Prosecution Insights
Last updated: October 04, 2026
Application No. 18/818,418

HUMANIZED ANTIBODIES AGAINST NECTIN-2 AND DRUG CONJUGATES THEREOF

Non-Final OA §112§DP
Filed
Aug 28, 2024
Priority
Feb 28, 2022 — provisional 63/314,490 +1 more
Examiner
ALSOMAIRY, SARAH ABDOALATIF
Art Unit
Tech Center
Assignee
Nectin Therapeutics Ltd.
OA Round
1 (Non-Final)
58%
Grant Probability
Moderate
1-2
OA Rounds
1y 3m
Est. Remaining
88%
With Interview

Examiner Intelligence

Grants 58% of resolved cases
58%
Career Allowance Rate
89 granted / 154 resolved
-2.2% vs TC avg
Strong +30% interview lift
Without
With
+30.2%
Interview Lift
resolved cases with interview
Typical timeline
3y 4m
Avg Prosecution
46 currently pending
Career history
187
Total Applications
across all art units

Statute-Specific Performance

§101
3.0%
-37.0% vs TC avg
§103
35.1%
-4.9% vs TC avg
§102
15.6%
-24.4% vs TC avg
§112
28.5%
-11.5% vs TC avg
Black line = Tech Center average estimate • Based on career data from 154 resolved cases

Office Action

§112 §DP
Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . DETAILED ACTION Claims 1-14 are currently pending and under prosecution. Claim Rejections - 35 USC § 112 The following is a quotation of 35 U.S.C. 112(d): (d) REFERENCE IN DEPENDENT FORMS.—Subject to subsection (e), a claim in dependent form shall contain a reference to a claim previously set forth and then specify a further limitation of the subject matter claimed. A claim in dependent form shall be construed to incorporate by reference all the limitations of the claim to which it refers. The following is a quotation of pre-AIA 35 U.S.C. 112, fourth paragraph: Subject to the following paragraph [i.e., the fifth paragraph of pre-AIA 35 U.S.C. 112], a claim in dependent form shall contain a reference to a claim previously set forth and then specify a further limitation of the subject matter claimed. A claim in dependent form shall be construed to incorporate by reference all the limitations of the claim to which it refers. Claims 2-4 are rejected under 35 U.S.C. 112(d) or pre-AIA 35 U.S.C. 112, 4th paragraph, as being of improper dependent form for failing to further limit the subject matter of the claim upon which it depends, or for failing to include all the limitations of the claim upon which it depends. Claim 2 recites “The antibody of claim 1, wherein the CDR2 of the VH has an amino acid sequence according to SEQ ID NO: 41.” Claim 3 recites “The antibody of claim 1, wherein the CDR1 of the VL has an amino acid sequence according to SEQ ID NO: 43.” Claim 1 recites that the VH CDR2 sequence is SEQ ID NO: 2 and the VL CDR1 sequence is SEQ ID NO: 4. Claims 2 and 3 do not further limit claim 1. Applicant may cancel the claim(s), amend the claim(s) to place the claim(s) in proper dependent form, rewrite the claim(s) in independent form, or present a sufficient showing that the dependent claim(s) complies with the statutory requirements. Claim Interpretation Examiner has interpreted claims 2-4 to replace the VH CDR2 of claim 1 and the VL CDR1 of claim 1 sequences with the respective sequences listed in the claims. That is, the sequences of the antibody of claims 2-4 will be interpreted as: Claim 2: VH CDR1-3: SEQ ID NO: 1-41-3; VL CDR 1-3: SEQ ID NO: 4-5-6 Claim 3: VH CDR1-3: SEQ ID NO: 1-2-3; VL CDR1-3: SEQ ID NO: 43-5-6 Claim 4: VH CDR1-3: 1-41-3; CDR1-3: SEQ ID NO: 43-5-6 Double Patenting The nonstatutory double patenting rejection is based on a judicially created doctrine grounded in public policy (a policy reflected in the statute) so as to prevent the unjustified or improper timewise extension of the “right to exclude” granted by a patent and to prevent possible harassment by multiple assignees. A nonstatutory double patenting rejection is appropriate where the conflicting claims are not identical, but at least one examined application claim is not patentably distinct from the reference claim(s) because the examined application claim is either anticipated by, or would have been obvious over, the reference claim(s). See, e.g., In re Berg, 140 F.3d 1428, 46 USPQ2d 1226 (Fed. Cir. 1998); In re Goodman, 11 F.3d 1046, 29 USPQ2d 2010 (Fed. Cir. 1993); In re Longi, 759 F.2d 887, 225 USPQ 645 (Fed. Cir. 1985); In re Van Ornum, 686 F.2d 937, 214 USPQ 761 (CCPA 1982); In re Vogel, 422 F.2d 438, 164 USPQ 619 (CCPA 1970); In re Thorington, 418 F.2d 528, 163 USPQ 644 (CCPA 1969). A timely filed terminal disclaimer in compliance with 37 CFR 1.321(c) or 1.321(d) may be used to overcome an actual or provisional rejection based on nonstatutory double patenting provided the reference application or patent either is shown to be commonly owned with the examined application, or claims an invention made as a result of activities undertaken within the scope of a joint research agreement. See MPEP § 717.02 for applications subject to examination under the first inventor to file provisions of the AIA as explained in MPEP § 2159. See MPEP § 2146 et seq. for applications not subject to examination under the first inventor to file provisions of the AIA . A terminal disclaimer must be signed in compliance with 37 CFR 1.321(b). The filing of a terminal disclaimer by itself is not a complete reply to a nonstatutory double patenting (NSDP) rejection. A complete reply requires that the terminal disclaimer be accompanied by a reply requesting reconsideration of the prior Office action. Even where the NSDP rejection is provisional the reply must be complete. See MPEP § 804, subsection I.B.1. For a reply to a non-final Office action, see 37 CFR 1.111(a). For a reply to final Office action, see 37 CFR 1.113(c). A request for reconsideration while not provided for in 37 CFR 1.113(c) may be filed after final for consideration. See MPEP §§ 706.07(e) and 714.13. The USPTO Internet website contains terminal disclaimer forms which may be used. Please visit www.uspto.gov/patent/patents-forms. The actual filing date of the application in which the form is filed determines what form (e.g., PTO/SB/25, PTO/SB/26, PTO/AIA /25, or PTO/AIA /26) should be used. A web-based eTerminal Disclaimer may be filled out completely online using web-screens. An eTerminal Disclaimer that meets all requirements is auto-processed and approved immediately upon submission. For more information about eTerminal Disclaimers, refer to www.uspto.gov/patents/apply/applying-online/eterminal-disclaimer. Claims 4 is rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1-2 of U.S. Patent No. 12,545,727. Although the claims at issue are not identical, they are not patentably distinct from each other because the U.S. Patent recites an antibody that binds to Nectin-2 or antigen-binding fragment thereof, comprising the instantly claimed sequences of the antibody. [See sequence alignments below] SEQ ID NOS: 1-41-3 RESULT 1 US-17-421-885A-17 Sequence 17, US/17421885A Patent No. 12545727 GENERAL INFORMATION APPLICANT: Yissum Research Development Company of the Hebrew APPLICANT: University of Jerusalem Ltd. APPLICANT: University of Rijeka Faculty of Medicine TITLE OF INVENTION: ANTIBODIES SPECIFIC TO HUMAN NECTIN-2 FILE REFERENCE: 169.0142-US00 CURRENT APPLICATION NUMBER: US/17/421,885A CURRENT FILING DATE: 2021-08-05 PRIOR APPLICATION NUMBER: PCT/IL2020/050047 PRIOR FILING DATE: 2020-01-13 PRIOR APPLICATION NUMBER: US 62/791808 PRIOR FILING DATE: 2019-01-13 NUMBER OF SEQ ID NOS: 32 SEQ ID NO 17 LENGTH: 116 TYPE: PRT ORGANISM: Mus musculus Query Match 85.0%; Score 139.4; Length 116; Best Local Similarity 38.7%; Matches 29; Conservative 0; Mismatches 0; Indels 46; Gaps 2; Qy 1 SYWIH--------------AVYPGNSDSNYNQKFKA------------------------ 22 ||||| ||||||||||||||||| Db 31 SYWIHWVKQRPGQGLEWIGAVYPGNSDSNYNQKFKAKAKLTAVTSTSTAYMELSSLTSED 90 Qy 23 --------LVGTFDY 29 ||||||| Db 91 SAVYYCTKLVGTFDY 105 SEQ ID NOS: 43-5-6 RESULT 1 US-17-421-885A-18 Sequence 18, US/17421885A Patent No. 12545727 GENERAL INFORMATION APPLICANT: Yissum Research Development Company of the Hebrew APPLICANT: University of Jerusalem Ltd. APPLICANT: University of Rijeka Faculty of Medicine TITLE OF INVENTION: ANTIBODIES SPECIFIC TO HUMAN NECTIN-2 FILE REFERENCE: 169.0142-US00 CURRENT APPLICATION NUMBER: US/17/421,885A CURRENT FILING DATE: 2021-08-05 PRIOR APPLICATION NUMBER: PCT/IL2020/050047 PRIOR FILING DATE: 2020-01-13 PRIOR APPLICATION NUMBER: US 62/791808 PRIOR FILING DATE: 2019-01-13 NUMBER OF SEQ ID NOS: 32 SEQ ID NO 18 LENGTH: 107 TYPE: PRT ORGANISM: Mus musculus Query Match 82.2%; Score 114.3; Length 107; Best Local Similarity 36.5%; Matches 27; Conservative 0; Mismatches 0; Indels 47; Gaps 2; Qy 1 KASQNVGINVV---------------SASYRYS--------------------------- 18 ||||||||||| ||||||| Db 24 KASQNVGINVVWYQQRAGQSPKTLIYSASYRYSGVPDRFTGSGSGTDFTLTISNVQSEDL 83 Qy 19 -----QQYNTNPFT 27 ||||||||| Db 84 AEYFCQQYNTNPFT 97 Allowable Subject Matter/Closest Prior Art Claims 1 and 5-14 are allowed. The closest prior art made of record is Sato et al (US20100008928 A1; Published 1/14/2010). Sato teaches an antibody that binds to Nectin-2. However, the art does not teach anti-Nectin-2 antibodies comprising the instantly claimed sequences. Conclusion Conclusion: Claims 1 and 5-14 are allowed. Claims 2 and 3 are rejected. Any inquiry concerning this communication or earlier communications from the examiner should be directed to SARAH A ALSOMAIRY whose telephone number is (571)272-0027. The examiner can normally be reached Monday-Friday 7:30 AM to 5:30 PM. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Gregory Emch can be reached at (571) 272-8149. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /SARAH A ALSOMAIRY/Examiner, Art Unit 1646
Read full office action

Prosecution Timeline

Aug 28, 2024
Application Filed
Sep 24, 2026
Non-Final Rejection mailed — §112, §DP (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12702702
APPLICATION OF CAERIN 1.1/1.9 COMBINED WITH ANTI-CD47 ANTIBODY IN PREPARING DRUG FOR TREATING MELANOMA
1y 2m to grant Granted Aug 11, 2026
Patent 12698343
COMBINATION OF BISPECIFIC FUSION PROTEIN AND ANTI-Her2 ANTIBODY FOR TUMOR TREATMENT
4y 2m to grant Granted Aug 04, 2026
Patent 12692518
THERAPEUTIC GENOME EDITING IN WISKOTT-ALDRICH SYNDROME AND X-LINKED THROMBOCYTOPENIA
3y 3m to grant Granted Jul 28, 2026
Patent 12667606
FORMULATIONS OF PROTEIN MOLECULES COMPRISING IDURONATE 2-SULFATASE
4y 9m to grant Granted Jun 30, 2026
Patent 12668644
ANTIBODY-BASED METHOD TO IDENTIFY, PURIFY, AND MANIPULATE CELL TYPES AND PROCESSES
4y 7m to grant Granted Jun 30, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

Strategy Recommendation AI-generated — please review before filing

Get a prosecution strategy drawn from examiner precedents, rejection analysis, and claim mapping.
Typically takes 5-10 seconds — AI-generated, attorney review required before filing

Prosecution Projections

1-2
Expected OA Rounds
58%
Grant Probability
88%
With Interview (+30.2%)
3y 4m (~1y 3m remaining)
Median Time to Grant
Low
PTA Risk
Based on 154 resolved cases by this examiner. Grant probability derived from career allowance rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month