Prosecution Insights
Last updated: July 05, 2026
Application No. 18/830,256

NOVEL INSECT INHIBITORY PROTEINS

Non-Final OA §101§112§DP
Filed
Sep 10, 2024
Priority
Dec 20, 2016 — provisional 62/436,736 +3 more
Examiner
ZHONG, WAYNESHAOBIN
Art Unit
1662
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Monsanto Technology LLC
OA Round
1 (Non-Final)
72%
Grant Probability
Favorable
1-2
OA Rounds
1y 1m
Est. Remaining
94%
With Interview

Examiner Intelligence

Grants 72% — above average
72%
Career Allowance Rate
388 granted / 536 resolved
+12.4% vs TC avg
Strong +21% interview lift
Without
With
+21.4%
Interview Lift
resolved cases with interview
Typical timeline
2y 11m
Avg Prosecution
25 currently pending
Career history
559
Total Applications
across all art units

Statute-Specific Performance

§101
3.2%
-36.8% vs TC avg
§103
58.7%
+18.7% vs TC avg
§102
10.3%
-29.7% vs TC avg
§112
17.7%
-22.3% vs TC avg
Black line = Tech Center average estimate • Based on career data from 536 resolved cases

Office Action

§101 §112 §DP
DETAILED ACTION Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Information Disclosure Statement The Information Disclosure Statements filed on 9/10/2024, 1/17/2025, 3/13/2025 have been entered and considered. Initialed copies of the form PTO-1449 are enclosed with this action. Election/Restrictions and status of claims On 5/6/2026, the applicant elected amino acid sequence of SEQ ID NO: 36 and its encoding polynucleotide SEQ ID NO: 35 with traverse, and requested that amino acid sequence of SEQ ID NO: 51 and its encoding polynucleotide SEQ ID NO: 50 that have substantial sequence identity percentage to the elected species (supported by sequence alignment), thus, be examined. The request is accepted. In summary, claims 1-28 are pending and examined in the office action. SEQ ID NOs: 35-36 and 50-51 are examined in the office action. Non-elected species are withdrawn. The restriction is made final. Priority Instant 18830256, filed 09/10/2024, is a Divisional of 17938016, filed 10/04/2022, now U.S. Patent # 12123011. 17938016 is a Divisional of 16895921, filed 06/08/2020, now U.S. Patent # 11492640. 16895921 is a Divisional of 15846796, filed 12/19/2017, now U.S. Patent # 10717989. 15846796 Claims Priority from Provisional Application 62436736, filed 12/20/2016. 62436736 disclosed the claimed subject matter including elected SEQ ID NOs: 35-36, 50-51. Thus, the priority of 12/20/2016 is recognized. Claim Rejections - 35 USC § 112 Indefiniteness The following is a quotation of 35 U.S.C. 112(b): (b) CONCLUSION—The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the inventor or a joint inventor regards as the invention. Claims 25-26 are rejected under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter which the inventor or a joint inventor, or for pre-AIA the applicant regards as the invention. Claim 25 recites “the like” (line 4) and “such as” (line 5). Regarding “the like”, The phrase "the like" renders the claim indefinite because the claim includes elements not actually disclosed (those encompassed by "the like"), thereby rendering the scope of the claim(s) unascertainable. See MPEP § 7.34.09 and 2173.05(d). In this case, while “corn flakes, corn cakes, corn flour, corn meal, corn syrup, corn oil, corn silage, corn starch, corn cereal” are disclosed, “the like” is not disclosed, thereby rendering the scope of the claim(s) unascertainable. Regarding the phrase “such as”, description of examples or preferences is properly set forth in the specification rather than the claims. If stated in the claims, examples and preferences may lead to confusion over the intended scope of a claim. In those instances where it is not clear whether the term after the “such as” (fuel derived from cotton oil) is a limitation, a rejection under 35 U.S.C. 112, second paragraph should be made. See MPEP § 2173.05(d). In this case, it is unclear whether the recitation(s) following the phrase “such as” is a claim limitation or merely an example. Appropriate corrections and clarifications are required. Claim 26 recites “a. planting at least a seed of claim 13”. b and c also recite said seed. However, neither of the parent claims 1 and 13 recites any seed. In contrary, claim 1 recites a recombinant nucleic acid molecule, and claim 13 recites the recombinant nucleic acid molecule of claim 1. Thus, such seed does not have antecedent base in the parent claim(s), which renders the claim indefinite. Appropriate correction is required. Lacking written description The following is a quotation of the first paragraph of 35 U.S.C. 112(a): (a) IN GENERAL—The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor or joint inventor of carrying out the invention. Claims 1-28 are rejected under 35 U.S.C. 112(a), as failing to comply with the written description requirement. The claim(s) contains subject matter which was not described in the specification in such a way as to reasonably convey to one skilled in the relevant art that the inventor or a joint inventor, or for pre-AIA the inventor(s), at the time the application was filed, had possession of the claimed invention. To claim a genus under the written description requirement, the applicant is required to describe a representative number of species to reflect the variation within the genus or structures sufficient to define the genus. The factors to be considered include disclosure of complete or partial structure, physical and/or chemical properties, functional characteristics, structure/function correlation, methods of making the claimed product, or any combinations thereof. By court’s statement in Regents of the Univ. of Cal. v. Eli Lilly, 119 F.3d 1559, 1566, 43 USPQ2d 1398, 1404 (Fed. Cir. 1997), a written description of an invention “requires a precise definition, such as a structure, formula, or chemical name, of the claimed subject matter sufficient to distinguish it from other materials”; further, a written description of a claimed genus requires a description of a representative number of species of the claimed genus, and one of skill in the art should be able to “visualize or recognize the identity of the members of the genus”. The claims are broadly drawn to a genus of polynucleotide segments encoding a genus of polypeptide sequences having at least 62% sequence identities to SEQ ID NO: 36 or SEQ ID NO: 51 (elected) or a genus of fragments thereof, or a genus of polynucleotide segments hybridizing to SEQ ID NO: 35 or SEQ ID NO: 50 (encoding SEQ ID NO: 36 or SEQ ID NO: 51), a genus of plants comprising above sequences, and a genus of methods of using the sequences to contact pests. The claimed function is encoding pesticidal proteins that express pesticidal activity. The specification describes the structure of SEQ ID NOs: 36 and 51 and encoding sequences SEQ ID NOs: 35 and 50 by providing sequence information in sequence listing. According to the specification ([0061]-[0062], [0076]-[0077]), SEQ ID NO: 36 is the amino acid sequence of a TIC7108 protein, SEQ ID NO: 35 is the encoding sequence of the TIC7108 protein; SEQ ID NO: 51 is amino acid sequence of TIC7108PL, wherein an additional alanine residue is inserted immediately following the initiating methionine, SEQ ID NO:50 is a synthetic coding sequence encoding a TIC7108PL pesticidal protein designed for expression in a plant cell, wherein an additional codon encoding an alanine residue is inserted immediately following the initiating methionine codon. The specification also demonstrated pesticidal activity of TIC7108 against number of species of pests WCR, CPB, and SGSB only (Coleopteran and Hemipteran) (Example 2, [0193], Table 10); and against SWC and DBM only (Lepidopteran) (Example 2, [0193], Table 11). 1) However, the specification does not describe the common structure feature and sufficient connection to the claimed pesticidal activity of polynucleotides encoding the genus of sequences having at least 62% sequence identities to SEQ ID NO: 53 or 39, and fragments thereof. The specification does not describe the conservative domain(s) of TIC7108 proteins. The specification also does not have any example of SEQ ID NO: 36 or 50 having percent identity change(s) and maintaining the pesticidal activity. According to the specification ([0187]), sequence identity and protein similarity were obtained by high throughput sequencing and bioinformatics tools. However, in the art, Friedberg (Automated protein function prediction--the genomic challenge, BRIEFINGS IN BIOINFORMATICS. VOL 7. NO 3. 225-242, 2006) teaches that homology-based transfer is not reliable for functional annotation even with high- alignment percentages (page 227, second column). Friedberg also teaches that identification of functionally significant sub-regions is critical to functional annotation, and that often addition, deletion, or re-shuffling of domains can lead to errors in annotation (page 227, second column; page 228, 1st paragraph). Friedberg teaches that sequence-based tools are just not sensitive enough to identify functional protein similarity as databases get larger, and diversity of sequences gets larger (page 228, first full paragraph). Thus, the sequences and percentage identical thereof obtained by algorisms of bioinformatics tools are not consistent or reliable. Wang et al (From Protein Sequence to Protein Function via Multi-Label Linear Discriminant Analysis. TRANSACTIONS ON COMPUTATIONAL BIOLOGYAND BIOINFORMATICS, 503-513, 2017) teach that FASTA and Basic Local Alignment Search Tool (BLAST) are useful but have limitations. Because a duplicate of a gene could adopt a new function in response to selective pressure during evolution, function transfer by homology on such gene and its product could produce erroneous results (p503, left col, 2nd para). There is no literature addressing the issue which criterion and which algorithm is optimal for protein function prediction. Moreover, genes evolve at different rates due to both uneven selection pressure on their functions and the inherent mutation rate of different species, which means that it is difficult to establish a similarity measure that is reliable in all cases (p504, left col, 1st para). Computational approaches to predict protein function is to assist biologist to discover new functional roles of proteins for experimental verification (p508, right col, last para). Thus, the sequences and percentage identical thereof obtained by algorisms of bioinformatics tools are not consistent or reliable. Experimental data is the most reliable, specifically for new proteins and new functions. In this case, SEQ ID NO: 53 or 39 and the pesticidal activity are new protein and new function. Accordingly, experimental data is the most reliable. Accordingly, neither the specification nor the prior art describes the common structure feature of the claimed genus. Thus, changing SEQ ID NO: 36 or 51 by 38% (or 6%) likely will lose the pesticidal activity of SEQ ID NO: 36 or 51. A fragment of SEQ ID NO: 36 or 51 as short as 2 amino acids does not likely have any pesticidal activity. 2) However, the specification also does not describe the common structure feature and sufficient connection to the claimed pesticidal activity of the genus of polynucleotide segments hybridizing to SEQ ID NO: 35 or SEQ ID NO: 50. The specification also does not have any example of the claimed segments that encode any protein maintaining the pesticidal activity. In prior art, Fourgoux-Nicol et al (Isolation of rapeseed genes expressed early and specifically during development of the male gametophyte. Plant Molecular Biology 40: 857–872, 1999) teach that the identification of a 674bp fragment using a 497bp probe incorporating stringent hybridization conditions comprising three consecutive 30 minute rinses in 2X, 1X and 0.1X SSC with 0.1% SDS at 65°C (page 859, left column, 2nd paragraph). Fourgoux-Nicol et al also teach that the probe and identified DNA fragment exhibited a number of sequence differences comprising a 99bp insertion within the probe and a single nucleotide gap, while the DNA fragment contained 2 single nucleotide gaps and together the fragments contained 27 nucleotide mismatches. Taking into account the insertions, gaps and mismatches, the longest stretch of contiguous nucleotides to which the probe could hybridize consisted of 93bp of DNA (page 862, Figure 2). Thus, the sequences and percentage identical thereof obtained by hybridizations are not consistent or reliable. Furthermore, a hybridizing sequence can be longer or shorter than the template sequence. Many conditions, such as the length, composition, and concentration of the polynucleotides significantly affect hybridization of polynucleotides. Accordingly, neither the specification nor the prior art describes the common structure feature of the claimed genus. 3) Regarding claims 8, 10, 12-14, the specification also does not have any example that SEQ ID NO: 36 or 51 or any has any activity against other species except WCR, CPB, and SGSB only (Coleopteran and Hemipteran) and SWC and DBM only (Lepidopteran). In contrary, the specification also demonstrated that TIC7108 had no activities against pests except WCR, CPB, and SGSB only and SWC and DBM only (Example 2, [0193], Tables 10-11). These species were claimed in claims 8, 10 and 12, but were not described. The specification dose not demonstrate that TIC7108 has activity against order of Thysanoptera as claimed in claim 13, nor any species claimed in claim 14. Regarding the element of the description of a representative number of species: SEQ ID NO: 36 is a polypeptide sequence of 274 amino acids. For at least 62% sequence identity, up to 38%, or 104 amino acids, can be substituted, deleted, or added. Thus, (104+103+102+ ...... +3+2+1) amino acids can be substituted, deleted, or added. In addition, each position can be substituted with at least 19 amino acids, and each peptide species of the genus can be 170-388 amino acids long. SEQ ID NO: 51 is a polypeptide sequence of 275 amino acids. For at least 62% sequence identity, up to 38%, or 104 amino acids, can be substituted, deleted, or added. Thus, (104+103+102+ ...... +3+2+1) amino acids can be substituted, deleted, or added. In addition, each position can be substituted with 19 amino acids, and each peptide species of the genus can be 171-389 amino acids long. The fragments thereof encompass peptides as short as a few amino acids. Since an amino acid can be coded by more than one codon, the polynucleotides encoding the above peptides are an even larger number. The genus of segments hybridizing to SEQ ID NO: 52 or 38 can be longer or shorter than the template sequence, thus are extremely large number. Thus, the claimed genera of sequences are extremely large numbers. Again, as analyzed above, the sequences are heterogeneous in structure, amino acid changes can affect pesticidal activity, and specificities. Therefore, the application has not met either of the two elements of the written description requirement as set forth in the court’s decision in Eli Lilly, and has not shown her/his possession of the claimed genus/genera. Dependent claims do not cure the deficiency, thus, are included. Scope of enablement The following is a quotation of the first paragraph of 35 U.S.C. 112(a): (a) IN GENERAL—The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor or joint inventor of carrying out the invention. Claims 8, 10, 12-14 are rejected under 35 U.S.C. 112(a), because the specification, while being enabling for using SEQ ID NOs: 36 or 51 (TIC7108) for conferring pesticidal activity against pest species of WCR, CPB, and SGSB (order of Coleopteran and Hemipteran) and SWC and DBM (order of Lepidopteran), does not reasonably provide enablement for using the SED ID NO for conferring pesticidal activity against other pest species recited in the claims including other species as claimed. The specification does not enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the invention commensurate in scope with these claims. Claim 8 claims pesticidal activity of SEQ ID NO: 36 or 51 against insect species Western Corn Rootworm (WCR), Southern Corn Rootworm (SCRW), Northern Corn Rootworm (NCRW), Mexican Corn Rootworm (MCRW), Brazilian Corn Rootworm (BCRW). Claim 10 claims pesticidal activity of SEQ ID NO: 36 or 51 against insect species Velvet bean caterpillar (VBC), Sugarcane borer (SB), Lesser cornstalk borer (LCB), Corn earworm (CEW), Tobacco budworm (TBW), Soybean looper (SL), Black armyworm (BAW), Southern armyworm (SAW), Fall armyworm (FAW), Beet armyworm (BAW), Old World bollworm (OWB), Oriental leaf worm (OLW), Pink bollworm (PBW), Black cutworm (BCW), Southwestern Corn Borer (SCB), and European corn borer (ECB). Claim 12 claims pesticidal activity of SEQ ID NO: NO: 36 or 51 against insect species Southern Green Stinkbug, Neotropical Brown Stinkbug, Western Tarnished Plant Bug, and Tarnished Plant Bug. Claims 13-14 claims pesticidal activity of SEQ ID NO: NO: 36 or 51 against insect order of Thysanoptera, and species Tobacco Thrips, Flower Thrips, Western Flower Thrips, and Soybean Thrips. The specification only provides examples serving as guidance of pesticidal activity of TIC7108 (SEQ ID NOs: 36 and 51) against number of species of pests WCR, CPB, and SGSB only (Coleopteran and Hemipteran) (Example 2, [0193], Table 10); and against SWC and DBM only (Lepidopteran) (Example 2, [0193], Table 11). However, TIC7108 toxin showed negative activity against all other species (claimed in claims 8, 10 and 12) other than WCR, CPB, and SGSB, SWC and DBM (Example 2, [0193], Tables 10-11). The specification also does not provide guidance that TIC7108 has activity against order of Thysanoptera as claimed in claim 13, nor any species claimed in claim 14. Furthermore, in prior art, there is no knowledge of using SEQ ID NO: 36 and SEQ ID NO: 51 (both new proteins) to confer pest resistance. MPEP 2164 provides the Enablement Requirement. MPEP section 2164.01 states "Any analysis of whether a particular claim is supported by the disclosure in an application requires a determination of whether that disclosure, when filed, contained sufficient information regarding the subject matter of the claims as to enable one skilled in the pertinent art to make and use the claimed invention". The standard for determining whether the specification meets the enablement requirement was cast in the Supreme Court decision of Mineral Separation v. Hyde, 242 U.S. 261, 270 (1916) which postured the question: is the experimentation needed to practice the invention undue or unreasonable? That standard is still the one to be applied. In re Wands, 858 F.2d 731, 737, 8 USPQ2d 1400, 1404 (Fed. Cir. 1988). Accordingly, even though the statute does not use the term "undue experimentation," it has been interpreted to require that the claimed invention be enabled so that any person skilled in the art can make and use the invention without undue experimentation. Therefore, given the claim breadth, lack of guidance in the specification, unpredictability in the prior art, particularly the amount of direction provided by the inventor, undue experimentation would have been required by one skilled in the art to make and use the invention as broadly claimed. Claim Rejections - 35 USC § 101 35 U.S.C. 101 reads as follows: Whoever invents or discovers any new and useful process, machine, manufacture, or composition of matter, or any new and useful improvement thereof, may obtain a patent therefor, subject to the conditions and requirements of this title. Claims 27-28 are rejected under 35 U.S.C. 101 because the claimed invention is directed to non-statutory subject matter. The claimed invention is directed to a judicial exception (natural product and natural process) without significantly more. Regarding claim 27, the claim recites a plant comprising an insecticidally effective amount of a pesticidal protein comprising SEQ ID NO: 36 or SEQ ID NO: 51 (elected). According to the specification ([0159]), a "recombinant DNA molecule" is a DNA molecule comprising a combination of DNA molecules that would not naturally occur together without human intervention”. The specification does not define or describe “effective amount”. According to the sequence listing, SEQ ID NO: 51 is a synthetic sequence, which is not natural. However, SEQ ID NO: 36 is a sequence from Lysinibacillus sphaericu, which is natural. Lysinibacillus sphaericus exists naturally in the soil, and many plant species naturally host Lysinibacillus sphaericus. For example, Ali et al (Ex Vivo Application of Secreted Metabolites Produced by Soil-Inhabiting Bacillus spp. Efficiently Controls Foliar Diseases Caused by Alternaria spp. Applied and Environmental Microbiology. P478-490, 2016) reported that plants of Impatiens sp. naturally host Lysinibacillus sphaericus (page 479, table 1). Thus, the claimed plant encompasses such natural plant hosting Lysinibacillus sphaericus comprising SEQ ID NO: 36. The resistance to insect infection is an inherent property of the host plant. There is no non-natural product added, not to mention significantly more, to such natural product. Therefore, claim 27 is directed to natural product without significantly more. Regarding claim 28, the claim recites a method of contacting pests with insecticidally effective amount of SEQ ID NO: 36. As analyzed above, some plants naturally host Lysinibacillus sphaericus comprising SEQ ID NO: 36. Thus, “contacting pests” with SEQ ID NO: 36 encompasses the natural process of pests contacting plants. This is no non-natural step(s) added to the natural process, not to mention significantly more. This is also no non-natural practical step. Therefore, claim 28 is directed to natural process without significantly more. Double Patenting The nonstatutory double patenting rejection is based on a judicially created doctrine grounded in public policy (a policy reflected in the statute) so as to prevent the unjustified or improper timewise extension of the “right to exclude” granted by a patent and to prevent possible harassment by multiple assignees. A nonstatutory double patenting rejection is appropriate where the claims at issue are not identical, but at least one examined application claim is not patentably distinct from the reference claim(s) because the examined application claim is either anticipated by, or would have been obvious over, the reference claim(s). See, e.g., In re Berg, 140 F.3d 1428, 46 USPQ2d 1226 (Fed. Cir. 1998); In re Goodman, 11 F.3d 1046, 29 USPQ2d 2010 (Fed. Cir. 1993); In re Longi, 759 F.2d 887, 225 USPQ 645 (Fed. Cir. 1985); In re Van Ornum, 686 F.2d 937, 214 USPQ 761 (CCPA 1982); In re Vogel, 422 F.2d 438, 164 USPQ 619 (CCPA 1970); and In re Thorington, 418 F.2d 528, 163 USPQ 644 (CCPA 1969). A timely filed terminal disclaimer in compliance with 37 CFR 1.321(c) or 1.321(d) may be used to overcome an actual or provisional rejection based on a nonstatutory double patenting ground provided the reference application or patent either is shown to be commonly owned with this application, or claims an invention made as a result of activities undertaken within the scope of a joint research agreement. A terminal disclaimer must be signed in compliance with 37 CFR 1.321(b). The USPTO internet Web site contains terminal disclaimer forms which may be used. Please visit http://www.uspto.gov/forms/. The filing date of the application will determine what form should be used. A web-based eTerminal Disclaimer may be filled out completely online using web-screens. An eTerminal Disclaimer that meets all requirements is auto-processed and approved immediately upon submission. For more information about eTerminal Disclaimers, refer to http://www.uspto.gov/patents/process/file/efs/guidance/eTD-info-I.jsp. There are 3 rejections. Instant application shares multiple inventors with the 3 US Patents. Monsanto is the applicant of instant application and the US Patents. Claims 1-28 are rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1-26 of US Patent 12123011. Although the claims at issue are not identical, they are not patentably distinct from each other because: The USP claims SEQ ID NOs: 39 and 53 and sequences having at least 95% sequence identity thereof. By sequence matches, SEQ ID NO: 39 of the US Patent is 99. 6% identical to instant SEQ ID NO: 53, and 99.3% identical to instant SEQ ID NO: 36. SEQ ID NO: 53 of the US Patent is 99.0% identical to instant SEQ ID NO: 51, and 99.6% identical to instant SEQ ID NO: 51. See “Sequence Matches” at the end of office action. Thus, SEQ ID NOs: 39 and 53 of the US Patent are species of the instant genus of amino acid sequences having at least 62% sequence identity to instant SEQ ID NO: 36 or SEQ ID NO: 51. Accordingly, claims 1 the US Patent anticipates instant claim 1. Regarding the dependent claims, not only the subject matter recited, but also the claim languages, of the US Patent and instant application, are essentially the same. Therefore, the claims are obvious over each other. Note: the examiner has noticed that instant application is a division of the US Patent. However, according to MPEP 804.04, in a divisional application, a nonstatutory double patenting rejection may be appropriate in situations in which the invention presented in the divisional is not the same invention that was the subject of the restriction requirement. In this case, by sequence alignment performed by the examiner, SEQ ID NOs: 39 and 53 are identical in instant application and the US Patent. According to instant specification (BRIEF DESCRIPTION OF THE SEQUENCES, [0027]-[0125]), SEQ ID NO: 39 and 53 of US Patent are TIC7110 toxins. TIC7110 has different activity and specificity from that of instant TIC7108 toxins ([0193], Tables 10-11). Thus, SEQ ID NOs: 39 and 53 of US Patent are a different toxin from SEQ ID NOs: 36 and 51, and should not have been rejoined in the US Patent. Therefore, the double patenting rejection is proper. Claims 1-28 are rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1-31 of US Patent 11492640. Although the claims at issue are not identical, they are not patentably distinct from each other because: The USP claims SEQ ID NOs: 33 and 49 and sequences having at least 95% sequence identity thereof. By sequence matches, SEQ ID NO: 39 of the US Patent is 96.2% identical to instant SEQ ID NO: 36, and 95.5% identical to instant SEQ ID NO: 51. SEQ ID NO: 49 of the US Patent is 95.8% identical to instant SEQ ID NO: 36, and 96.2% identical to instant SEQ ID NO: 51. See “Sequence Matches” at the end of office action. Thus, SEQ ID NOs: 33 and 49 of the US Patent are species of the instant genus of amino acid sequences having at least 62% sequence identity to instant SEQ ID NO: 36 or SEQ ID NO: 51. Accordingly, claims 1 the US Patent anticipates instant claim 1. Regarding the dependent claims, not only the subject matter recited, but also the claim languages, of the US Patent and instant application, are essentially the same. Therefore, the claims are obvious over each other. Note: the examiner has noticed that instant application is a division of the US Patent. However, according to MPEP 804.04, in a divisional application, a nonstatutory double patenting rejection may be appropriate in situations in which the invention presented in the divisional is not the same invention that was the subject of the restriction requirement. In this case, by sequence alignment performed by the examiner, SEQ ID NOs: 33 and 49 are identical in instant application and the US Patent. According to instant specification (BRIEF DESCRIPTION OF THE SEQUENCES, [0027]-[0125]), SEQ ID NO: 33 and 49 of US Patent are TIC7017 toxins. TIC7017 has different activity and specificity from that of instant TIC7108 toxins ([0193], Tables 10-11). Thus, SEQ ID NOs: 39 and 53 of US Patent are a different toxin from SEQ ID NOs: 36 and 51, and should not have been rejoined in the US Patent. Therefore, the double patenting rejection is proper. Claims 1-28 are rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1-27 of US Patent 10717989. Although the claims at issue are not identical, they are not patentably distinct from each other because: The USP claims SEQ ID NO: 47. By sequence matches, SEQ ID NO: 47 of the US Patent is 96.6% identical to instant SEQ ID NO: 36, and 96.2% identical to instant SEQ ID NO: 51. See “Sequence Matches” at the end of office action. Thus, SEQ ID NO: 47 of the US Patent are species of the instant genus of amino acid sequences having at least 62% sequence identity to instant SEQ ID NO: 36 or SEQ ID NO: 51. Accordingly, claims 1 the US Patent anticipates instant claim 1. Regarding the dependent claims, not only the subject matter recited, but also the claim languages, of the US Patent and instant application, are essentially the same. Therefore, the claims are obvious over each other. Note: the examiner has noticed that instant application is a division of the US Patent. However, according to MPEP 804.04, in a divisional application, a nonstatutory double patenting rejection may be appropriate in situations in which the invention presented in the divisional is not the same invention that was the subject of the restriction requirement. In this case, by sequence alignment performed by the examiner, SEQ ID NO: 47 is identical in instant application and the US Patent. According to instant specification (BRIEF DESCRIPTION OF THE SEQUENCES, [0027]-[0125]), SEQ ID NO: 47 of US Patent is a TIC7016 toxin. TIC7016 has different activity and specificity from that of instant TIC7108 toxins ([0193], Tables 10-11). Thus, SEQ ID NOs: 39 and 53 of US Patent are a different toxin from SEQ ID NO: 47, and should not have been rejoined in the US Patent. Therefore, the double patenting rejection is proper. Remarks Prior art does not teach or suggest SEQ ID NO: 36 or 51, or sequences having at least 62% sequence identities thereof. Prior art also does not teach or suggest the coding sequence of SEQ ID NO: 36 or 51. Sequence Matches Instant SEQ ID NO: 36 against SEQ ID NO: 39 of the US Patent 12123011 RESULT 3: 2 DUPLICATES: =================================== % Result Query Filing No. Score Match Length ID Date Dups Description ------------------------------------------------------------------------------------------------------------- 3 1372 99.6 274 US-15-846-796-39 2017-12-19 2 NOVEL INSECT INHIBITORY PROTEINS ALIGNMENT: Query Match 99.6%; Score 1372; Length 274; Best Local Similarity 99.6%; Matches 273; Conservative 0; Mismatches 1; Indels 0; Gaps 0; Qy 1 MTNLDLKMESWLALNDISLHQNLEPVAIKLAPSDQTVVSQGIFVGSQLSEARIADNQVQQ 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MTNLDLKMESWLALNDISLHQNLEPVAIKLAPSDQTVVSQGIFVGSQLSEARIADNQVQQ 60 Qy 61 ALQNFGRYSSAVKEAAKVAPTTGLTTILDIARIVSNFNPALPNDKNNVPAYEKYVSKILQ 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 ALQNFGRYSSAVKEAAKVAPTTGLTTILDIARIVSNFNPALPNDKNNVPAYEKYVSKILQ 120 Qy 121 NPLIHLLNSSLKSFKRRTSDWNEVIDQIANLYNGISAVDKGKIVESLKALANSASSSSSE 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 NPLIHLLNSSLKSFKRRTSDWNEVIDQIANLYNGISAVDKGKIVESLKALANSASSSSSE 180 Qy 181 KQIEKLFTQSTINCEENIDIYIYSSSVTMEEHNGKHNVKQVEFEIQETQLRFTKELWSLY 240 || ||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 KQTEKLFTQSTINCEENIDIYIYSSSVTMEEHNGKHNVKQVEFEIQETQLRFTKELWSLY 240 Qy 241 SDAVLAKHLALMDDWLNGIDTKADNRLSTLTCLV 274 |||||||||||||||||||||||||||||||||| Db 241 SDAVLAKHLALMDDWLNGIDTKADNRLSTLTCLV 274 DUPLICATES: US-17-938-016-39 Filing date in PALM: 2022-10-04 Sequence 39, US/17938016 Patent No. 12123011 GENERAL INFORMATION APPLICANT: Monsanto Technology LLC (en) TITLE OF INVENTION: NOVEL INSECT INHIBITORY PROTEINS (en) FILE REFERENCE: MONS:431USD2 CURRENT APPLICATION NUMBER: US/17/938,016 CURRENT FILING DATE: 2022-10-04 NUMBER OF SEQ ID NOS: 99 SEQ ID NO 39 LENGTH: 274 TYPE: PRT FEATURE: NAME/KEY: REGION LOCATION: 1..274 QUALIFIERS: note = MISC_FEATURE - Amino acid sequence of the TIC7110 protein. FEATURE: NAME/KEY: source LOCATION: 1..274 QUALIFIERS: mol_type = protein organism = Lysinibacillus sphaericus Instant SEQ ID NO: 36 against SEQ ID NO: 53 of the US Patent 12123011 RESULT 15: 2 DUPLICATES: =================================== % Result Query Filing No. Score Match Length ID Date Dups Description ------------------------------------------------------------------------------------------------------------- 15 1367 99.3 275 US-15-846-796-53 2017-12-19 2 NOVEL INSECT INHIBITORY PROTEINS ALIGNMENT: Query Match 99.3%; Score 1367; Length 275; Best Local Similarity 99.6%; Matches 272; Conservative 0; Mismatches 1; Indels 0; Gaps 0; Qy 2 TNLDLKMESWLALNDISLHQNLEPVAIKLAPSDQTVVSQGIFVGSQLSEARIADNQVQQA 61 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 3 TNLDLKMESWLALNDISLHQNLEPVAIKLAPSDQTVVSQGIFVGSQLSEARIADNQVQQA 62 Qy 62 LQNFGRYSSAVKEAAKVAPTTGLTTILDIARIVSNFNPALPNDKNNVPAYEKYVSKILQN 121 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 63 LQNFGRYSSAVKEAAKVAPTTGLTTILDIARIVSNFNPALPNDKNNVPAYEKYVSKILQN 122 Qy 122 PLIHLLNSSLKSFKRRTSDWNEVIDQIANLYNGISAVDKGKIVESLKALANSASSSSSEK 181 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 123 PLIHLLNSSLKSFKRRTSDWNEVIDQIANLYNGISAVDKGKIVESLKALANSASSSSSEK 182 Qy 182 QIEKLFTQSTINCEENIDIYIYSSSVTMEEHNGKHNVKQVEFEIQETQLRFTKELWSLYS 241 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 183 QTEKLFTQSTINCEENIDIYIYSSSVTMEEHNGKHNVKQVEFEIQETQLRFTKELWSLYS 242 Qy 242 DAVLAKHLALMDDWLNGIDTKADNRLSTLTCLV 274 ||||||||||||||||||||||||||||||||| Db 243 DAVLAKHLALMDDWLNGIDTKADNRLSTLTCLV 275 DUPLICATES: US-17-938-016-53 Filing date in PALM: 2022-10-04 Sequence 53, US/17938016 Patent No. 12123011 GENERAL INFORMATION APPLICANT: Monsanto Technology LLC (en) TITLE OF INVENTION: NOVEL INSECT INHIBITORY PROTEINS (en) FILE REFERENCE: MONS:431USD2 CURRENT APPLICATION NUMBER: US/17/938,016 CURRENT FILING DATE: 2022-10-04 NUMBER OF SEQ ID NOS: 99 SEQ ID NO 53 LENGTH: 275 TYPE: PRT FEATURE: NAME/KEY: REGION LOCATION: 1..275 QUALIFIERS: note = Amino acid sequence of TIC7110PL, wherein an additional alanineresidue is inserted immediately following the initiatingmethionine. FEATURE: NAME/KEY: source LOCATION: 1..275 QUALIFIERS: mol_type = protein organism = synthetic construct Instant SEQ ID NO: 51 against SEQ ID NO: 39 of the US Patent 12123011 RESULT 5: 2 DUPLICATES: =================================== % Result Query Filing No. Score Match Length ID Date Dups Description ------------------------------------------------------------------------------------------------------------- 5 1367 99.0 274 US-15-846-796-39 2017-12-19 2 NOVEL INSECT INHIBITORY PROTEINS ALIGNMENT: Query Match 99.0%; Score 1367; Length 274; Best Local Similarity 99.6%; Matches 272; Conservative 0; Mismatches 1; Indels 0; Gaps 0; Qy 3 TNLDLKMESWLALNDISLHQNLEPVAIKLAPSDQTVVSQGIFVGSQLSEARIADNQVQQA 62 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2 TNLDLKMESWLALNDISLHQNLEPVAIKLAPSDQTVVSQGIFVGSQLSEARIADNQVQQA 61 Qy 63 LQNFGRYSSAVKEAAKVAPTTGLTTILDIARIVSNFNPALPNDKNNVPAYEKYVSKILQN 122 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 62 LQNFGRYSSAVKEAAKVAPTTGLTTILDIARIVSNFNPALPNDKNNVPAYEKYVSKILQN 121 Qy 123 PLIHLLNSSLKSFKRRTSDWNEVIDQIANLYNGISAVDKGKIVESLKALANSASSSSSEK 182 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 122 PLIHLLNSSLKSFKRRTSDWNEVIDQIANLYNGISAVDKGKIVESLKALANSASSSSSEK 181 Qy 183 QIEKLFTQSTINCEENIDIYIYSSSVTMEEHNGKHNVKQVEFEIQETQLRFTKELWSLYS 242 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 182 QTEKLFTQSTINCEENIDIYIYSSSVTMEEHNGKHNVKQVEFEIQETQLRFTKELWSLYS 241 Qy 243 DAVLAKHLALMDDWLNGIDTKADNRLSTLTCLV 275 ||||||||||||||||||||||||||||||||| Db 242 DAVLAKHLALMDDWLNGIDTKADNRLSTLTCLV 274 DUPLICATES: US-17-938-016-39 Filing date in PALM: 2022-10-04 Sequence 39, US/17938016 Patent No. 12123011 GENERAL INFORMATION APPLICANT: Monsanto Technology LLC (en) TITLE OF INVENTION: NOVEL INSECT INHIBITORY PROTEINS (en) FILE REFERENCE: MONS:431USD2 CURRENT APPLICATION NUMBER: US/17/938,016 CURRENT FILING DATE: 2022-10-04 NUMBER OF SEQ ID NOS: 99 SEQ ID NO 39 LENGTH: 274 TYPE: PRT FEATURE: NAME/KEY: REGION LOCATION: 1..274 QUALIFIERS: note = MISC_FEATURE - Amino acid sequence of the TIC7110 protein. FEATURE: NAME/KEY: source LOCATION: 1..274 QUALIFIERS: mol_type = protein organism = Lysinibacillus sphaericus Instant SEQ ID NO: 51 against SEQ ID NO: 53 of the US Patent 12123011 RESULT 2: 2 DUPLICATES: =================================== % Result Query Filing No. Score Match Length ID Date Dups Description ------------------------------------------------------------------------------------------------------------- 2 1376 99.6 275 US-15-846-796-53 2017-12-19 2 NOVEL INSECT INHIBITORY PROTEINS ALIGNMENT: Query Match 99.6%; Score 1376; Length 275; Best Local Similarity 99.6%; Matches 274; Conservative 0; Mismatches 1; Indels 0; Gaps 0; Qy 1 MATNLDLKMESWLALNDISLHQNLEPVAIKLAPSDQTVVSQGIFVGSQLSEARIADNQVQ 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MATNLDLKMESWLALNDISLHQNLEPVAIKLAPSDQTVVSQGIFVGSQLSEARIADNQVQ 60 Qy 61 QALQNFGRYSSAVKEAAKVAPTTGLTTILDIARIVSNFNPALPNDKNNVPAYEKYVSKIL 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 QALQNFGRYSSAVKEAAKVAPTTGLTTILDIARIVSNFNPALPNDKNNVPAYEKYVSKIL 120 Qy 121 QNPLIHLLNSSLKSFKRRTSDWNEVIDQIANLYNGISAVDKGKIVESLKALANSASSSSS 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 QNPLIHLLNSSLKSFKRRTSDWNEVIDQIANLYNGISAVDKGKIVESLKALANSASSSSS 180 Qy 181 EKQIEKLFTQSTINCEENIDIYIYSSSVTMEEHNGKHNVKQVEFEIQETQLRFTKELWSL 240 ||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 EKQTEKLFTQSTINCEENIDIYIYSSSVTMEEHNGKHNVKQVEFEIQETQLRFTKELWSL 240 Qy 241 YSDAVLAKHLALMDDWLNGIDTKADNRLSTLTCLV 275 ||||||||||||||||||||||||||||||||||| Db 241 YSDAVLAKHLALMDDWLNGIDTKADNRLSTLTCLV 275 DUPLICATES: US-16-895-921-53 Filing date in PALM: 2020-06-08 Sequence 53, US/16895921 Patent No. 11492640 GENERAL INFORMATION APPLICANT: Monsanto Technology LLC TITLE OF INVENTION: NOVEL INSECT INHIBITORY PROTEINS FILE REFERENCE: MONS:431US CURRENT APPLICATION NUMBER: US/16/895,921 CURRENT FILING DATE: 2020-06-08 PRIOR APPLICATION NUMBER: US 15/846,796 PRIOR FILING DATE: 2017-12-19 PRIOR APPLICATION NUMBER: US 62/436,736 PRIOR FILING DATE: 2016-12-20 NUMBER OF SEQ ID NOS: 99 SEQ ID NO 53 LENGTH: 275 TYPE: PRT ORGANISM: Artificial FEATURE: OTHER INFORMATION: Amino acid sequence of TIC7110PL, wherein an additional alanine residue is inserted immediately following the initiating methionine. US-17-938-016-53 Filing date in PALM: 2022-10-04 Sequence 53, US/17938016 Patent No. 12123011 GENERAL INFORMATION APPLICANT: Monsanto Technology LLC (en) TITLE OF INVENTION: NOVEL INSECT INHIBITORY PROTEINS (en) FILE REFERENCE: MONS:431USD2 CURRENT APPLICATION NUMBER: US/17/938,016 CURRENT FILING DATE: 2022-10-04 NUMBER OF SEQ ID NOS: 99 SEQ ID NO 53 LENGTH: 275 TYPE: PRT FEATURE: NAME/KEY: REGION LOCATION: 1..275 QUALIFIERS: note = Amino acid sequence of TIC7110PL, wherein an additional alanineresidue is inserted immediately following the initiatingmethionine. FEATURE: NAME/KEY: source LOCATION: 1..275 QUALIFIERS: mol_type = protein organism = synthetic construct Instant SEQ ID NO: 36 against SEQ ID NO: 33 of the US Patent 11492640 RESULT 20: 2 DUPLICATES: =================================== % Result Query Filing No. Score Match Length ID Date Dups Description ------------------------------------------------------------------------------------------------------------- 20 1324 96.2 274 US-15-846-796-33 2017-12-19 2 NOVEL INSECT INHIBITORY PROTEINS ALIGNMENT: Query Match 96.2%; Score 1324; Length 274; Best Local Similarity 95.6%; Matches 262; Conservative 6; Mismatches 6; Indels 0; Gaps 0; Qy 1 MTNLDLKMESWLALNDISLHQNLEPVAIKLAPSDQTVVSQGIFVGSQLSEARIADNQVQQ 60 ||||||||||||||||||||||||||||||| |||||||||||||:|||||||||||||| Db 1 MTNLDLKMESWLALNDISLHQNLEPVAIKLATSDQTVVSQGIFVGNQLSEARIADNQVQQ 60 Qy 61 ALQNFGRYSSAVKEAAKVAPTTGLTTILDIARIVSNFNPALPNDKNNVPAYEKYVSKILQ 120 |||:|||||:|||||||:|||||||||||||||||||||||||||||||||||||||||| Db 61 ALQSFGRYSAAVKEAAKIAPTTGLTTILDIARIVSNFNPALPNDKNNVPAYEKYVSKILQ 120 Qy 121 NPLIHLLNSSLKSFKRRTSDWNEVIDQIANLYNGISAVDKGKIVESLKALANSASSSSSE 180 ||||||||||:||||| |||||| ||||||||||||| ||||||||||||| |||||||| Db 121 NPLIHLLNSSVKSFKRTTSDWNEAIDQIANLYNGISAADKGKIVESLKALAKSASSSSSE 180 Qy 181 KQIEKLFTQSTINCEENIDIYIYSSSVTMEEHNGKHNVKQVEFEIQETQLRFTKELWSLY 240 || |||||||||||||||||||||||||||||:||||||||||||||||||||||||||| Db 181 KQTEKLFTQSTINCEENIDIYIYSSSVTMEEHSGKHNVKQVEFEIQETQLRFTKELWSLY 240 Qy 241 SDAVLAKHLALMDDWLNGIDTKADNRLSTLTCLV 274 |||||||||||||||||||||||||||||||||| Db 241 SDAVLAKHLALMDDWLNGIDTKADNRLSTLTCLV 274 DUPLICATES: US-16-895-921-33 Filing date in PALM: 2020-06-08 Sequence 33, US/16895921 Patent No. 11492640 GENERAL INFORMATION APPLICANT: Monsanto Technology LLC TITLE OF INVENTION: NOVEL INSECT INHIBITORY PROTEINS FILE REFERENCE: MONS:431US CURRENT APPLICATION NUMBER: US/16/895,921 CURRENT FILING DATE: 2020-06-08 PRIOR APPLICATION NUMBER: US 15/846,796 PRIOR FILING DATE: 2017-12-19 PRIOR APPLICATION NUMBER: US 62/436,736 PRIOR FILING DATE: 2016-12-20 NUMBER OF SEQ ID NOS: 99 SEQ ID NO 33 LENGTH: 274 TYPE: PRT ORGANISM: Lysinibacillus sphaericus FEATURE: NAME/KEY: MISC_FEATURE LOCATION: (1)..(274) OTHER INFORMATION: Amino acid sequence of the TIC7017 protein. Instant SEQ ID NO: 36 against SEQ ID NO: 49 of the US Patent 11492640 RESULT 25: 2 DUPLICATES: =================================== % Result Query Filing No. Score Match Length ID Date Dups Description ------------------------------------------------------------------------------------------------------------- 25 1319 95.8 275 US-15-846-796-49 2017-12-19 2 NOVEL INSECT INHIBITORY PROTEINS ALIGNMENT: Query Match 95.8%; Score 1319; Length 275; Best Local Similarity 95.6%; Matches 261; Conservative 6; Mismatches 6; Indels 0; Gaps 0; Qy 2 TNLDLKMESWLALNDISLHQNLEPVAIKLAPSDQTVVSQGIFVGSQLSEARIADNQVQQA 61 |||||||||||||||||||||||||||||| |||||||||||||:||||||||||||||| Db 3 TNLDLKMESWLALNDISLHQNLEPVAIKLATSDQTVVSQGIFVGNQLSEARIADNQVQQA 62 Qy 62 LQNFGRYSSAVKEAAKVAPTTGLTTILDIARIVSNFNPALPNDKNNVPAYEKYVSKILQN 121 ||:|||||:|||||||:||||||||||||||||||||||||||||||||||||||||||| Db 63 LQSFGRYSAAVKEAAKIAPTTGLTTILDIARIVSNFNPALPNDKNNVPAYEKYVSKILQN 122 Qy 122 PLIHLLNSSLKSFKRRTSDWNEVIDQIANLYNGISAVDKGKIVESLKALANSASSSSSEK 181 |||||||||:||||| |||||| ||||||||||||| ||||||||||||| ||||||||| Db 123 PLIHLLNSSVKSFKRTTSDWNEAIDQIANLYNGISAADKGKIVESLKALAKSASSSSSEK 182 Qy 182 QIEKLFTQSTINCEENIDIYIYSSSVTMEEHNGKHNVKQVEFEIQETQLRFTKELWSLYS 241 | |||||||||||||||||||||||||||||:|||||||||||||||||||||||||||| Db 183 QTEKLFTQSTINCEENIDIYIYSSSVTMEEHSGKHNVKQVEFEIQETQLRFTKELWSLYS 242 Qy 242 DAVLAKHLALMDDWLNGIDTKADNRLSTLTCLV 274 ||||||||||||||||||||||||||||||||| Db 243 DAVLAKHLALMDDWLNGIDTKADNRLSTLTCLV 275 DUPLICATES: US-16-895-921-49 Filing date in PALM: 2020-06-08 Sequence 49, US/16895921 Patent No. 11492640 GENERAL INFORMATION APPLICANT: Monsanto Technology LLC TITLE OF INVENTION: NOVEL INSECT INHIBITORY PROTEINS FILE REFERENCE: MONS:431US CURRENT APPLICATION NUMBER: US/16/895,921 CURRENT FILING DATE: 2020-06-08 PRIOR APPLICATION NUMBER: US 15/846,796 PRIOR FILING DATE: 2017-12-19 PRIOR APPLICATION NUMBER: US 62/436,736 PRIOR FILING DATE: 2016-12-20 NUMBER OF SEQ ID NOS: 99 SEQ ID NO 49 LENGTH: 275 TYPE: PRT ORGANISM: Artificial FEATURE: OTHER INFORMATION: Amino acid sequence of TIC7017PL, wherein an additional alanine residue is inserted immediately following the initiating methionine. Instant SEQ ID NO: 51 against SEQ ID NO: 33 of the US Patent 11492640 RESULT 21: 2 DUPLICATES: =================================== % Result Query Filing No. Score Match Length ID Date Dups Description ------------------------------------------------------------------------------------------------------------- 21 1319 95.5 274 US-15-846-796-33 2017-12-19 2 NOVEL INSECT INHIBITORY PROTEINS ALIGNMENT: Query Match 95.5%; Score 1319; Length 274; Best Local Similarity 95.6%; Matches 261; Conservative 6; Mismatches 6; Indels 0; Gaps 0; Qy 3 TNLDLKMESWLALNDISLHQNLEPVAIKLAPSDQTVVSQGIFVGSQLSEARIADNQVQQA 62 |||||||||||||||||||||||||||||| |||||||||||||:||||||||||||||| Db 2 TNLDLKMESWLALNDISLHQNLEPVAIKLATSDQTVVSQGIFVGNQLSEARIADNQVQQA 61 Qy 63 LQNFGRYSSAVKEAAKVAPTTGLTTILDIARIVSNFNPALPNDKNNVPAYEKYVSKILQN 122 ||:|||||:|||||||:||||||||||||||||||||||||||||||||||||||||||| Db 62 LQSFGRYSAAVKEAAKIAPTTGLTTILDIARIVSNFNPALPNDKNNVPAYEKYVSKILQN 121 Qy 123 PLIHLLNSSLKSFKRRTSDWNEVIDQIANLYNGISAVDKGKIVESLKALANSASSSSSEK 182 |||||||||:||||| |||||| ||||||||||||| ||||||||||||| ||||||||| Db 122 PLIHLLNSSVKSFKRTTSDWNEAIDQIANLYNGISAADKGKIVESLKALAKSASSSSSEK 181 Qy 183 QIEKLFTQSTINCEENIDIYIYSSSVTMEEHNGKHNVKQVEFEIQETQLRFTKELWSLYS 242 | |||||||||||||||||||||||||||||:|||||||||||||||||||||||||||| Db 182 QTEKLFTQSTINCEENIDIYIYSSSVTMEEHSGKHNVKQVEFEIQETQLRFTKELWSLYS 241 Qy 243 DAVLAKHLALMDDWLNGIDTKADNRLSTLTCLV 275 ||||||||||||||||||||||||||||||||| Db 242 DAVLAKHLALMDDWLNGIDTKADNRLSTLTCLV 274 DUPLICATES: US-16-895-921-33 Filing date in PALM: 2020-06-08 Sequence 33, US/16895921 Patent No. 11492640 GENERAL INFORMATION APPLICANT: Monsanto Technology LLC TITLE OF INVENTION: NOVEL INSECT INHIBITORY PROTEINS FILE REFERENCE: MONS:431US CURRENT APPLICATION NUMBER: US/16/895,921 CURRENT FILING DATE: 2020-06-08 PRIOR APPLICATION NUMBER: US 15/846,796 PRIOR FILING DATE: 2017-12-19 PRIOR APPLICATION NUMBER: US 62/436,736 PRIOR FILING DATE: 2016-12-20 NUMBER OF SEQ ID NOS: 99 SEQ ID NO 33 LENGTH: 274 TYPE: PRT ORGANISM: Lysinibacillus sphaericus FEATURE: NAME/KEY: MISC_FEATURE LOCATION: (1)..(274) OTHER INFORMATION: Amino acid sequence of the TIC7017 protein. Instant SEQ ID NO: 51 against SEQ ID NO: 49 of the US Patent 11492640 RESULT 17: 2 DUPLICATES: =================================== % Result Query Filing No. Score Match Length ID Date Dups Description ------------------------------------------------------------------------------------------------------------- 17 1328 96.2 275 US-15-846-796-49 2017-12-19 2 NOVEL INSECT INHIBITORY PROTEINS ALIGNMENT: Query Match 96.2%; Score 1328; Length 275; Best Local Similarity 95.6%; Matches 263; Conservative 6; Mismatches 6; Indels 0; Gaps 0; Qy 1 MATNLDLKMESWLALNDISLHQNLEPVAIKLAPSDQTVVSQGIFVGSQLSEARIADNQVQ 60 |||||||||||||||||||||||||||||||| |||||||||||||:||||||||||||| Db 1 MATNLDLKMESWLALNDISLHQNLEPVAIKLATSDQTVVSQGIFVGNQLSEARIADNQVQ 60 Qy 61 QALQNFGRYSSAVKEAAKVAPTTGLTTILDIARIVSNFNPALPNDKNNVPAYEKYVSKIL 120 ||||:|||||:|||||||:||||||||||||||||||||||||||||||||||||||||| Db 61 QALQSFGRYSAAVKEAAKIAPTTGLTTILDIARIVSNFNPALPNDKNNVPAYEKYVSKIL 120 Qy 121 QNPLIHLLNSSLKSFKRRTSDWNEVIDQIANLYNGISAVDKGKIVESLKALANSASSSSS 180 |||||||||||:||||| |||||| ||||||||||||| ||||||||||||| ||||||| Db 121 QNPLIHLLNSSVKSFKRTTSDWNEAIDQIANLYNGISAADKGKIVESLKALAKSASSSSS 180 Qy 181 EKQIEKLFTQSTINCEENIDIYIYSSSVTMEEHNGKHNVKQVEFEIQETQLRFTKELWSL 240 ||| |||||||||||||||||||||||||||||:|||||||||||||||||||||||||| Db 181 EKQTEKLFTQSTINCEENIDIYIYSSSVTMEEHSGKHNVKQVEFEIQETQLRFTKELWSL 240 Qy 241 YSDAVLAKHLALMDDWLNGIDTKADNRLSTLTCLV 275 ||||||||||||||||||||||||||||||||||| Db 241 YSDAVLAKHLALMDDWLNGIDTKADNRLSTLTCLV 275 DUPLICATES: US-16-895-921-49 Filing date in PALM: 2020-06-08 Sequence 49, US/16895921 Patent No. 11492640 GENERAL INFORMATION APPLICANT: Monsanto Technology LLC TITLE OF INVENTION: NOVEL INSECT INHIBITORY PROTEINS FILE REFERENCE: MONS:431US CURRENT APPLICATION NUMBER: US/16/895,921 CURRENT FILING DATE: 2020-06-08 PRIOR APPLICATION NUMBER: US 15/846,796 PRIOR FILING DATE: 2017-12-19 PRIOR APPLICATION NUMBER: US 62/436,736 PRIOR FILING DATE: 2016-12-20 NUMBER OF SEQ ID NOS: 99 SEQ ID NO 49 LENGTH: 275 TYPE: PRT ORGANISM: Artificial FEATURE: OTHER INFORMATION: Amino acid sequence of TIC7017PL, wherein an additional alanine residue is inserted immediately following the initiating methionine. Instant SEQ ID NO: 36 against SEQ ID NO: 47 of the US Patent 10717989 US-15-846-796-47 (NOTE: this sequence has 2 duplicates in the database searched. See complete list at the end of this report) Sequence 47, US/15846796 Patent No. 10717989 GENERAL INFORMATION APPLICANT: Monsanto Technology LLC TITLE OF INVENTION: NOVEL INSECT INHIBITORY PROTEINS FILE REFERENCE: MONS:431US CURRENT APPLICATION NUMBER: US/15/846,796 CURRENT FILING DATE: 2017-12-19 PRIOR APPLICATION NUMBER: US 62/436,736 PRIOR FILING DATE: 2016-12-20 NUMBER OF SEQ ID NOS: 99 SEQ ID NO 47 LENGTH: 275 TYPE: PRT ORGANISM: Artificial FEATURE: OTHER INFORMATION: Amino acid sequence of TIC7016PL, wherein an additional alanine residue is inserted immediately following the initiating methionine. Query Match 96.2%; Score 1325; Length 275; Best Local Similarity 96.3%; Matches 263; Conservative 4; Mismatches 6; Indels 0; Gaps 0; Qy 2 TNLDLKMESWLALNDISLHQNLEPVAIKLAPSDQTVVSQGIFVGSQLSEARIADNQVQQA 61 |||||||||||||||||||||||||||||| |||||||||||||:||||||||||||||| Db 3 TNLDLKMESWLALNDISLHQNLEPVAIKLATSDQTVVSQGIFVGNQLSEARIADNQVQQA 62 Qy 62 LQNFGRYSSAVKEAAKVAPTTGLTTILDIARIVSNFNPALPNDKNNVPAYEKYVSKILQN 121 ||:|||||:||||||||||||||||||||||||||||||||||||||||||||||||||| Db 63 LQSFGRYSTAVKEAAKVAPTTGLTTILDIARIVSNFNPALPNDKNNVPAYEKYVSKILQN 122 Qy 122 PLIHLLNSSLKSFKRRTSDWNEVIDQIANLYNGISAVDKGKIVESLKALANSASSSSSEK 181 |||||||||:||||| |||||| ||||||||||||| ||||||||||||| ||||||||| Db 123 PLIHLLNSSVKSFKRTTSDWNEAIDQIANLYNGISAADKGKIVESLKALAKSASSSSSEK 182 Qy 182 QIEKLFTQSTINCEENIDIYIYSSSVTMEEHNGKHNVKQVEFEIQETQLRFTKELWSLYS 241 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 183 QTEKLFTQSTINCEENIDIYIYSSSVTMEEHNGKHNVKQVEFEIQETQLRFTKELWSLYS 242 Qy 242 DAVLAKHLALMDDWLNGIDTKADNRLSTLTCLV 274 ||||||||||||||||||||||||||||||||| Db 243 DAVLAKHLALMDDWLNGIDTKADNRLSTLTCLV 275 Instant SEQ ID NO: 51 against SEQ ID NO: 47 of the US Patent 10717879 US-15-846-796-47 (NOTE: this sequence has 2 duplicates in the database searched. See complete list at the end of this report) Sequence 47, US/15846796 Patent No. 10717989 GENERAL INFORMATION APPLICANT: Monsanto Technology LLC TITLE OF INVENTION: NOVEL INSECT INHIBITORY PROTEINS FILE REFERENCE: MONS:431US CURRENT APPLICATION NUMBER: US/15/846,796 CURRENT FILING DATE: 2017-12-19 PRIOR APPLICATION NUMBER: US 62/436,736 PRIOR FILING DATE: 2016-12-20 NUMBER OF SEQ ID NOS: 99 SEQ ID NO 47 LENGTH: 275 TYPE: PRT ORGANISM: Artificial FEATURE: OTHER INFORMATION: Amino acid sequence of TIC7016PL, wherein an additional alanine residue is inserted immediately following the initiating methionine. Query Match 96.6%; Score 1334; Length 275; Best Local Similarity 96.4%; Matches 265; Conservative 4; Mismatches 6; Indels 0; Gaps 0; Qy 1 MATNLDLKMESWLALNDISLHQNLEPVAIKLAPSDQTVVSQGIFVGSQLSEARIADNQVQ 60 |||||||||||||||||||||||||||||||| |||||||||||||:||||||||||||| Db 1 MATNLDLKMESWLALNDISLHQNLEPVAIKLATSDQTVVSQGIFVGNQLSEARIADNQVQ 60 Qy 61 QALQNFGRYSSAVKEAAKVAPTTGLTTILDIARIVSNFNPALPNDKNNVPAYEKYVSKIL 120 ||||:|||||:||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 QALQSFGRYSTAVKEAAKVAPTTGLTTILDIARIVSNFNPALPNDKNNVPAYEKYVSKIL 120 Qy 121 QNPLIHLLNSSLKSFKRRTSDWNEVIDQIANLYNGISAVDKGKIVESLKALANSASSSSS 180 |||||||||||:||||| |||||| ||||||||||||| ||||||||||||| ||||||| Db 121 QNPLIHLLNSSVKSFKRTTSDWNEAIDQIANLYNGISAADKGKIVESLKALAKSASSSSS 180 Qy 181 EKQIEKLFTQSTINCEENIDIYIYSSSVTMEEHNGKHNVKQVEFEIQETQLRFTKELWSL 240 ||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 EKQTEKLFTQSTINCEENIDIYIYSSSVTMEEHNGKHNVKQVEFEIQETQLRFTKELWSL 240 Qy 241 YSDAVLAKHLALMDDWLNGIDTKADNRLSTLTCLV 275 ||||||||||||||||||||||||||||||||||| Db 241 YSDAVLAKHLALMDDWLNGIDTKADNRLSTLTCLV 275 Conclusion No claim is allowed. Contact information Any inquiry concerning this communication or earlier communications from the examiner should be directed to WAYNE ZHONG whose telephone number is (571)270-0311. The examiner can normally be reached 8:30am to 5:00pm EST. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Bratislav Stankovic, can be reached on 571-270-0305. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /Wayne Zhong/ Primary Examiner, Art Unit 1662
Read full office action

Prosecution Timeline

Sep 10, 2024
Application Filed
Jun 08, 2026
Non-Final Rejection mailed — §101, §112, §DP (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12660775
WHEAT VARIETY 6PAZF90B
2y 5m to grant Granted Jun 23, 2026
Patent 12653122
TRITICALE CULTIVAR APT1415420
3y 9m to grant Granted Jun 16, 2026
Patent 12655440
GENETICALLY MODIFIED PLANTS THAT EXHIBIT AN INCREASE IN SEED YIELD COMPRISING A FIRST BIOTIN ATTACHMENT DOMAIN-CONTAINING (BADC) GENE HOMOZYGOUS FOR A WILD-TYPE ALLELE, A SECOND BADC GENE HOMOZYGOUS FOR A MUTANT ALLELE, AND HOMOLOGS OF THE FIRST AND SECOND BADC GENES
3y 5m to grant Granted Jun 16, 2026
Patent 12644127
HAPLOID MAIZE TRANSFORMATION
11y 1m to grant Granted Jun 02, 2026
Patent 12642235
SOYBEAN CULTIVAR 29120104
2y 3m to grant Granted Jun 02, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

Strategy Recommendation AI-generated — please review before filing

Get a prosecution strategy drawn from examiner precedents, rejection analysis, and claim mapping.
Typically takes 5-10 seconds — AI-generated, attorney review required before filing

Prosecution Projections

1-2
Expected OA Rounds
72%
Grant Probability
94%
With Interview (+21.4%)
2y 11m (~1y 1m remaining)
Median Time to Grant
Low
PTA Risk
Based on 536 resolved cases by this examiner. Grant probability derived from career allowance rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month