Prosecution Insights
Last updated: April 19, 2026
Application No. 18/779,813

RNA-BASED CONTROL OF POWDERY MILDEW

Non-Final OA §103§112
Filed
Jul 22, 2024
Examiner
ZHENG, LI
Art Unit
1662
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
UNITED STATES GOVERNMENT
OA Round
1 (Non-Final)
84%
Grant Probability
Favorable
1-2
OA Rounds
2y 8m
To Grant
97%
With Interview

Examiner Intelligence

Grants 84% — above average
84%
Career Allow Rate
1055 granted / 1260 resolved
+23.7% vs TC avg
Moderate +13% lift
Without
With
+13.2%
Interview Lift
resolved cases with interview
Typical timeline
2y 8m
Avg Prosecution
30 currently pending
Career history
1290
Total Applications
across all art units

Statute-Specific Performance

§101
3.0%
-37.0% vs TC avg
§103
15.2%
-24.8% vs TC avg
§102
21.6%
-18.4% vs TC avg
§112
49.7%
+9.7% vs TC avg
Black line = Tech Center average estimate • Based on career data from 1260 resolved cases

Office Action

§103 §112
Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . DETAILED ACTION 1. Claims 62-76 are pending. Claim Rejections - 35 USC § 112 The following is a quotation of the first paragraph of 35 U.S.C. 112(a): (a) IN GENERAL.—The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor or joint inventor of carrying out the invention. The following is a quotation of the first paragraph of pre-AIA 35 U.S.C. 112: The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor of carrying out his invention. 2. Claims 62-76 are rejected under 35 U.S.C. 112(a) or 35 U.S.C. 112 (pre-AIA ), first paragraph, as failing to comply with the written description requirement. The claim(s) contains subject matter which was not described in the specification in such a way as to reasonably convey to one skilled in the relevant art that the inventor or a joint inventor, or for applications subject to pre-AIA 35 U.S.C. 112, the inventor(s), at the time the application was filed, had possession of the claimed invention. Instant claims are broadly drawn to a composition for controlling E. necator, comprising a dsRNA molecule that cause mortality, suppression of growth, decrease in virulence or pathogenicity or reproductive capacity in E. necator when transfected or contacted to said E. necator, wherein at least one strand of said dsRNA having a first and a second strand, wherein both strands are about 800 nucleotides or less in length comprises at least 200 contiguous nucleotides that are at least 95% sequence identical to SEQ ID NO: 215; The specification teaches controlling E. necator by using dsRNA (ES43) targeting SEQ ID NO:215/108 (Tables 1 and 2). The Applicants do not describe any other dsRNA targeting CYP51 gene and being about 200 to about 800 nucleotides in length. The only described by the specification is ES43 which targets 497bp region of the gene encoded by SEQ ID NO:215/108. The specification fails to provide conserved structure shared by the members in the claimed genus. It is well known in the art that different tiles of a given target gene may vary greatly in efficacy. Still further, given that SEQ ID NO: 215 only comprises 497 bp, the nucleotides sequence beyond that length are not described, needless to say the variants thereof. Further still, Applicants fails to describe the relationship between first strand and the second strand. It is unclear whether the second strand is fully complementary to the first one, or if not, how much they are complementary to each other. Therefore, it is concluded that Applicants are not in possession of the claimed genus. The Federal Circuit has recently clarified the application of the written description requirement to inventions in the field of biotechnology. See University of California v. Eli Lilly and Co., 119 F.3d 1559, 1568, 43 USPQ2d 1398, 1406 (Fed. Cir. 1997). In summary, the court stated that a written description of an invention requires a precise definition, one that defines the structural features of the chemical genus that distinguishes it from other chemical structures. A definition by function does not suffice to define the genus because it is only an indication of what the gene does, rather than what it is. The court goes on to say, “A description of a genus of cDNAs may be achieved by means of a recitation of a representative number of cDNAs, defined by nucleotide sequence, falling within the scope of the genus or of a recitation of structural features common to members of the genus, which features constitute a substantial portion of the genus.” See University of California v. Eli Lilly and Co., 119 F.3d 1559; 43 USPQ2d 1398, 1406 (Fed. Cir. 1997). Applicants fail to describe a representative number of dsRNA falling within the scope of the claimed genus. Applicants only describe a single species which is dsRNA targeting SEQ ID NO:215/108 region. Furthermore, Applicants fail to describe structural features common to members of the claimed genus of dsRNA. Hence, Applicants fail to meet either prong of the two-prong test set forth by Eli Lilly. Furthermore, given the lack of description of the necessary elements essential for dsRNA in about 200 bp to about 800 bp targeting CYP51. Since said genus has not been described by specific structural features, the specification fails to provide an adequate written description to support the breath of the claims. Claim Rejections - 35 USC § 103 The following is a quotation of 35 U.S.C. 103 which forms the basis for all obviousness rejections set forth in this Office action: A patent for a claimed invention may not be obtained, notwithstanding that the claimed invention is not identically disclosed as set forth in section 102, if the differences between the claimed invention and the prior art are such that the claimed invention as a whole would have been obvious before the effective filing date of the claimed invention to a person having ordinary skill in the art to which the claimed invention pertains. Patentability shall not be negated by the manner in which the invention was made. 4. Claim(s) 62-76 are rejected under 35 U.S.C. 103 as being unpatentable over Kogel (US Patent Application Publication No. 2016/0215290) and further in view of Delgado et al. (US Patent Application Publication No. 2018/0320179), Rallos et al. (2016, Plos One DOI:10.1371 page 1-18) and Applicants admitted prior art. Instant claims a composition for cotrolling E. necator, comprising a dsRNA molecule that cause mortality, suppression of growth, decrease in virulence or pathogenicity or reproductive capacity in E. necator when transfected or contacted to said E. necator, wherein at least one strand of said dsRNA being about 300 to about 800 nucleotides comprises at least 200/300/400/500 contiguous nucleotides that are at least 95% sequence identical/complementary to SEQ ID NO: 215; or wherein the composition is in form of liquid; or wherein the composition further comprises a carrier agent; or wherein said at least 200 contiguous nucleotides are at least 95% identical to a conserved region of a target gene of two or more strains of E. necator; or wherein the two or more strains are LNYM, NY90….or CH19; or wherein the conserved region comprises SEQ ID NO:215. Instant claims are also drawn to a method for controlling E. necator infection of a plant by contacting said E. necator with the composition. Kogel teaches a method of controlling fungal phyto-pathogens by producing transgenic plant producing dsRNA targeting CYP51 or contacting the pathogen with the dsRNA (claims 22 and 24). Kogel teaches dsRNA targeting CYP51 from various fungal pathogens including genus of Fusarium, Ustilago maydis, Botrytis cineras, Magnaporthe grisea etc. (claim 9). Kogel teaches a list of phytopathogens that can be controlled by the method including E. necator (paragraph [0049]). Kogel teaches composition further comprises a plant-compatible carrier, which can be liquid (paragraph [0114]). Kogel teaches dsRNA is 200-300 bp in length (paragraph [0154]), which is within the range of about 300 bp to about 800 bp Kogel does not teach that the pathogen is E. necator in the claims and that the CYP51 is SEQ ID NO:1. Kogel does not teach SEQ ID NO: 108. Rallos et al. teach CYP51 of E. necator (Genbank Accession No. KR106192) which is over 98.4% identical to instant SEQ ID NO:215 (see alignment below). The alignment shows that Genbank Accession No. KR106192 contains at least 400 contiguous nucleotides of instant SEQ ID NO:215. Delgado et al. teach a method for controlling an infestation of a phytopathogen from the genus Zymoseptoria in a plant comprising contacting the pathogen with dsRNA target CYP51 of Zymoseptoria. Given the teachings of Kogel and Delgado that dsRNA targeting CYP51 can be used for controlling various fungal phyto-pathogens, it would have obvious to apply same method of Kogel to control powdery mildew E. necator by targeting Genbank Accession No. KR106192 of Rallos et al. with reasonable expectation for success given that controlling grape powdery mildew is of commercial interest according to Applicants admitted prior art (specification, paragraph [0001]) . Although the combined teachings do not teach targeting specifically SEQ ID NO:215, targeting 200/300/400/500 bp region within SEQ ID NO:215 would have been considered as an obvious design choice given that such region is in the coding region of NR106192 and teaching of Kogel that dsRNA is 200-300 bp in length (paragraph [0154]). Although the combined teachings do not teach said at least 200 contiguous nucleotides are at least 95% identical to a conserved region of a target gene of two or more strains of E. necator; or that the two or more strains are LNYM, NY90….or CH19, those limitation would have been obviously exhibited by the corresponding region in the Genbank Accession No. KR106192 to instant SEQ ID NO:215. Alignment between KR106192 and instant SEQ ID NO:215 RESULT 13 KR106192 LOCUS KR106192 1781 bp DNA linear PLN 06-MAR-2016 DEFINITION Erysiphe necator eburicol 14-alpha demethylase (CYP51) gene, complete cds. ACCESSION KR106192 VERSION KR106192.1 KEYWORDS . SOURCE Erysiphe necator (Uncinula necator) ORGANISM Erysiphe necator Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Leotiomycetes; Erysiphales; Erysiphaceae; Erysiphe. REFERENCE 1 (bases 1 to 1781) AUTHORS Rallos,L.E. and Baudoin,A.B. TITLE Co-Occurrence of Two Allelic Variants of CYP51 in Erysiphe necator and Their Correlation with Over-Expression for DMI Resistance JOURNAL PLoS ONE 11 (2), E0148025 (2016) PUBMED 26839970 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 1781) AUTHORS Rallos,L.E. and Baudoin,A.B. TITLE Direct Submission JOURNAL Submitted (11-APR-2015) Plant Pathology, Physiology and Weed Science, Virginia Tech, Price Hall, Blacksburg, VA 24061, USA FEATURES Location/Qualifiers source 1..1781 /organism="Erysiphe necator" /mol_type="genomic DNA" /db_xref="taxon:52586" gene <58..>1740 /gene="CYP51" /note="sensitive allele" mRNA join(<58..303,359..556,610..>1740) /gene="CYP51" /product="eburicol 14-alpha demethylase" CDS join(58..303,359..556,610..1740) /gene="CYP51" /codon_start=1 /product="eburicol 14-alpha demethylase" /protein_id="AMM72595.1" /translation="MYIADILSDLLTQQTTRYGWIFMVTSIAFSIILLAVVLNVLSQL LFRRPYEPPVVFHWFPIIGSTISYGIDPYKFYFDCRAKYGDIFTFILLGKKVTVYLGL QGNNFILNGKLKDVNAEEIYTNLTTPVFGRDVVYDCPNSKLMEQKKFMKTALTTEAFH SYVTIIQNEVEAYINNCVSFQGESGTVNISKVMAEITIYTASHALQGEEVRENFDSSF AALYHDLDMGFTPINFTFYWAPLPWNRARDHAQRTVARTYMNIIQARREEKRSGENKH DIMWELMRSTYKDGTPVPDREIAHMMIALLMAGQHSSSSTSSWIMLWLAARPDIMEEL YEEQLRIFGSEKPFPPLQYEDLSKLQLHQNVLKEVLRLHAPIHSIMRKVKNPMIVPGT KYVIPTSHVLISSPGCTSQDATFFPDPLKWDPHRWDIGSGKVLGNDAVDEKYDYGYGL TSTGASSPYLPFGAGRHRCIGEQFATLQLVTIMATMVRFFRFRNIDGKQGVVKTDYSS LFSMPLAPALIGWEKR" Query Match 98.4%; Score 489; DB 458; Length 1781; Best Local Similarity 72.4%; Matches 354; Conservative 135; Mismatches 0; Indels 0; Gaps 0; Qy 9 UGAAGCGUUCCAUUCCUAUGUAACAAUAAUACAAAAUGAAGUAGAGGCAUAUAUAAACAA 68 :||||||::|||::||:|:|:|||||:||:||||||:||||:|||||||:|:|:|||||| Db 633 TGAAGCGTTCCATTCCTATGTAACAATAATACAAAATGAAGTAGAGGCATATATAAACAA 692 Qy 69 UUGCGUUAGCUUUCAGGGUGAGAGUGGCACAGUAAACAUCUCAAAAGUUAUGGCGGAAAU 128 ::|||::|||:::|||||:|||||:|||||||:|||||:|:||||||::|:||||||||: Db 693 TTGCGTTAGCTTTCAGGGTGAGAGTGGCACAGTAAACATCTCAAAAGTTATGGCGGAAAT 752 Qy 129 CACUAUAUAUACUGCUUCACAUGCCUUACAAGGAGAAGAGGUCCGUGAGAAUUUUGACUC 188 |||:|:|:|:||:||::||||:|||::||||||||||||||:|||:|||||::::|||:| Db 753 CACTATATATACTGCTTCACATGCCTTACAAGGAGAAGAGGTCCGTGAGAATTTTGACTC 812 Qy 189 AUCUUUUGCCGCUCUUUAUCAUGAUCUUGAUAUGGGAUUUACACCGAUCAACUUUACAUU 248 |:|::::|||||:|:::|:||:||:|::||:|:||||:::|||||||:||||:::|||:: Db 813 ATCTTTTGCCGCTCTTTATCATGATCTTGATATGGGATTTACACCGATCAACTTTACATT 872 Qy 249 UUACUGGGCACCUCUACCUUGGAAUCGUGCUCGUGAUCAUGCCCAAAGAACUGUUGCUAG 308 ::||:|||||||:|:|||::||||:||:||:||:||:||:|||||||||||:|::||:|| Db 873 TTACTGGGCACCTCTACCTTGGAATCGTGCTCGTGATCATGCCCAAAGAACTGTTGCTAG 932 Qy 309 GACUUAUAUGAAUAUAAUCCAAGCUCGUAGAGAAGAGAAAAGAAGCGGUGAGAAUAAGCA 368 |||::|:|:|||:|:||:||||||:||:||||||||||||||||||||:|||||:||||| Db 933 GACTTATATGAATATAATCCAAGCTCGTAGAGAAGAGAAAAGAAGCGGTGAGAATAAGCA 992 Qy 369 UGAUAUAAUGUGGGAGUUGAUGCGUUCCACUUAUAAAGACGGGACUCCGGUACCUGAUCG 428 :||:|:||:|:|||||::||:|||::||||::|:|||||||||||:||||:|||:||:|| Db 993 TGATATAATGTGGGAGTTGATGCGTTCCACTTATAAAGACGGGACTCCGGTACCTGATCG 1052 Qy 429 AGAGAUAGCGCAUAUGAUGAUAGCCCUUCUGAUGGCUGGACAACACUCUUCGUCAUCCAC 488 |||||:||||||:|:||:||:|||||::|:||:|||:|||||||||:|::||:||:|||| Db 1053 AGAGATAGCGCATATGATGATAGCCCTTCTGATGGCTGGACAACACTCTTCGTCATCCAC 1112 Qy 489 GAGCUCAUG 497 ||||:||:| Db 1113 GAGCTCATG 1121 Alignment between KR106192 and instant SEQ ID NO:1 Range 1: 1 to 1756GraphicsNext MatchPrevious Match Alignment statistics for match #1 Score Expect Identities Gaps Strand 3208 bits(1737) 0.0 1748/1756(99%) 0/1756(0%) Plus/Plus Query 25 TAAGGTAGTATTGAGGCGGGTAAATCGGCCATTATGTACATTGCTGACATTTTGTCGGAT 84 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct 1 TAAGGTAGTATTGAGGCGGGTAAATCGGCCATTATGTACATTGCTGACATTTTGTCGGAT 60 Query 85 CTACTGACTCAACAGACGACACGATATGGGTGGATTTTCATGGTCACAAGTATCGCATTT 144 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct 61 CTACTGACTCAACAGACGACACGATATGGGTGGATTTTCATGGTCACAAGTATCGCATTT 120 Query 145 TCTATAATACTATTGGCCGTTGTGTTAAATGTATTGAGCCAGTTGCTGTTCCGTAGACCC 204 |||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||| Sbjct 121 TCTATAATACTATTGGCCGTTGGGTTAAATGTATTGAGCCAGTTGCTGTTCCGTAGACCC 180 Query 205 TACGAGCCACCAGTTGTATTTCATTGGTTTCCAATAATTGGAAGTACAATTTCGTATGGA 264 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct 181 TACGAGCCACCAGTTGTATTTCATTGGTTTCCAATAATTGGAAGTACAATTTCGTATGGA 240 Query 265 ATTGATCCATATAAATTTTATTTTGATTGTAGAGCCAAAGTAAGTAGAGCTCTTTTACAT 324 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct 241 ATTGATCCATATAAATTTTATTTTGATTGTAGAGCCAAAGTAAGTAGAGCTCTTTTACAT 300 Query 325 GCCCATCTCCAGATCATTAACATACATCTTTTAGTATGGAGACATTTTTACATTTATTCT 384 |||||||||||||||||||||| |||||||||||||||||||||||||||||||||||| Sbjct 301 GCCCATCTCCAGATCATTAACAACCATCTTTTAGTATGGAGACATTTTTACATTTATTCT 360 Query 385 CCTCGGGAAAAAAGTAACAGTCTATCTGGGACTTCAAGGTAATAATTTTATACTTAATGG 444 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct 361 CCTCGGGAAAAAAGTAACAGTCTATCTGGGACTTCAAGGTAATAATTTTATACTTAATGG 420 Query 445 GAAGTTAAAAGATGTCAACGCCGAAGAGATTTACACTAATTTAACAACTCCGGTCTTTGG 504 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct 421 GAAGTTAAAAGATGTCAACGCCGAAGAGATTTACACTAATTTAACAACTCCGGTCTTTGG 480 Query 505 AAGAGATGTTGTATATGATTGTCCAAATTCCAAACTCATGGAACaaaaaaaGGTCCGTAA 564 |||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||| Sbjct 481 AAGAGATGTTGTATNTGATTGTCCAAATTCCAAACTCATGGAACAAAAAAAGGTCCGTAA 540 Query 565 ATGGTCGAGTAGTAATTTTTGAGATTCGATCTGAACTGCTGGTAGTTTATGAAAACGGCT 624 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct 541 ATGGTCGAGTAGTAATTTTTGAGATTCGATCTGAACTGCTGGTAGTTTATGAAAACGGCT 600 Query 625 CTTACCACTGAAGCGTTCCATTCCTATGTAACAATAATACAAAATGAAGTAGAGGCATAT 684 ||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct 601 CTTACCANTGAAGCGTTCCATTCCTATGTAACAATAATACAAAATGAAGTAGAGGCATAT 660 Query 685 ATAAACAATTGCGTTAGCTTTCAGGGTGAGAGTGGCACAGTAAACATCTCAAAAGTTATG 744 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct 661 ATAAACAATTGCGTTAGCTTTCAGGGTGAGAGTGGCACAGTAAACATCTCAAAAGTTATG 720 Query 745 GCGGAAATCACTATATATACTGCTTCACATGCCTTACAAGGAGAAGAGGTCCGTGAGAAT 804 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct 721 GCGGAAATCACTATATATACTGCTTCACATGCCTTACAAGGAGAAGAGGTCCGTGAGAAT 780 Query 805 TTTGACTCATCTTTTGCCGCTCTTTATCATGATCTTGATATGGGATTTACACCGATCAAC 864 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct 781 TTTGACTCATCTTTTGCCGCTCTTTATCATGATCTTGATATGGGATTTACACCGATCAAC 840 Query 865 TTTACATTTTACTGGGCACCTCTACCTTGGAATCGTGCTCGTGATCATGCCCAAAGAACT 924 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct 841 TTTACATTTTACTGGGCACCTCTACCTTGGAATCGTGCTCGTGATCATGCCCAAAGAACT 900 Query 925 GTTGCTAGGACTTATATGAATATAATCCAAGCTCGTAGAGAAGAGAAAAGAAGCGGTGAG 984 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct 901 GTTGCTAGGACTTATATGAATATAATCCAAGCTCGTAGAGAAGAGAAAAGAAGCGGTGAG 960 Query 985 AATAAGCATGATATAATGTGGGAGTTGATGCGTTCCACTTATAAAGACGGGACTCCGGTA 1044 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct 961 AATAAGCATGATATAATGTGGGAGTTGATGCGTTCCACTTATAAAGACGGGACTCCGGTA 1020 Query 1045 CCTGATCGAGAGATAGCGCATATGATGATAGCCCTTCTGATGGCTGGACAACACTCTTCG 1104 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct 1021 CCTGATCGAGAGATAGCGCATATGATGATAGCCCTTCTGATGGCTGGACAACACTCTTCG 1080 Query 1105 TCATCCACGAGCTCATGGATTATGCTTTGGTTAGCCGCACGACCAGATATCATGGAAGAG 1164 |||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||| Sbjct 1081 TCATCCACGAGCTCATGGATTATGCTTTGGTTAGCCGCNCGACCAGATATCATGGAAGAG 1140 Query 1165 TTGTATGAGGAACAACTTCGGATTTTTGGGTCAGAAAAGCCCTTCCCGCCTTTACAATAT 1224 ||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||| Sbjct 1141 TTGTATGAGGAACAACTTCGGATTTTTGGNTCAGAAAAGCCCTTCCCGCCTTTACAATAT 1200 Query 1225 GAAGATCTTTCAAAACTTCAACTTCATCAAAATGTTTTGAAAGAAGTTCTGCGACTTCAC 1284 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct 1201 GAAGATCTTTCAAAACTTCAACTTCATCAAAATGTTTTGAAAGAAGTTCTGCGACTTCAC 1260 Query 1285 GCTCCCATACACTCAATCATGCGGAAGGTCAAGAATCCAATGATCGTGCCAGGCACTAAA 1344 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct 1261 GCTCCCATACACTCAATCATGCGGAAGGTCAAGAATCCAATGATCGTGCCAGGCACTAAA 1320 Query 1345 TACGTCATTCCGACGTCGCATGTACTCATCTCATCGCCCGGATGTACTAGTCAGGATGCC 1404 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct 1321 TACGTCATTCCGACGTCGCATGTACTCATCTCATCGCCCGGATGTACTAGTCAGGATGCC 1380 Query 1405 ACtttttttCCAGACCCTCTCAAATGGGATCCTCATCGATGGGACATTGGATCAGGTAAA 1464 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct 1381 ACTTTTTTTCCAGACCCTCTCAAATGGGATCCTCATCGATGGGACATTGGATCAGGTAAA 1440 Query 1465 GTCCTAGGAAATGATGCGGTTGATGAGAAGTATGATTATGGGTATGGTTTAACTAGCACA 1524 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct 1441 GTCCTAGGAAATGATGCGGTTGATGAGAAGTATGATTATGGGTATGGTTTAACTAGCACA 1500 Query 1525 GGAGCGTCAAGTCCATATCTACCTTTTGGTGCGGGTCGGCATCGATGTATTGGCGAGCAA 1584 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct 1501 GGAGCGTCAAGTCCATATCTACCTTTTGGTGCGGGTCGGCATCGATGTATTGGCGAGCAA 1560 Query 1585 TTTGCCACATTGCAGCTAGTGACAATAATGGCAACTATGGTGCGtttttttAGGTTCCGT 1644 ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct 1561 TTTGCCACATTGCAGCTAGTGACAATAATGGCAACTATGGTGCGTTTTTTTAGGTTCCGN 1620 Query 1645 AATATAGATGGGAAGCAGGGGGTTGTAAAGACAGACTATTCAAGTCTATTTTCGATGCCT 1704 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct 1621 AATATAGATGGGAAGCAGGGGGTTGTAAAGACAGACTATTCAAGTCTATTTTCGATGCCT 1680 Query 1705 CTCGCACCAGCCCTGATAGGCTGGGAAAAGAGATGACTGTTATCGTAATTATTTATGGCA 1764 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct 1681 CTCGCACCAGCCCTGATAGGCTGGGAAAAGAGATGACTGTTATCGTAATTATTTATGGCA 1740 Query 1765 GGTGTTAGGGTTAGAA 1780 |||||||||||||||| Sbjct 1741 GGTGTTAGGGTTAGAA 1756 Conclusion No claim is allowed. Any inquiry concerning this communication or earlier communications from the examiner should be directed to LI ZHENG whose telephone number is (571)272-8031. The examiner can normally be reached Monday-Friday (9-5). Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, BRATISLAV STANKOVIC can be reached on 571-270-0305. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /LI ZHENG/Primary Examiner, Art Unit 1662
Read full office action

Prosecution Timeline

Jul 22, 2024
Application Filed
Apr 02, 2026
Non-Final Rejection — §103, §112 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12588628
SOYBEAN CULTIVAR 22121100
2y 5m to grant Granted Mar 31, 2026
Patent 12588638
SOYBEAN CULTIVAR 20320703
2y 5m to grant Granted Mar 31, 2026
Patent 12588639
SOYBEAN CULTIVAR 25101703
2y 5m to grant Granted Mar 31, 2026
Patent 12582060
CANOLA INBRED 4PPQP40A
2y 5m to grant Granted Mar 24, 2026
Patent 12577624
TRANSGENIC CORN EVENT ZM_BCS216090 AND METHODS FOR DETECTION AND USES THEREOF
2y 5m to grant Granted Mar 17, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

AI Strategy Recommendation

Get an AI-powered prosecution strategy using examiner precedents, rejection analysis, and claim mapping.
Powered by AI — typically takes 5-10 seconds

Prosecution Projections

1-2
Expected OA Rounds
84%
Grant Probability
97%
With Interview (+13.2%)
2y 8m
Median Time to Grant
Low
PTA Risk
Based on 1260 resolved cases by this examiner. Grant probability derived from career allow rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month