1, wherein in step (i) one or more additional components are introduced into the plant cell, the one or more additional components comprising: one or more polypeptides selected from the group consisting of a PLETHORA 5 (PLT5) polypeptide, a KWS Regeneration Boost Protein 1 (KWS-RBP1) polypeptide, an RWP-RK Domain containing factor 4 (RKD4) polypeptide, and an RWP-RK Domain containing factor 2 (RKD2) polypeptide, and/or one or more nucleic acids selected from the group consisting of a nucleic acid encoding a PLT5 polypeptide, a KWS-RBP1 polypeptide, an RKD4 polypeptide, and an RKD2 polypeptide, and/or one or more site-directed transcriptional activators suitable to increase transiently the expression of an endogenous PLT5 polypeptide, an endogenous RKD4 polypeptide, or an endogenous RKD2 polypeptide, and/or a nucleic acid encoding such site-directed transcriptional activator. Claim 6. The method of claim 3, wherein the PLT5 polypeptide comprises the amino acid sequence of SEQ ID NO: 10 or 12, or an amino acid sequence at least 95% identical to SEQ ID NO: 10 or 12; or wherein the nucleic acid encoding the PLT5 polypeptide encodes the amino acid sequence of SEQ ID NO: 10 or 12, or an amino acid sequence at least 95% identical to SEQ ID NO: 10 or 12; or wherein the KWS-RBP1 polypeptide comprises the amino acid sequence of SEQ ID NO: 14, or an amino acid sequence at least 95% identical to SEQ ID NO: 14; or wherein the nucleic acid encoding the KWS-RBP1 polypeptide encodes the amino acid sequence of SEQ ID NO: 14, or an amino acid sequence at least 95% identical to SEQ ID NO: 14; or wherein the KWS-RBP2 polypeptide comprises the amino acid sequence of SEQ ID NO: 50, or an amino acid sequence at least 95% identical to SEQ ID NO: or wherein the nucleic acid encoding the KWS-RBP2 polypeptide encodes the amino acid sequence of SEQ ID NO: 50, or an amino acid sequence at least 95% identical to SEQ ID NO: or wherein the RKD4 polypeptide comprises the amino acid sequence of SEQ ID NO: 16, 18 or 20, or an amino acid sequence at least 95% identical to SEQ ID NO: 16, 18 or 20; or wherein the nucleic acid encoding the RKD4 polypeptide encodes the amino acid sequence of SEQ ID NO: 16, 18 or 20, or an amino acid sequence at least 95% identical to SEQ ID NO: 16, 18 or 20; or wherein the RKD2 polypeptide comprises the amino acid sequence of SEQ ID NO: 22, 24 or 26, or an amino acid sequence at least 95% identical to SEQ ID NO: 22, 24 or 26; or wherein the nucleic acid encoding the RKD2 polypeptide encodes the amino acid sequence of SEQ ID NO: 22, 24 or 26, or an amino acid sequence at least 95% identical to SEQ ID NO: 22, 24 or 26. Although the claims at issue are not identical, they are not patentably distinct from each other because: US Patent claim 6 depends on claims 3 and 1, and recites using a booster peptide of SEQ ID NO: 14, or at least 95% identical to SEQ ID NO: 14, in combination with the sequences of claims 1 and 3. By sequence search, US Patent SEQ ID NO: 14 is 100% identical to instant SEQ ID NO: 2 and 94% identical to instant SEQ ID NO: 48: US Patent SEQ ID NO: 14 against instant SEQ ID NO: 2 Query Match 100.0%; Score 1361; Length 260; Best Local Similarity 100.0%; Matches 260; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MESGSGTAAGSGYVYRQPGSTRWNPTAEQLSLLREIYYRNGLRTPTADEIRQISSKLSRY 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MESGSGTAAGSGYVYRQPGSTRWNPTAEQLSLLREIYYRNGLRTPTADEIRQISSKLSRY 60 Qy 61 GKIEGKNVYNWFQNRRAREKRKQRLSTIGCDPALIEMGNVASLEFGTESALESLSSGPSS 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 GKIEGKNVYNWFQNRRAREKRKQRLSTIGCDPALIEMGNVASLEFGTESALESLSSGPSS 120 Qy 121 ELREAPTRKFYEKKTVGENSTIINPVEQNCTLSCGTSQEFQYAVDSRRVMKAMEEKQATD 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 ELREAPTRKFYEKKTVGENSTIINPVEQNCTLSCGTSQEFQYAVDSRRVMKAMEEKQATD 180 Qy 181 DEPDGNKWTESNRHVKILQLFPLHNNEDQTLIKSDKEIYCLGSCEKKMDLSPLGHSGSQR 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 DEPDGNKWTESNRHVKILQLFPLHNNEDQTLIKSDKEIYCLGSCEKKMDLSPLGHSGSQR 240 Qy 241 ASALDLCLSLGNESCGLHDN 260 |||||||||||||||||||| Db 241 ASALDLCLSLGNESCGLHDN 260 DUPLICATES: US-17-251-674A-14 Filing date in PALM: 2020-12-11 Sequence 14, US/17251674A Patent No. 12146142 GENERAL INFORMATION APPLICANT: KWS SAAT SE & CO. KGAA TITLE OF INVENTION: METHODS FOR IMPROVING GENOME ENGINEERING AND REGENERATION IN TITLE OF INVENTION: PLANT II FILE REFERENCE: 245761.000134 CURRENT APPLICATION NUMBER: US/17/251,674A CURRENT FILING DATE: 2020-12-11 PRIOR APPLICATION NUMBER: PCT/EP2019/065647 PRIOR FILING DATE: 2019-06-14 PRIOR APPLICATION NUMBER: 62/728,401 PRIOR FILING DATE: 2018-09-07 PRIOR APPLICATION NUMBER: 62/685,626 PRIOR FILING DATE: 2018-06-15 NUMBER OF SEQ ID NOS: 52 SEQ ID NO 14 LENGTH: 260 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: protein of KWS_RBP1 US Patent SEQ ID NO: 14 against instant SEQ ID NO: 48 Query Match 94.6%; Score 1290; Length 260; Best Local Similarity 93.1%; Matches 242; Conservative 13; Mismatches 5; Indels 0; Gaps 0; Qy 1 MESGSGTAAGSGYVYRQSGSTRWNPTAEQLSLLKELYYRNGIRTPSADQIRQISARLSRY 60 ||||||||||||||||| |||||||||||||||:|:|||||:|||:||:|||||::|||| Db 1 MESGSGTAAGSGYVYRQPGSTRWNPTAEQLSLLREIYYRNGLRTPTADEIRQISSKLSRY 60 Qy 61 GKIEGKNVFYWFQNHKARERQKKRLSTVGCDPALIEMGNVASLEFGTESALESLSSGPSS 120 ||||||||: |||| :|||::|:||||:|||||||||||||||||||||||||||||||| Db 61 GKIEGKNVYNWFQNRRAREKRKQRLSTIGCDPALIEMGNVASLEFGTESALESLSSGPSS 120 Qy 121 ELREAPTRKFYEKKTVGENSTIINPVEQNCTLSCGTSQEFQYAVDSRRVMKAMEEKQATD 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 ELREAPTRKFYEKKTVGENSTIINPVEQNCTLSCGTSQEFQYAVDSRRVMKAMEEKQATD 180 Qy 181 DEPDGNKWTESNRHVKTLPLFPLHNNEDQTLIKSDKEIYCLGSCEKKMDLSPLGHSGSQR 240 |||||||||||||||| | ||||||||||||||||||||||||||||||||||||||||| Db 181 DEPDGNKWTESNRHVKILQLFPLHNNEDQTLIKSDKEIYCLGSCEKKMDLSPLGHSGSQR 240 Qy 241 ASALDLCLSLGNESCGLHDN 260 |||||||||||||||||||| Db 241 ASALDLCLSLGNESCGLHDN 260 DUPLICATES: US-17-251-674A-14 Filing date in PALM: 2020-12-11 Sequence 14, US/17251674A Patent No. 12146142 GENERAL INFORMATION APPLICANT: KWS SAAT SE & CO. KGAA TITLE OF INVENTION: METHODS FOR IMPROVING GENOME ENGINEERING AND REGENERATION IN TITLE OF INVENTION: PLANT II FILE REFERENCE: 245761.000134 CURRENT APPLICATION NUMBER: US/17/251,674A CURRENT FILING DATE: 2020-12-11 PRIOR APPLICATION NUMBER: PCT/EP2019/065647 PRIOR FILING DATE: 2019-06-14 PRIOR APPLICATION NUMBER: 62/728,401 PRIOR FILING DATE: 2018-09-07 PRIOR APPLICATION NUMBER: 62/685,626 PRIOR FILING DATE: 2018-06-15 NUMBER OF SEQ ID NOS: 52 SEQ ID NO 14 LENGTH: 260 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: protein of KWS_RBP1 Accordingly, the USP claims a method of using instant booster polypeptides SEQ ID NOs: 2 and 48 or 93% identical thereof in a narrower and more specific manner (in combination with other sequences in the USP), except does not teach the booster polypeptides as coating. As analyzed above, for example, Ikeda et al teach introducing WUSCHEL (WUS) into plant cells by particle bombardment, and the advantage/motivation of such introduction. Thus, a booster/regeneration factor to serve as a coating for bombardment had been obvious to one ordinary skill in prior art. Thus, the subject matter of claim 34 is deemed obvious over the USP in view of Ikeda et al. Regarding instant dependent claims, according to the specification (p6, last para; p7 1st to 2nd para), genome engineering components include endonuclease like Cas, ZFN or TAL. As analyzed above, Bortesi et al cite multiple references teaching and demonstrating using particle bombardment to deliver genes of interests and Crispr-Cas (genome engineer component) into plant cells, and the advantage/motivation of introducing Cas into plant cells. Thus, claims 35-37 are deemed obvious over the USP in view of Bortesi et al. As analyzed above, Li et al teach introducing trichostatin A (TSA) into plant cells and the advantage thereof. He et al teach inhibiting DNA methylation and the mechanism and advantage thereof. Thus, claims 42-45 are deemed obvious over the USP in view of Li et al and He et al. As analyzed above, Ma et al teach introducing 2,4-D into plant cells and the advantage thereof. Thus, claims 46-47 are deemed obvious over the USP in view of Ma et al. Therefore, reference and instant claims are obvious over each other in view of the cited prior art. Remarks SEQ ID NOs: 1-2 and 47-48 are synthetic sequences in the sequence listing. Prior art does not teach or suggest any sequence at least 93% identical to instant SEQ ID NO: 2 or 48 (both 260 aa), or any encoding sequence thereof. SEQ ID NOs: 1 and 47, both 783 bp, are one of the encoding sequences, which are not taught or suggested by prior art. Accordingly, no art rejection is made. Closest sequence matches in the art are list in “Sequence Matches” at the end of office action. Sequence Matches Against instant SEQ ID NO: 2 RESULT 1 US-17-251-633A-2 (NOTE: this sequence has 2 duplicates in the database searched. See complete list at the end of this report) Sequence 2, US/17251633A Patent No. 12043837 GENERAL INFORMATION APPLICANT: KWS SAAT SE & CO. KGAA TITLE OF INVENTION: METHODS FOR IMPROVING GENOME ENGINEERING AND REGENERATION IN TITLE OF INVENTION: PLANT FILE REFERENCE: 245761.000133 CURRENT APPLICATION NUMBER: US/17/251,633A CURRENT FILING DATE: 2021-07-06 PRIOR APPLICATION NUMBER: PCT/EP2019/065645 PRIOR FILING DATE: 2019-06-14 PRIOR APPLICATION NUMBER: 62/728,445 PRIOR FILING DATE: 2018-09-07 PRIOR APPLICATION NUMBER: 62/685,626 PRIOR FILING DATE: 2018-06-15 NUMBER OF SEQ ID NOS: 59 SEQ ID NO 2 LENGTH: 260 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: Description of Artificial Sequence: Synthetic polypeptide FEATURE: OTHER INFORMATION: protein of KWS_RBP1 Query Match 100.0%; Score 1361; Length 260; Best Local Similarity 100.0%; Matches 260; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MESGSGTAAGSGYVYRQPGSTRWNPTAEQLSLLREIYYRNGLRTPTADEIRQISSKLSRY 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MESGSGTAAGSGYVYRQPGSTRWNPTAEQLSLLREIYYRNGLRTPTADEIRQISSKLSRY 60 Qy 61 GKIEGKNVYNWFQNRRAREKRKQRLSTIGCDPALIEMGNVASLEFGTESALESLSSGPSS 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 GKIEGKNVYNWFQNRRAREKRKQRLSTIGCDPALIEMGNVASLEFGTESALESLSSGPSS 120 Qy 121 ELREAPTRKFYEKKTVGENSTIINPVEQNCTLSCGTSQEFQYAVDSRRVMKAMEEKQATD 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 ELREAPTRKFYEKKTVGENSTIINPVEQNCTLSCGTSQEFQYAVDSRRVMKAMEEKQATD 180 Qy 181 DEPDGNKWTESNRHVKILQLFPLHNNEDQTLIKSDKEIYCLGSCEKKMDLSPLGHSGSQR 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 DEPDGNKWTESNRHVKILQLFPLHNNEDQTLIKSDKEIYCLGSCEKKMDLSPLGHSGSQR 240 Qy 241 ASALDLCLSLGNESCGLHDN 260 |||||||||||||||||||| Db 241 ASALDLCLSLGNESCGLHDN 260 RESULT 1 C3W871_GINBI ID C3W871_GINBI Unreviewed; 261 AA. AC C3W871; DT 16-JUN-2009, integrated into UniProtKB/TrEMBL. DT 16-JUN-2009, sequence version 1. DT 19-JAN-2022, entry version 38. DE SubName: Full=Putative wuschel homeobox protein WUS {ECO:0000313|EMBL:CAT02906.1}; GN Name=wus {ECO:0000313|EMBL:CAT02906.1}; OS Ginkgo biloba (Ginkgo) (Maidenhair tree). OC Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; OC Spermatophyta; Ginkgoidae; Ginkgoales; Ginkgoaceae; Ginkgo. OX NCBI_TaxID=3311 {ECO:0000313|EMBL:CAT02906.1}; RN [1] {ECO:0000313|EMBL:CAT02906.1} RP NUCLEOTIDE SEQUENCE. RC TISSUE=Vegetative root apices {ECO:0000313|EMBL:CAT02906.1}; RA Nardmann J., Reisewitz P., Werr W.; RT "Discrete shoot and root stem cell maintaining WUS/WOX5 functions are an RT evolutionary innovation of angiosperms."; RL Submitted (DEC-2008) to the EMBL/GenBank/DDBJ databases. CC -!- SUBCELLULAR LOCATION: Nucleus {ECO:0000256|ARBA:ARBA00004123, CC ECO:0000256|PROSITE-ProRule:PRU00108, ECO:0000256|RuleBase:RU000682}. CC -!- SIMILARITY: Belongs to the WUS homeobox family. CC {ECO:0000256|ARBA:ARBA00024040}. CC --------------------------------------------------------------------------- CC Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms CC Distributed under the Creative Commons Attribution (CC BY 4.0) License CC --------------------------------------------------------------------------- DR EMBL; FM882128; CAT02906.1; -; mRNA. DR GO; GO:0005634; C:nucleus; IEA:UniProtKB-SubCell. DR GO; GO:0003677; F:DNA binding; IEA:UniProtKB-UniRule. DR GO; GO:0003700; F:DNA-binding transcription factor activity; IEA:InterPro. DR GO; GO:0099402; P:plant organ development; IEA:InterPro. DR CDD; cd00086; homeodomain; 1. DR InterPro; IPR009057; Homeobox-like_sf. DR InterPro; IPR001356; Homeobox_dom. DR InterPro; IPR044555; WUSCHEL-like. DR PANTHER; PTHR45940; PTHR45940; 1. DR Pfam; PF00046; Homeodomain; 1. DR SMART; SM00389; HOX; 1. DR SUPFAM; SSF46689; SSF46689; 1. DR PROSITE; PS50071; HOMEOBOX_2; 1. PE 2: Evidence at transcript level; KW DNA-binding {ECO:0000256|PROSITE-ProRule:PRU00108, KW ECO:0000256|RuleBase:RU000682}; KW Homeobox {ECO:0000256|PROSITE-ProRule:PRU00108, KW ECO:0000256|RuleBase:RU000682}; KW Nucleus {ECO:0000256|PROSITE-ProRule:PRU00108, KW ECO:0000256|RuleBase:RU000682}. FT DOMAIN 14..80 FT /note="Homeobox" FT /evidence="ECO:0000259|PROSITE:PS50071" FT DNA_BIND 16..81 FT /note="Homeobox" FT /evidence="ECO:0000256|PROSITE-ProRule:PRU00108" SQ SEQUENCE 261 AA; 30366 MW; 96DC2644A82A6790 CRC64; Query Match 71.2%; Score 969.5; DB 103; Length 261; Best Local Similarity 76.9%; Matches 190; Conservative 23; Mismatches 29; Indels 5; Gaps 4; Qy 10 GSGYVYRQPGSTRWNPTAEQLSLLREIYYRNGLRTPTADEIRQISSKLSRYGKIEGKNVY 69 |||||||| | |||||| ||||:| |:|||||:|:|:||:|::|| |||||||||||||: Db 9 GSGYVYRQSG-TRWNPTPEQLSILSELYYRNGIRSPSADQIQRISWKLSRYGKIEGKNVF 67 Qy 70 NWFQNRRAREKRKQRLSTIGCDPALIEMGNVASLEFGTESALESLSSGPS--SELREAPT 127 |||| :|||::|:||| :||||||||||::| ||||:|||||| | |||||| Db 68 YWFQNHKARERQKKRLSMVGCDPALIEMGHIAPLEFGSESALESRCCYPGEFSELREAFI 127 Qy 128 RKFYEKKTVGENSTIINPVEQNCTLSCGTSQEFQYAVDSRRVMKAMEEKQATDDEPDGNK 187 ||||| ||| ||:|| ||||||||||||||||||: ||||| || :|||||||||| Db 128 RKFYE-KTVRENNTIANPVEQNCTLSCGTSQEFQFNVDSRRKTVCMENYEATDDEPDGNK 186 Qy 188 WTESNRHVKILQLFPLHNNEDQTLIKSDKEIYCLGSCEKKMDLSPLGHSGSQRASALDLC 247 |||||||||||||||||||||||||||||||||||||||||||||||| | | ||||| Db 187 WTESNRHVKILQLFPLHNNEDQTLIKSDKEIYCLGSCEKKMDLSPLGH-GHIRKHALDLC 245 Qy 248 LSLGNES 254 |:: ||: Db 246 LNIYNEN 252 Against instant SEQ ID NO: 48 RESULT 1 US-17-251-633A-48 (NOTE: this sequence has 2 duplicates in the database searched. See complete list at the end of this report) Sequence 48, US/17251633A Patent No. 12043837 GENERAL INFORMATION APPLICANT: KWS SAAT SE & CO. KGAA TITLE OF INVENTION: METHODS FOR IMPROVING GENOME ENGINEERING AND REGENERATION IN TITLE OF INVENTION: PLANT FILE REFERENCE: 245761.000133 CURRENT APPLICATION NUMBER: US/17/251,633A CURRENT FILING DATE: 2021-07-06 PRIOR APPLICATION NUMBER: PCT/EP2019/065645 PRIOR FILING DATE: 2019-06-14 PRIOR APPLICATION NUMBER: 62/728,445 PRIOR FILING DATE: 2018-09-07 PRIOR APPLICATION NUMBER: 62/685,626 PRIOR FILING DATE: 2018-06-15 NUMBER OF SEQ ID NOS: 59 SEQ ID NO 48 LENGTH: 260 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: Description of Artificial Sequence: Synthetic polypeptide FEATURE: OTHER INFORMATION: protein of KWS-RBP2 Query Match 100.0%; Score 1363; Length 260; Best Local Similarity 100.0%; Matches 260; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MESGSGTAAGSGYVYRQSGSTRWNPTAEQLSLLKELYYRNGIRTPSADQIRQISARLSRY 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MESGSGTAAGSGYVYRQSGSTRWNPTAEQLSLLKELYYRNGIRTPSADQIRQISARLSRY 60 Qy 61 GKIEGKNVFYWFQNHKARERQKKRLSTVGCDPALIEMGNVASLEFGTESALESLSSGPSS 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 GKIEGKNVFYWFQNHKARERQKKRLSTVGCDPALIEMGNVASLEFGTESALESLSSGPSS 120 Qy 121 ELREAPTRKFYEKKTVGENSTIINPVEQNCTLSCGTSQEFQYAVDSRRVMKAMEEKQATD 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 ELREAPTRKFYEKKTVGENSTIINPVEQNCTLSCGTSQEFQYAVDSRRVMKAMEEKQATD 180 Qy 181 DEPDGNKWTESNRHVKTLPLFPLHNNEDQTLIKSDKEIYCLGSCEKKMDLSPLGHSGSQR 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 DEPDGNKWTESNRHVKTLPLFPLHNNEDQTLIKSDKEIYCLGSCEKKMDLSPLGHSGSQR 240 Qy 241 ASALDLCLSLGNESCGLHDN 260 |||||||||||||||||||| Db 241 ASALDLCLSLGNESCGLHDN 260 LOCUS CAT02906 261 aa linear PLN 01-MAY-2009 DEFINITION putative wuschel homeobox protein WUS [Ginkgo biloba]. ACCESSION CAT02906 VERSION CAT02906.1 DBSOURCE embl accession FM882128.1 KEYWORDS . SOURCE Ginkgo biloba (maidenhair tree) ORGANISM Ginkgo biloba Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Ginkgoidae; Ginkgoales; Ginkgoaceae; Ginkgo. REFERENCE 1 AUTHORS Nardmann,J., Reisewitz,P. and Werr,W. TITLE Discrete shoot and root stem cell maintaining WUS/WOX5 functions are an evolutionary innovation of angiosperms JOURNAL Unpublished REFERENCE 2 (residues 1 to 261) AUTHORS Nardmann,J. TITLE Direct Submission JOURNAL Submitted (02-DEC-2008) Nardmann J., Institut fuer Entwicklungsbiologie, Universitaet zu Koeln, Gyrhofstrasse 17, Koeln, 50931, GERMANY FEATURES Location/Qualifiers source 1..261 /organism="Ginkgo biloba" /db_xref="taxon:3311" /tissue_type="vegetative root apices" Range 1: 8 to 252GenPeptGraphicsNext MatchPrevious Match Alignment statistics for match #1 Score Expect Method Identities Positives Gaps 377 bits(969) 1e-129 Compositional matrix adjust. 200/248(81%) 214/248(86%) 5/248(2%) Query 9 AGSGYVYRQSGSTRWNPTAEQLSLLKELYYRNGIRTPSADQIRQISARLSRYGKIEGKNV 68 GSGYVYRQSG TRWNPT EQLS+L ELYYRNGIR+PSADQI++IS +LSRYGKIEGKNV Sbjct 8 VGSGYVYRQSG-TRWNPTPEQLSILSELYYRNGIRSPSADQIQRISWKLSRYGKIEGKNV 66 Query 69 FYWFQNHKARERQKKRLSTVGCDPALIEMGNVASLEFGTesalesl--ssgpsselREAP 126 FYWFQNHKARERQKKRLS VGCDPALIEMG++A LEFG+ESALES G SELREA Sbjct 67 FYWFQNHKARERQKKRLSMVGCDPALIEMGHIAPLEFGSESALESRCCYPGEFSELREAF 126 Query 127 TRKFYEKKTVGENSTIINPVEQNCTLSCGTSQEFQYAVDSRRVMKAMEEKQATDDEPDGN 186 RKFYEK TV EN+TI NPVEQNCTLSCGTSQEFQ+ VDSRR ME +ATDDEPDGN Sbjct 127 IRKFYEK-TVRENNTIANPVEQNCTLSCGTSQEFQFNVDSRRKTVCMENYEATDDEPDGN 185 Query 187 KWTESNRHVKTLPLFPLHNNEDQTLIKSDKEIYCLGSCEKKMDLSPLGHSGSQRASALDL 246 KWTESNRHVK L LFPLHNNEDQTLIKSDKEIYCLGSCEKKMDLSPLGH G R ALDL Sbjct 186 KWTESNRHVKILQLFPLHNNEDQTLIKSDKEIYCLGSCEKKMDLSPLGH-GHIRKHALDL 244 Query 247 CLSLGNES 254 CL++ NE+ Sbjct 245 CLNIYNEN 252 Against instant SEQ ID NO: 47 RESULT 1 FM882128 LOCUS FM882128 786 bp mRNA linear PLN 01-MAY-2009 DEFINITION Ginkgo biloba mRNA for putative wuschel homeobox protein WUS (wus gene). ACCESSION FM882128 VERSION FM882128.1 KEYWORDS . SOURCE Ginkgo biloba (maidenhair tree) ORGANISM Ginkgo biloba Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Ginkgoidae; Ginkgoales; Ginkgoaceae; Ginkgo. REFERENCE 1 AUTHORS Nardmann,J., Reisewitz,P. and Werr,W. TITLE Discrete shoot and root stem cell maintaining WUS/WOX5 functions are an evolutionary innovation of angiosperms JOURNAL Unpublished REFERENCE 2 (bases 1 to 786) AUTHORS Nardmann,J. TITLE Direct Submission JOURNAL Submitted (02-DEC-2008) Nardmann J., Institut fuer Entwicklungsbiologie, Universitaet zu Koeln, Gyrhofstrasse 17, Koeln, 50931, GERMANY FEATURES Location/Qualifiers source 1..786 /organism="Ginkgo biloba" /mol_type="mRNA" /db_xref="taxon:3311" /tissue_type="vegetative root apices" gene 1..786 /gene="wus" CDS 1..786 /gene="wus" /codon_start=1 /product="putative wuschel homeobox protein WUS" /protein_id="CAT02906.1" /db_xref="GOA:C3W871" /db_xref="InterPro:IPR001356" /db_xref="InterPro:IPR009057" /db_xref="InterPro:IPR012287" /db_xref="UniProtKB/TrEMBL:C3W871" Query Match 37.2%; Score 291.4; DB 443; Length 786; Best Local Similarity 67.3%; Matches 460; Conservative 0; Mismatches 211; Indels 12; Gaps 3; Qy 28 GGGTCTGGTTATGTCTATCGGCAGAGCGGAAGCACCCGGTGGAATCCAACAGCAGAACAG 87 || ||||||||| ||||| ||||||| | ||||| ||||| |||||| | || || Db 25 GGAAGTGGTTATGTATATCGCCAGAGCG---GTACCCGATGGAACCCAACACCGGAGCAA 81 Qy 88 TTGTCGCTGCTCAAGGAACTTTATTACCGGAATGGAATTCGGACACCGTCGGCAGATCAA 147 | | || | ||| | |||||| | ||||||||||| | ||| ||||| ||| Db 82 CTCAGTATACTGAGCGAATTGTATTACAGAAATGGAATTCGTTCCCCGAGTGCAGACCAA 141 Qy 148 ATTAGGCAAATTTCGGCCCGGCTGTCCAGATACGGCAAAATAGAAGGGAAAAACGTCTTT 207 ||| || ||||| |||| | | || || || ||||| || || || || || Db 142 ATTCAGCGCATTTCTTGGAAGCTGAGCCGTTATGGGAAGATAGAGGGAAAGAATGTGTTC 201 Qy 208 TACTGGTTTCAAAATCATAAAGCACGGGAACGGCAGAAGAAAAGACTTTCCACGGTCGGC 267 |||||||| ||||||||||| || | || ||||||||||| | | || ||| || Db 202 TACTGGTTCCAAAATCATAAGGCCAGAGAGAGGCAGAAGAAACGTTTGAGCATGGTTGGG 261 Qy 268 TGCGACCCTGCTCTCATAGAAATGGGTAACGTCGCGAGCTTGGAATTTGGGACCGAAAGC 327 || || || || | || |||||||| || | || || || ||||||| ||| Db 262 TGTGATCCGGCATTGATTGAAATGGGGCACATTGCTCCTTTAGAGTTTGGGAGTGAATCG 321 Qy 328 GCTCTTGAATCTCTCAGCT------CAGGCCCGTCCAGCGAGTTGCGCGAGGCTCCTACC 381 || || ||| ||| |||| | | ||| || | ||||| || Db 322 GCACTGGAAAGCAGATGCTGCTATCCAGGGGAATTCTCAGAGCTGAGGGAGGCATTTATA 381 Qy 382 CGCAAGTTTTATGAGAAGAAAACCGTTGGTGAGAACAGCACCATAATCAATCCTGTTGAG 441 | || ||||| | ||||||| || | ||||||| || || |||||| || || Db 382 AGGAAATTTTACG---AGAAAACTGTCCGGGAGAACAATACTATTGCCAATCCAGTGGAA 438 Qy 442 CAGAACTGCACACTTTCTTGCGGTACTTCGCAGGAATTTCAGTATGCTGTTGATAGCCGC 501 || |||||||| || ||| || || || |||||||| | | |||||| ||| | Db 439 CAAAACTGCACTCTAAGTTGTGGAACGAGTCAAGAATTTCAATTTAATGTTGACAGCAGG 498 Qy 502 CGGGTGATGAAGGCAATGGAAGAGAAGCAAGCAACGGATGATGAACCGGACGGAAACAAA 561 || || | |||||| | | |||| ||||||||||| || || ||||| ||| Db 499 AGGAAGACGGTTTGCATGGAAAACTACGAAGCCACGGATGATGAGCCTGATGGAAATAAA 558 Qy 562 TGGACGGAGTCGAACAGGCATGTGAAGACCCTCCCTCTTTTCCCCTTGCATAATAATGAA 621 ||||| ||| || | ||||| || | || | ||||| || ||||| ||||||||| Db 559 TGGACAGAGAGCAATCGCCATGTTAAAATACTGCAACTTTTTCCTTTGCACAATAATGAA 618 Qy 622 GATCAGACCTTGATCAAGTCGGACAAGGAAATTTATTGCCTTGGGAGCTGTGAAAAAAAA 681 |||||||| |||| || || || |||||||||||||| | || |||||||||||| Db 619 GATCAGACTCTGATTAAATCTGATAAGGAAATTTATTGTTTGGGATCCTGTGAAAAAAAG 678 Qy 682 ATGGATCTGTCCCCATTGGGACA 704 |||||||| ||||| || || Db 679 ATGGATCTTAGTCCATTAGGTCA 701 Against instant SEQ ID NO: 1 RESULT 1 GO662999 LOCUS GO662999 760 bp mRNA linear EST 15-APR-2010 DEFINITION TKN002C01 Taraxacum kok-saghyz root cDNA library (TKN) Taraxacum kok-saghyz cDNA clone TKN002C01, mRNA sequence. ACCESSION GO662999 VERSION GO662999.1 DBLINK BioSample: SAMN00167574 KEYWORDS EST. SOURCE Taraxacum kok-saghyz ORGANISM Taraxacum kok-saghyz Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Crepidinae; Taraxacum. REFERENCE 1 (bases 1 to 760) AUTHORS Collins,J., Whalen,M.C., Nural-Taban,A.H., Scott,D., Hathwaik,U., Lazo,G.R., Cox,K., Durant,K., Woolsey,R., Schegg,K., Gollery,M., Cornish,K., McMahan,C., Schooley,C. and Shintani,D. TITLE Genomic and proteomic identification of candidates genes and proteins for rubber biosynthesis in Taraxacum kok-saghyz (Russian dandelion) JOURNAL Unpublished COMMENT Contact: Whalen MC Crop Improvement and Utilization Research Unit USDA-ARS Western Regional Research Center 800 Buchanan Street, Albany, CA 94710-1105, USA Tel: 510 559 5818 Fax: 510 559 5950 Email: maureen.whalen@ars.usda.gov Elastomics Project http://www.ars.usda.gov/pwa/wrrc/ciu Plate: TKN002 row: C column: 01. FEATURES Location/Qualifiers source 1..760 /organism="Taraxacum kok-saghyz" /mol_type="mRNA" /db_xref="taxon:333970" /clone="TKN002C01" /tissue_type="root" /clone_lib="SAMN00167574 Taraxacum kok-saghyz root cDNA library (TKN)" /dev_stage="1.2 to 3 month" /note="Vector: pGADT7Rec-AB; Site_1: SfiIA; Site_2: SfiIB; Total RNA was used for ds cDNA synthesis using Clontech SMART protocol (Zhu et. al. (2001) Biotechniques 30: 892-897). SMART prepared amplified cDNA was then normalized using DSN normalization method (Zhulidov et. al., (2004) Nucleic Acid Res. 32(3): e37. Normalization included cDNA denaturation/reassociation, treatment of duplex specific nuclease (DSN) (Shagin et. al. (2002) Genome Res. 12:1935-1942) and amplification of normalized fraction by PCR. Resulted normalized cDNA was digested with SfiI and subcloned into pGADT7Rec-AB. Quality Read Lengths from sequences were extracted with Phred program. File trimming based on sequence mark-up done with cross_match program, minor vector/adaptor sequences remained." Query Match 10.8%; Score 84.8; DB 120; Length 760; Best Local Similarity 60.9%; Matches 156; Conservative 0; Mismatches 97; Indels 3; Gaps 1; Qy 28 GGCTCTGGCTATGTTTACAGACAGCCAGGATCAACGCGGTGGAACCCGACAGCTGAACAA 87 | |||| | || | | ||| |||||| ||| |||||||| || ||| || ||| Db 300 GACTCTCCTCAGGTAGAGACACATCCAGGAGGAACACGGTGGAATCCAACACAAGAGCAA 359 Qy 88 CTGTCCTTGCTTAGAGAAATCTACTACCGCAACGGATTGCGGACCCCGACCGCGGACGAA 147 | | | | ||| || | || | ||| ||||||| || | ||| | || Db 360 AT---CGGGATCTTAGAGATGTTATATAGAGGGGGAATGCGGACTCCAAACGCACAACAA 416 Qy 148 ATCAGACAAATCAGCTCAAAGCTCTCAAGGTACGGAAAAATAGAGGGCAAAAACGTTTAC 207 ||| |||||| | |||| | || | | |||||| || ||||| ||||| || || | Db 417 ATCGAACAAATTACCTCACAACTATGCAAGTACGGCAAGATAGAAGGCAAGAATGTGTTT 476 Qy 208 AACTGGTTCCAGAATAGACGCGCAAGAGAAAAGCGCAAGCAACGGCTCTCTACAATCGGC 267 | |||||||||||| ||| |||| | || ||||| || | |||| Db 477 TATTGGTTCCAGAATCACAAAGCACGAGAGAGGCAGAAGCAGAAGCGTAACAACCTCGGT 536 Qy 268 TGTGATCCAGCACTGA 283 ||| | ||| Db 537 CTAAATCATTCTTTGA 552 Conclusion No claim is allowed. Contact information Any inquiry concerning this communication or earlier communications from the examiner should be directed to WAYNE ZHONG whose telephone number is (571)270-0311. The examiner can normally be reached 8:30am to 5:00pm EST. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Bratislav Stankovic, can be reached on 571-270-0305. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /Wayne Zhong/ Primary Examiner, Art Unit 1662
Read full office action

Prosecution Timeline

Jun 11, 2024
Application Filed
Jan 25, 2026
Non-Final Rejection — §112, §DP (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12600978
PROCESS FOR PRODUCING LIPIDS
2y 5m to grant Granted Apr 14, 2026
Patent 12599072
PLANTS AND SEEDS OF HYBRID CORN VARIETY CH010552
2y 5m to grant Granted Apr 14, 2026
Patent 12600976
MAIZE GENE KRN2 AND USES THEREOF
2y 5m to grant Granted Apr 14, 2026
Patent 12593767
PROTOPLAST ISOLATION AND REGENERATION OF PLANTS
2y 5m to grant Granted Apr 07, 2026
Patent 12593793
SOYBEAN VARIETY 01094778
2y 5m to grant Granted Apr 07, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

AI Strategy Recommendation

Get an AI-powered prosecution strategy using examiner precedents, rejection analysis, and claim mapping.
Powered by AI — typically takes 5-10 seconds

Prosecution Projections

1-2
Expected OA Rounds
72%
Grant Probability
94%
With Interview (+22.3%)
3y 0m
Median Time to Grant
Low
PTA Risk
Based on 524 resolved cases by this examiner. Grant probability derived from career allow rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month