Prosecution Insights
Last updated: July 17, 2026
Application No. 18/810,533

LOW-REVERSION TYPE TOBACCO PLANT HAVING LOW NORNICOTINE CONTENT, METHOD FOR SELECTING SAME, AND METHOD FOR PRODUCING TOBACCO PLANT LINE

Non-Final OA §112
Filed
Aug 21, 2024
Priority
Feb 24, 2022 — JP 2022-027284 +1 more
Examiner
ZHONG, WAYNESHAOBIN
Art Unit
1662
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Japan Tobacco Inc.
OA Round
1 (Non-Final)
72%
Grant Probability
Favorable
1-2
OA Rounds
1y 0m
Est. Remaining
94%
With Interview

Examiner Intelligence

Grants 72% — above average
72%
Career Allowance Rate
388 granted / 536 resolved
+12.4% vs TC avg
Strong +22% interview lift
Without
With
+21.6%
Interview Lift
resolved cases with interview
Typical timeline
2y 11m
Avg Prosecution
29 currently pending
Career history
562
Total Applications
across all art units

Statute-Specific Performance

§101
3.2%
-36.8% vs TC avg
§103
58.5%
+18.5% vs TC avg
§102
10.4%
-29.6% vs TC avg
§112
17.6%
-22.4% vs TC avg
Black line = Tech Center average estimate • Based on career data from 536 resolved cases

Office Action

§112
DETAILED ACTION Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Information Disclosure Statement The Information Disclosure Statements filed on 11/20/2024, 9/11/2025 have been entered and considered. Initialed copies of the form PTO-1449 are enclosed with this action. Restriction-Election/Status of claims On 5/13/2026, the applicant elected SNV1 for Election 1, InDel4 for Election 2, and the combination of SNV1, InDel4, and SNV95 for Election 3, without traverse. Up on further consideration, SNV1, InDel4, and SNV95 are examined individually and as a combination. In summary, claims 1-7 are pending and examined in this office action. Non-elected species are withdrawn. Priority Instant application 18810533, filed 08/21/2024, is a Continuation of PCT/JP2023/006427, filed 02/22/2023, and claims foreign priority to 2022-027284, filed 02/24/2022. The certified copy of the foreign priority was received, but an English translation is missing. Thus, the priority date of 2/14/2022 is not recognized until the English translation is received. Claim Objections Claims 1 and 7 are objected to because: The independent claims recite “a chromosome Nt09 in a reference genome sequence of K326 of Nicotiana tabacum”. According to 37 CFR 1.57, the incorporation of essential material by reference to an unpublished U.S. application, foreign application or patent, or to a publication is improper. According to Nicotiana tabacum genome assembly ASM71507v2 - NCBI - NLM (PDF also attached), genome sequence of K326 of Nicotiana tabacum has different versions, currently the updated version is version 2. Version 1 is different from version 2. Accordingly, “a chromosome Nt09 in a reference genome sequence of K326 of Nicotiana tabacum” or “a reference genome sequence of K326 of Nicotiana tabacum” are modifiable in content and thus not static sources of information. Appropriate corrections are required. The most reliable static information is SEQ ID NOs in a sequence listing. Claim 1 is objected for following informalities: In the claim, “SNV”, “Nt09”, “InDel” appear in a claim for the first time. Each of the full names should be recited, followed by the abbreviation in a (). In addition, the following suggestions are made for correcting informalities: It is suggested to recite --- tobacco cultivar Matsukawa --- instead of the “Matsukawa”. It is suggested to recite --- tables 1-2 below --- instead of the “tables below”. In the 3rd para, the “markers” should be --- the markers ---. In the 5th para, the “InDel” should be in plural form: --- insertions/deletions (InDels) ---. In the last para, the “insertion/deletion” should be --- each of the InDels ---. Claims 1 and 7 are objected for following informalities: In the claims, the “a chromosome Nt09” should be --- the chromosome Nt09 ---. See the requirement of 37 CFR 1.71(a) for “full, clear, and exact terms”. Appropriate correction is required. The claims are also rejected below for indefiniteness. Claim Rejections - 35 USC § 112 Enablement/Lacking Deposit The following is a quotation of the first paragraph of 35 U.S.C. 112(a): (a) IN GENERAL—The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor or joint inventor of carrying out the invention. Claims 1-7 are rejected under 35 U.S.C. 112(a), as failing to comply with the enablement requirement. The claim(s) contains subject matter which was not described in the specification in such a way as to enable one skilled in the art to which it pertains, or with which it is most nearly connected, to make and/or use the invention. As analyzed below in the 112(b) rejection, by BRI cultivar Matsukawa (Kanto) is interpreted as cultivar Matsukawa, of all types and variations. Claims are drawn to methods of using (to develop new tobacco cultivars), and resultant products, of tobacco cultivar Matsukawa. By the examiner’s search, only Nicotiana tabacum (also called common tobacco) cultivar K326 has been partially sequenced. See Nicotiana tabacum genome assembly ASM71507v2 - NCBI - NLM. PDF also attached. Tobacco cultivar Matsukawa, or cultivar Matsukawa Kanto, is not a new cultivar, but had/has not been deposited, sequenced, or characterized, at least for low reversion type low nornicotine content. The specification does not provide deposit information, or sequence (even partial sequence) of cultivar Matsukawa. Thus, cultivar Matsukawa appears to be a newly characterized biological material. Since the seed of cultivar Matsukawa is essential to the claimed invention, it must be obtainable by a repeatable method set forth in the specification or otherwise be readily available to the public. If a seed is not so obtainable or available, a deposit thereof may satisfy the requirements of 35 U.S.C. 112. The specification does not disclose a repeatable process to obtain the exact same seed in each occurrence and it is not apparent if such a seed is readily available to the public. If the deposit has been made under the terms of the Budapest Treaty, then a statement, affidavit or declaration by Applicants, or a statement by an attorney of record over his or her signature and registration number, or someone empowered to make such a statement, stating that the specific strain has been deposited under the Budapest Treaty and that the strain will be irrevocably and without restriction released to the public upon the issuance of a patent, and will be publicly available for the enforceable life of the patent, would satisfy the deposit requirement made herein. If the deposit has not been made under the Budapest Treaty, then in order to certify that the deposit meets the criteria set forth in 37 C.F.R. 1.801-1.809 and MPEP 2402-2411.05, Applicants may provide assurance of compliance by statement, affidavit or declaration, or by someone empowered to make the same, or by a statement by an attorney of record over his or her signature and registration number, showing that (a) during the pendency of the application, access to the invention will be afforded to the Commissioner upon request; (b) all restrictions upon availability to the public will be irrevocably removed upon granting of the patent for the enforceable life of the patent in accordance with 37 CFR § 1.808(a)(2); (c) the deposit will be maintained in a public depository for a period of 30 years or 5 years after the last request or for the enforceable life of the patent, whichever is longer; and (d) the viability of the biological material at the time of deposit will be tested (see 37 CFR 1.807). In addition, the deposit information set forth in 37 CFR 1.809(d) should be added to the specification. See 37 C.F.R. 1.801-1.809 for additional explanation of these requirements. Alternatively, the applicant can provide sequence information, in form of SEQ ID NO(s), at least partial sequences as markers or primers, that are sufficient to distinguish cultivar Matsukawa from common tobacco, and all other tobacco cultivars, and are readily searchable and usable, for one skilled in the art to which it pertains, or with which it is most nearly connected, to make and/or use the invention. See MPEP 2164. Note: regarding claim 7, by examiner’s search, SEQ ID NO: 2, and its encoding sequence, had been taught in the art (multiple references) as a sequence of Nicotiana tabacum/common tobacco. Thus, SEQ ID NO: 2 does not distinguish cultivar Matsukawa from common tobacco, or any other tobacco cultivars. Additional sequences, markers or primers, are required. See “Sequence Matches” (at least 86 duplicates of 100% identical) at the end of office action. Indefiniteness The following is a quotation of 35 U.S.C. 112(b): (b) CONCLUSION—The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the inventor or a joint inventor regards as the invention. Claims 1-7 are rejected under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter which the inventor or a joint inventor, or for pre-AIA the applicant regards as the invention. There are multiple issues: Claims recite a term “Matsukawa (Kanto)”, multiple claims, multiple times. According to Arai et al (The origin and distribution of ‘Kokubu’-type splice-site mutations of the MLO genes in tobacco varieties. Breeding Science 72: 248-256, 2022, not prior art), there are at least 2 known cultivars named Matsukawa, Matsukawa Kanto and Matsukawa Ohkoshichikanari (p251-252, Table 2). A broad range or limitation together with a narrow range or limitation that falls within the broad range or limitation (in the same claim) is considered indefinite, since the resulting claim does not clearly set forth the metes and bounds of the patent protection desired. See MPEP § 2173.05(c). In the present instance, claims recite the broad recitation Matsukawa, and the claims also recite Kanto in ()s, which is the narrower statement of the range/limitation. In another word, the “(Kanto)” is narrower than and is a species of “Matsukawa”. It is unclear if the “(Kanto)” means to be Matsukawa Kanto or means to be an example of Matsukawa, or means to be a claim requirement. The metes and bounds are unclear. Appropriate corrections and clarifications are required. Dependent claims do not cure the deficiency. For compact prosecution, by BRI, cultivar “Matsukawa (Kanto)” has to be interpreted as cultivar Matsukawa. If the applicant clearly intends to mean Kanto, it is recommended to recite --- cultivar Matsukawa Kanto ---. Independent claims 1 and 7 recites “wherein markers indicated by SNV are each a marker based on single nucleotide variation present at a position corresponding to each shown position on a chromosome Nt09 in a reference genome sequence of K326 of Nicotiana tabacum, a "Base" indicates a base in Matsukawa (Kanto), markers indicated by InDel are each a marker based on insertion or deletion present at a position corresponding to each shown position on the chromosome Nt09 in the reference genome sequence, and "Insertion/Deletion" indicates whether the insertion or the deletion is present or not in Matsukawa (Kanto). By the examiner’s search, the SNVs (SNV1 and SNV95 are elected) in Tables 1 and 3, and the InDels (InDel4 is elected) in Tables 2 and 4, do not generate any meaningful search results in the art. As analyzed above, the specification does not provide any sequences, deposit, not even a version of the “reference genome sequence of K326 of Nicotiana tabacum”. Hence, the “positions on Nt09” and the “Base” in Tables 1 and 3 do not have clear meanings. The “positions on Nt09” and the “insertion/deletion” in Tables 2 and 4 also do not have clear meanings. As a result, the SNVs in Tables 1-3 and the InDels in Tables 2-4, are not art searchable and are not clearly defined by the specification. Therefore, they do not have art recognized meanings. Appropriate corrections and clarifications are required for one skill in the art to make and use the claimed invention. Dependent claims do not cure the deficiencies. Claim 1 recites “at least one marker which is of Matsukawa (Kanto), which is selected from tables below, and which allows Matsukawa (Kanto) to be distinguished from the another variety or the mutant of the another variety, wherein markers indicated by SNV are each a marker based on single nucleotide variation present at a position corresponding to each shown position on a chromosome Nt09 in a reference genome sequence of K326 of Nicotiana tabacum”. Claims 5 and 7 have similar recitations. The examiner notices that Table 3 differs Table 1 by excluding SNVs 1, 3, 6, 13-14, 21, 26, 29, 38, 42-43, 46, 48, 54-55, 57-58, 62-66, 68, 71-73, 81, 83, 89-91, and 95 (otherwise includes all other SNVs of Table 1). Table 4 differs Table 2 by excluding InDels 3, 9, 11, 13-15, 17-18, and 20 (otherwise includes all other InDels of Table 2). From the context of claim 7, another low nornicotine content tobacco plant (other than Matsukawa) comprises and requires the SNVs and InDels except the exclusions in Tables 3 and 4. Claim 1 requires that at least one marker, a SNV in Table 1 and a InDel in Table 2, is required to distinguish Matsukawa from the another tobacco. Thus, Both Matsukawa and tobacco plant (other than Matsukawa) require the the SNVs and InDels except the exclusions in Tables 3 and 4. In another word, the “at least one marker” recited in claim 1 cannot distinguish Matsukawa from the another tobacco. In another word, the claims are contradicting among themselves. Appropriate corrections and clarifications are required for one skill in the art to make and use the claimed invention. Dependent claims do not cure the deficiencies. Remarks As analyzed above, claims are deemed indefinite and not enabled. Please also see the prosecution of application 17965450/USP12239090, filed by the applicant Japan Tobacco Inc. SEQ ID NOs are claimed. For compact prosecution, the examiner performed limited searches. By the examiner’s search, only Nicotiana tabacum (also called common tobacco) cultivar K326 has been partially sequenced. See Nicotiana tabacum genome assembly ASM71507v2 - NCBI - NLM. PDF also attached. Tobacco cultivar Matsukawa, or cultivar Matsukawa Kanto, is not a new cultivar, but had/has not been deposited, sequenced, or characterized. However, the examiner cannot perform specific and meaningful searches based on the claims and specification. Once the issues are overcome, further search will be performed. Sequence Matches Against instant SEQ ID NO:2 Against Polypeptides RESULT 1 US-10-934-944-182 (NOTE: this sequence has 86 duplicates in the database searched. See complete list at the end of this report) Sequence 182, US/10934944 Patent No. 7812227 GENERAL INFORMATION APPLICANT: Xu, Dongmei TITLE OF INVENTION: Cloning of Cytochrome P450 Genes From Nicotiana FILE REFERENCE: 07678/141008 CURRENT APPLICATION NUMBER: US/10/934,944 CURRENT FILING DATE: 2004-09-03 PRIOR APPLICATION NUMBER: 10/686,947 PRIOR FILING DATE: 2003-10-16 PRIOR APPLICATION NUMBER: 60/503,989 PRIOR FILING DATE: 2003-09-18 PRIOR APPLICATION NUMBER: 60/485,368 PRIOR FILING DATE: 2003-07-08 PRIOR APPLICATION NUMBER: 10/387,346 PRIOR FILING DATE: 2003-03-12 PRIOR APPLICATION NUMBER: 10/340,861 PRIOR FILING DATE: 2003-01-10 PRIOR APPLICATION NUMBER: 10/293,252 PRIOR FILING DATE: 2002-11-13 PRIOR APPLICATION NUMBER: 60/418,933 PRIOR FILING DATE: 2002-10-16 PRIOR APPLICATION NUMBER: 60/363,684 PRIOR FILING DATE: 2002-03-12 PRIOR APPLICATION NUMBER: 60/347,444 PRIOR FILING DATE: 2002-01-11 PRIOR APPLICATION NUMBER: 60/337,684 PRIOR FILING DATE: 2001-11-13 NUMBER OF SEQ ID NOS: 387 SEQ ID NO 182 LENGTH: 517 TYPE: PRT ORGANISM: Nicotiana tabacum Query Match 100.0%; Score 2733; Length 517; Best Local Similarity 100.0%; Matches 517; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MLSPIEAIVGLVTFTFLFFFLWTKKSQKPSKPLPPKIPGGWPVIGHLFHFNDDGDDRPLA 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MLSPIEAIVGLVTFTFLFFFLWTKKSQKPSKPLPPKIPGGWPVIGHLFHFNDDGDDRPLA 60 Qy 61 RKLGDLADKYGPVFTFRLGLPLVLVVSSYEAVKDCFSTNDAIFSNRPAFLYGDYLGYNNA 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 RKLGDLADKYGPVFTFRLGLPLVLVVSSYEAVKDCFSTNDAIFSNRPAFLYGDYLGYNNA 120 Qy 121 MLFLANYGPYWRKNRKLVIQEVLSASRLEKFKHVRFARIQASIKNLYTRIDGNSSTINLT 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 MLFLANYGPYWRKNRKLVIQEVLSASRLEKFKHVRFARIQASIKNLYTRIDGNSSTINLT 180 Qy 181 DWLEELNFGLIVKMIAGKNYESGKGDEQVERFKKAFKDFMILSMEFVLWDAFPIPLFKWV 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 DWLEELNFGLIVKMIAGKNYESGKGDEQVERFKKAFKDFMILSMEFVLWDAFPIPLFKWV 240 Qy 241 DFQGHVKAMKRTFKDIDSVFQNWLEEHINKREKMEVNAEGNEQDFIDVVLSKMSNEYLGE 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 DFQGHVKAMKRTFKDIDSVFQNWLEEHINKREKMEVNAEGNEQDFIDVVLSKMSNEYLGE 300 Qy 301 GYSRDTVIKATVFSLVLDAADTVALHINWGMALLINNQKALTKAQEEIDTKVGKDRWVEE 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 GYSRDTVIKATVFSLVLDAADTVALHINWGMALLINNQKALTKAQEEIDTKVGKDRWVEE 360 Qy 361 SDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPK 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 SDIKDLVYLQAIVKEVLRLYPPGPLLVPHENVEDCVVSGYHIPKGTRLFANVMKLQRDPK 420 Qy 421 LWSDPDTFDPERFIATDIDFRGQYYKYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNY 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 LWSDPDTFDPERFIATDIDFRGQYYKYIPFGSGRRSCPGMTYALQVEHLTMAHLIQGFNY 480 Qy 481 RTPNDEPLDMKEGAGITIRKVNPVELIIAPRLAPELY 517 ||||||||||||||||||||||||||||||||||||| Db 481 RTPNDEPLDMKEGAGITIRKVNPVELIIAPRLAPELY 517 One of the 86 duplicates US-11-116-881C-3 Filing date in PALM: 2005-04-27 Sequence 3, US/11116881C Patent No. 7700834 GENERAL INFORMATION APPLICANT: XU, DONGMEI APPLICANT: NIELSEN, MARK T. TITLE OF INVENTION: NICOTIANA NUCLEIC ACID MOLECULES AND USES THEREOF FILE REFERENCE: 20210-070001 CURRENT APPLICATION NUMBER: US/11/116,881C CURRENT FILING DATE: 2005-04-27 PRIOR APPLICATION NUMBER: 11/110,062 PRIOR FILING DATE: 2005-04-19 PRIOR APPLICATION NUMBER: 60/665,451 PRIOR FILING DATE: 2005-03-24 PRIOR APPLICATION NUMBER: 60/665,097 PRIOR FILING DATE: 2005-03-24 PRIOR APPLICATION NUMBER: 60/646,764 PRIOR FILING DATE: 2005-01-25 PRIOR APPLICATION NUMBER: PCT/US04/34218 PRIOR FILING DATE: 2004-10-15 PRIOR APPLICATION NUMBER: PCT/US04/34065 PRIOR FILING DATE: 2004-10-15 PRIOR APPLICATION NUMBER: 10/943,507 PRIOR FILING DATE: 2004-09-17 PRIOR APPLICATION NUMBER: 10/934,944 PRIOR FILING DATE: 2004-09-03 PRIOR APPLICATION NUMBER: 60/607,357 PRIOR FILING DATE: 2004-09-03 PRIOR APPLICATION NUMBER: 60/566,235 PRIOR FILING DATE: 2004-04-29 Remaining Prior Application data removed - See File Wrapper or PALM. NUMBER OF SEQ ID NOS: 2303 SEQ ID NO 3 LENGTH: 517 TYPE: PRT ORGANISM: Nicotiana tabacum Against Encoding Polynucleotides RESULT 1 US-11-110-062-3 (NOTE: this sequence has 23 duplicates in the database searched. See complete list at the end of this report) Sequence 3, US/11110062 Patent No. 7700851 GENERAL INFORMATION APPLICANT: Xu, Dongmei TITLE OF INVENTION: Cloning of Cytochrome P450 Genes From Nicotiana FILE REFERENCE: 07678/141013 CURRENT APPLICATION NUMBER: US/11/110,062 CURRENT FILING DATE: 2005-04-19 PRIOR APPLICATION NUMBER: 60/665,451 PRIOR FILING DATE: 2005-03-24 PRIOR APPLICATION NUMBER: 60/665,097 PRIOR FILING DATE: 2005-03-24 PRIOR APPLICATION NUMBER: 60/646,764 PRIOR FILING DATE: 2005-01-25 PRIOR APPLICATION NUMBER: 60/607,357 PRIOR FILING DATE: 2004-09-03 PRIOR APPLICATION NUMBER: 60/566,235 PRIOR FILING DATE: 2004-04-29 PRIOR APPLICATION NUMBER: 10/934,944 PRIOR FILING DATE: 2004-09-03 PRIOR APPLICATION NUMBER: 10/943,507 PRIOR FILING DATE: 2004-09-17 PRIOR APPLICATION NUMBER: 60/503,989 PRIOR FILING DATE: 2003-09-18 PRIOR APPLICATION NUMBER: 60/485,368 PRIOR FILING DATE: 2003-07-08 PRIOR APPLICATION NUMBER: 60/418,933 PRIOR FILING DATE: 2002-10-16 Remaining Prior Application data removed - See File Wrapper or PALM. NUMBER OF SEQ ID NOS: 29 SEQ ID NO 3 LENGTH: 1554 TYPE: DNA ORGANISM: Tobacco Nicotine Demethylase Gene Coding Sequence Alignment Scores: Length: 1554 Score: 2733.00 Matches: 517 Percent Similarity: 100.0% Conservative: 0 Best Local Similarity: 100.0% Mismatches: 0 Query Match: 100.0% Indels: 0 Gaps: 0 US-18-810-533-2 (1-517) x US-11-110-062-3 (1-1554) Qy 1 MetLeuSerProIleGluAlaIleValGlyLeuValThrPheThrPheLeuPhePhePhe 20 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 ATGCTTTCTCCCATAGAAGCCATTGTAGGACTAGTAACCTTCACATTTCTCTTCTTCTTC 60 Qy 21 LeuTrpThrLysLysSerGlnLysProSerLysProLeuProProLysIleProGlyGly 40 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 CTATGGACAAAAAAATCTCAAAAACCTTCAAAACCCTTACCACCGAAAATCCCCGGAGGA 120 Qy 41 TrpProValIleGlyHisLeuPheHisPheAsnAspAspGlyAspAspArgProLeuAla 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 TGGCCGGTAATCGGCCATCTTTTCCACTTCAATGACGACGGCGACGACCGTCCATTAGCT 180 Qy 61 ArgLysLeuGlyAspLeuAlaAspLysTyrGlyProValPheThrPheArgLeuGlyLeu 80 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 CGAAAACTCGGAGACTTAGCTGACAAATACGGCCCCGTTTTCACTTTTCGGCTAGGCCTT 240 Qy 81 ProLeuValLeuValValSerSerTyrGluAlaValLysAspCysPheSerThrAsnAsp 100 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 CCCCTTGTCTTAGTTGTAAGCAGTTACGAAGCTGTAAAAGACTGTTTCTCTACAAATGAC 300 Qy 101 AlaIlePheSerAsnArgProAlaPheLeuTyrGlyAspTyrLeuGlyTyrAsnAsnAla 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 GCCATTTTTTCCAATCGTCCAGCTTTTCTTTACGGCGATTACCTTGGCTACAATAATGCC 360 Qy 121 MetLeuPheLeuAlaAsnTyrGlyProTyrTrpArgLysAsnArgLysLeuValIleGln 140 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 ATGCTATTTTTGGCCAATTACGGACCTTACTGGCGAAAAAATCGAAAATTAGTTATTCAG 420 Qy 141 GluValLeuSerAlaSerArgLeuGluLysPheLysHisValArgPheAlaArgIleGln 160 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 GAAGTTCTCTCCGCTAGTCGTCTCGAAAAATTCAAACACGTGAGATTTGCAAGAATTCAA 480 Qy 161 AlaSerIleLysAsnLeuTyrThrArgIleAspGlyAsnSerSerThrIleAsnLeuThr 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 481 GCGAGCATTAAGAATTTATATACTCGAATTGATGGAAATTCGAGTACGATAAATTTAACT 540 Qy 181 AspTrpLeuGluGluLeuAsnPheGlyLeuIleValLysMetIleAlaGlyLysAsnTyr 200 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 541 GATTGGTTAGAAGAATTGAATTTTGGTCTGATCGTGAAGATGATCGCTGGAAAAAATTAT 600 Qy 201 GluSerGlyLysGlyAspGluGlnValGluArgPheLysLysAlaPheLysAspPheMet 220 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 601 GAATCCGGTAAAGGAGATGAACAAGTGGAGAGATTTAAGAAAGCGTTTAAGGATTTTATG 660 Qy 221 IleLeuSerMetGluPheValLeuTrpAspAlaPheProIleProLeuPheLysTrpVal 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 661 ATTTTATCAATGGAGTTTGTGTTATGGGATGCATTTCCAATTCCATTATTTAAATGGGTG 720 Qy 241 AspPheGlnGlyHisValLysAlaMetLysArgThrPheLysAspIleAspSerValPhe 260 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 721 GATTTTCAAGGGCATGTTAAGGCTATGAAAAGGACTTTTAAAGATATAGATTCTGTTTTT 780 Qy 261 GlnAsnTrpLeuGluGluHisIleAsnLysArgGluLysMetGluValAsnAlaGluGly 280 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 781 CAGAATTGGTTAGAGGAACATATTAATAAAAGAGAAAAAATGGAGGTTAATGCAGAAGGG 840 Qy 281 AsnGluGlnAspPheIleAspValValLeuSerLysMetSerAsnGluTyrLeuGlyGlu 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 841 AATGAACAAGATTTCATTGATGTGGTGCTTTCAAAAATGAGTAATGAATATCTTGGTGAA 900 Qy 301 GlyTyrSerArgAspThrValIleLysAlaThrValPheSerLeuValLeuAspAlaAla 320 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 901 GGTTACTCTCGTGATACTGTCATTAAAGCAACGGTGTTTAGTTTGGTCTTGGATGCAGCA 960 Qy 321 AspThrValAlaLeuHisIleAsnTrpGlyMetAlaLeuLeuIleAsnAsnGlnLysAla 340 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 961 GACACAGTTGCTCTTCACATAAATTGGGGAATGGCATTATTGATAAACAATCAAAAGGCC 1020 Qy 341 LeuThrLysAlaGlnGluGluIleAspThrLysValGlyLysAspArgTrpValGluGlu 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1021 TTGACGAAAGCACAAGAAGAGATAGACACAAAAGTTGGTAAGGACAGATGGGTAGAAGAG 1080 Qy 361 SerAspIleLysAspLeuValTyrLeuGlnAlaIleValLysGluValLeuArgLeuTyr 380 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1081 AGTGATATTAAGGATTTGGTATACCTCCAAGCTATTGTTAAAGAAGTGTTACGATTATAT 1140 Qy 381 ProProGlyProLeuLeuValProHisGluAsnValGluAspCysValValSerGlyTyr 400 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1141 CCACCAGGACCTTTGTTAGTACCACACGAAAATGTAGAAGATTGTGTTGTTAGTGGATAT 1200 Qy 401 HisIleProLysGlyThrArgLeuPheAlaAsnValMetLysLeuGlnArgAspProLys 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1201 CACATTCCTAAAGGGACAAGATTATTCGCAAACGTCATGAAACTGCAACGTGATCCTAAA 1260 Qy 421 LeuTrpSerAspProAspThrPheAspProGluArgPheIleAlaThrAspIleAspPhe 440 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1261 CTCTGGTCTGATCCTGATACTTTCGATCCAGAGAGATTCATTGCTACTGATATTGACTTT 1320 Qy 441 ArgGlyGlnTyrTyrLysTyrIleProPheGlySerGlyArgArgSerCysProGlyMet 460 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1321 CGTGGTCAGTACTATAAGTATATCCCGTTTGGTTCTGGAAGACGATCTTGTCCAGGGATG 1380 Qy 461 ThrTyrAlaLeuGlnValGluHisLeuThrMetAlaHisLeuIleGlnGlyPheAsnTyr 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1381 ACTTATGCATTGCAAGTGGAACACTTAACAATGGCACATTTGATCCAAGGTTTCAATTAC 1440 Qy 481 ArgThrProAsnAspGluProLeuAspMetLysGluGlyAlaGlyIleThrIleArgLys 500 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1441 AGAACTCCAAATGACGAGCCCTTGGATATGAAGGAAGGTGCAGGCATAACTATACGTAAG 1500 Qy 501 ValAsnProValGluLeuIleIleAlaProArgLeuAlaProGluLeuTyr 517 ||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1501 GTAAATCCTGTGGAACTGATAATAGCGCCTCGCCTGGCACCTGAGCTTTAT 1551 RESULT 1 DQ205656 LOCUS DQ205656 1572 bp mRNA linear PLN 18-JAN-2007 DEFINITION Nicotiana tabacum nicotine demethylase mRNA, complete cds. ACCESSION DQ205656 VERSION DQ205656.1 KEYWORDS . SOURCE Nicotiana tabacum (common tobacco) ORGANISM Nicotiana tabacum Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana. REFERENCE 1 (bases 1 to 1572) AUTHORS Xu,D., Shen,Y., Chappell,J., Cui,M. and Nielsen,M.T. TITLE Biochemical and molecular characterizations of nicotine demethylase in tobacco JOURNAL Physiol. Plantarum 129, 307-319 (2007) REFERENCE 2 (bases 1 to 1572) AUTHORS Xu,D., Shen,Y. and Nielsen,M.T. TITLE Direct Submission JOURNAL Submitted (14-SEP-2005) USSTC, 100 West Putnam Avenue, Greenwich, CT 06830, USA FEATURES Location/Qualifiers source 1..1572 /organism="Nicotiana tabacum" /mol_type="mRNA" /cultivar="4407" /db_xref="taxon:4097" CDS 9..1562 /note="CYP450" /codon_start=1 /product="nicotine demethylase" /protein_id="ABB36475.1" /translation="MLSPIEAIVGLVTFTFLFFFLWTKKSQKPSKPLPPKIPGGWPVI GHLFHFNDDGDDRPLARKLGDLADKYGPVFTFRLGLPLVLVVSSYEAVKDCFSTNDAI FSNRPAFLYGDYLGYNNAMLFLANYGPYWRKNRKLVIQEVLSASRLEKFKHVRFARIQ ASIKNLYTRIDGNSSTINLTDWLEELNFGLIVKMIAGKNYESGKGDEQVERFKKAFKD FMILSMEFVLWDAFPIPLFKWVDFQGHVKAMKRTFKDIDSVFQNWLEEHINKREKMEV NAEGNEQDFIDVVLSKMSNEYLGEGYSRDTVIKATVFSLVLDAADTVALHINWGMALL INNQKALTKAQEEIDTKVGKDRWVEESDIKDLVYLQAIVKEVLRLYPPGPLLVPHENV EDCVVSGYHIPKGTRLFANVMKLQRDPKLWSDPDTFDPERFIATDIDFRGQYYKYIPF GSGRRSCPGMTYALQVEHLTMAHLIQGFNYRTPNDEPLDMKEGAGITIRKVNPVELII APRLAPELY Alignment Scores: Length: 1572 Score: 2733.00 Matches: 517 Percent Similarity: 100.0% Conservative: 0 Best Local Similarity: 100.0% Mismatches: 0 Query Match: 100.0% Indels: 0 Gaps: 0 US-18-810-533-2 (1-517) x DQ205656 (1-1572) Qy 1 MetLeuSerProIleGluAlaIleValGlyLeuValThrPheThrPheLeuPhePhePhe 20 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 9 ATGCTTTCTCCCATAGAAGCCATTGTAGGACTAGTAACCTTCACATTTCTCTTCTTCTTC 68 Qy 21 LeuTrpThrLysLysSerGlnLysProSerLysProLeuProProLysIleProGlyGly 40 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 69 CTATGGACAAAAAAATCTCAAAAACCTTCAAAACCCTTACCACCGAAAATCCCCGGAGGA 128 Qy 41 TrpProValIleGlyHisLeuPheHisPheAsnAspAspGlyAspAspArgProLeuAla 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 129 TGGCCGGTAATCGGCCATCTTTTCCACTTCAATGACGACGGCGACGACCGTCCATTAGCT 188 Qy 61 ArgLysLeuGlyAspLeuAlaAspLysTyrGlyProValPheThrPheArgLeuGlyLeu 80 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 189 CGAAAACTCGGAGACTTAGCTGACAAATACGGCCCCGTTTTCACTTTTCGGCTAGGCCTT 248 Qy 81 ProLeuValLeuValValSerSerTyrGluAlaValLysAspCysPheSerThrAsnAsp 100 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 249 CCCCTTGTCTTAGTTGTAAGCAGTTACGAAGCTGTAAAAGACTGTTTCTCTACAAATGAC 308 Qy 101 AlaIlePheSerAsnArgProAlaPheLeuTyrGlyAspTyrLeuGlyTyrAsnAsnAla 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 309 GCCATTTTTTCCAATCGTCCAGCTTTTCTTTACGGCGATTACCTTGGCTACAATAATGCC 368 Qy 121 MetLeuPheLeuAlaAsnTyrGlyProTyrTrpArgLysAsnArgLysLeuValIleGln 140 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 369 ATGCTATTTTTGGCCAATTACGGACCTTACTGGCGAAAAAATCGAAAATTAGTTATTCAG 428 Qy 141 GluValLeuSerAlaSerArgLeuGluLysPheLysHisValArgPheAlaArgIleGln 160 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 429 GAAGTTCTCTCCGCTAGTCGTCTCGAAAAATTCAAACACGTGAGATTTGCAAGAATTCAA 488 Qy 161 AlaSerIleLysAsnLeuTyrThrArgIleAspGlyAsnSerSerThrIleAsnLeuThr 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 489 GCGAGCATTAAGAATTTATATACTCGAATTGATGGAAATTCGAGTACGATAAATTTAACT 548 Qy 181 AspTrpLeuGluGluLeuAsnPheGlyLeuIleValLysMetIleAlaGlyLysAsnTyr 200 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 549 GATTGGTTAGAAGAATTGAATTTTGGTCTGATCGTGAAGATGATCGCTGGAAAAAATTAT 608 Qy 201 GluSerGlyLysGlyAspGluGlnValGluArgPheLysLysAlaPheLysAspPheMet 220 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 609 GAATCCGGTAAAGGAGATGAACAAGTGGAGAGATTTAAGAAAGCGTTTAAGGATTTTATG 668 Qy 221 IleLeuSerMetGluPheValLeuTrpAspAlaPheProIleProLeuPheLysTrpVal 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 669 ATTTTATCAATGGAGTTTGTGTTATGGGATGCATTTCCAATTCCATTATTTAAATGGGTG 728 Qy 241 AspPheGlnGlyHisValLysAlaMetLysArgThrPheLysAspIleAspSerValPhe 260 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 729 GATTTTCAAGGGCATGTTAAGGCTATGAAAAGGACTTTTAAAGATATAGATTCTGTTTTT 788 Qy 261 GlnAsnTrpLeuGluGluHisIleAsnLysArgGluLysMetGluValAsnAlaGluGly 280 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 789 CAGAATTGGTTAGAGGAACATATTAATAAAAGAGAAAAAATGGAGGTTAATGCAGAAGGG 848 Qy 281 AsnGluGlnAspPheIleAspValValLeuSerLysMetSerAsnGluTyrLeuGlyGlu 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 849 AATGAACAAGATTTCATTGATGTGGTGCTTTCAAAAATGAGTAATGAATATCTTGGTGAA 908 Qy 301 GlyTyrSerArgAspThrValIleLysAlaThrValPheSerLeuValLeuAspAlaAla 320 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 909 GGTTACTCTCGTGATACTGTCATTAAAGCAACGGTGTTTAGTTTGGTCTTGGATGCAGCA 968 Qy 321 AspThrValAlaLeuHisIleAsnTrpGlyMetAlaLeuLeuIleAsnAsnGlnLysAla 340 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 969 GACACAGTTGCTCTTCACATAAATTGGGGAATGGCATTATTGATAAACAATCAAAAGGCC 1028 Qy 341 LeuThrLysAlaGlnGluGluIleAspThrLysValGlyLysAspArgTrpValGluGlu 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1029 TTGACGAAAGCACAAGAAGAGATAGACACAAAAGTTGGTAAGGACAGATGGGTAGAAGAG 1088 Qy 361 SerAspIleLysAspLeuValTyrLeuGlnAlaIleValLysGluValLeuArgLeuTyr 380 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1089 AGTGATATTAAGGATTTGGTATACCTCCAAGCTATTGTTAAAGAAGTGTTACGATTATAT 1148 Qy 381 ProProGlyProLeuLeuValProHisGluAsnValGluAspCysValValSerGlyTyr 400 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1149 CCACCAGGACCTTTGTTAGTACCACACGAAAATGTAGAAGATTGTGTTGTTAGTGGATAT 1208 Qy 401 HisIleProLysGlyThrArgLeuPheAlaAsnValMetLysLeuGlnArgAspProLys 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1209 CACATTCCTAAAGGGACAAGATTATTCGCAAACGTCATGAAACTGCAACGTGATCCTAAA 1268 Qy 421 LeuTrpSerAspProAspThrPheAspProGluArgPheIleAlaThrAspIleAspPhe 440 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1269 CTCTGGTCTGATCCTGATACTTTCGATCCAGAGAGATTCATTGCTACTGATATTGACTTT 1328 Qy 441 ArgGlyGlnTyrTyrLysTyrIleProPheGlySerGlyArgArgSerCysProGlyMet 460 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1329 CGTGGTCAGTACTATAAGTATATCCCGTTTGGTTCTGGAAGACGATCTTGTCCAGGGATG 1388 Qy 461 ThrTyrAlaLeuGlnValGluHisLeuThrMetAlaHisLeuIleGlnGlyPheAsnTyr 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1389 ACTTATGCATTGCAAGTGGAACACTTAACAATGGCACATTTGATCCAAGGTTTCAATTAC 1448 Qy 481 ArgThrProAsnAspGluProLeuAspMetLysGluGlyAlaGlyIleThrIleArgLys 500 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1449 AGAACTCCAAATGACGAGCCCTTGGATATGAAGGAAGGTGCAGGCATAACTATACGTAAG 1508 Qy 501 ValAsnProValGluLeuIleIleAlaProArgLeuAlaProGluLeuTyr 517 ||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1509 GTAAATCCTGTGGAACTGATAATAGCGCCTCGCCTGGCACCTGAGCTTTAT 1559 Conclusion No claim is allowed. Contact information Any inquiry concerning this communication or earlier communications from the examiner should be directed to WAYNE ZHONG whose telephone number is (571)270-0311. The examiner can normally be reached 8:30am to 5:00pm EST. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Bratislav Stankovic, can be reached on 571-270-0305. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /Wayne Zhong/ Primary Examiner, Art Unit 1662
Read full office action

Prosecution Timeline

Aug 21, 2024
Application Filed
Jul 02, 2026
Non-Final Rejection mailed — §112 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12660775
WHEAT VARIETY 6PAZF90B
2y 5m to grant Granted Jun 23, 2026
Patent 12653122
TRITICALE CULTIVAR APT1415420
3y 9m to grant Granted Jun 16, 2026
Patent 12655440
GENETICALLY MODIFIED PLANTS THAT EXHIBIT AN INCREASE IN SEED YIELD COMPRISING A FIRST BIOTIN ATTACHMENT DOMAIN-CONTAINING (BADC) GENE HOMOZYGOUS FOR A WILD-TYPE ALLELE, A SECOND BADC GENE HOMOZYGOUS FOR A MUTANT ALLELE, AND HOMOLOGS OF THE FIRST AND SECOND BADC GENES
3y 5m to grant Granted Jun 16, 2026
Patent 12644127
HAPLOID MAIZE TRANSFORMATION
11y 1m to grant Granted Jun 02, 2026
Patent 12642235
SOYBEAN CULTIVAR 29120104
2y 3m to grant Granted Jun 02, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

Strategy Recommendation AI-generated — please review before filing

Get a prosecution strategy drawn from examiner precedents, rejection analysis, and claim mapping.
Typically takes 5-10 seconds — AI-generated, attorney review required before filing

Prosecution Projections

1-2
Expected OA Rounds
72%
Grant Probability
94%
With Interview (+21.6%)
2y 11m (~1y 0m remaining)
Median Time to Grant
Low
PTA Risk
Based on 536 resolved cases by this examiner. Grant probability derived from career allowance rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month