Prosecution Insights
Last updated: October 02, 2026
Application No. 18/838,151

PPO2 POLYPEPTIDE HAVING TOLERANCE TO PPO INHIBITOR HERBICIDE AND APPLICATION

Non-Final OA §102§112
Filed
Apr 03, 2025
Priority
Mar 29, 2022 — CN 202210316331.0 +1 more
Examiner
MEYER, GEORGE WILLIAM
Art Unit
1662
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Qingdao Kingagroot Chemical Compound Co. Ltd.
OA Round
1 (Non-Final)
100%
Grant Probability
Favorable
1-2
OA Rounds
10m
Est. Remaining
99%
With Interview

Examiner Intelligence

Grants 100% — above average
100%
Career Allowance Rate
5 granted / 5 resolved
+40.0% vs TC avg
Minimal +0% lift
Without
With
+0.0%
Interview Lift
resolved cases with interview
Typical timeline
2y 4m
Avg Prosecution
13 currently pending
Career history
24
Total Applications
across all art units

Statute-Specific Performance

§101
7.1%
-32.9% vs TC avg
§103
49.4%
+9.4% vs TC avg
§102
12.9%
-27.1% vs TC avg
§112
28.2%
-11.8% vs TC avg
Black line = Tech Center average estimate • Based on career data from 5 resolved cases

Office Action

§102 §112
Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Response to Previous Communication In response to the restriction requirement mailed on 06/30/2026, the Applicant’s attorney, Jeremy Jay, elects Group 1 (i.e. Claims 1-3) without traversal which was filed on 08/26/2026. Applicant further elects the amino acid sequences of SEQ ID NOs:1-2 without traversal. Priority This application claims priority to foreign application CN202210316331.0 on 03/29/2022. Status of the Claims Claims 1-12, 14, and 17-23 are pending. Claims 4-12, 14, and 17-23 are withdrawn from consideration for being directed to non-elected invention(s). Claims 1-3 are examined herein. Information Disclosure Statement The specification contains references throughout the document (see paragraphs 11, 35 and 87 for examples) that are not listed on a proper IDS. Unless the references are in the IDS documents filed on 06/15/2026, 02/04/2026, 10/23/2024 or on the PTO-892 form, the references have not been considered. Specification The disclosure is objected to because it contains an embedded hyperlink and/or other form of browser-executable code. Applicant is required to delete the embedded hyperlink and/or other form of browser-executable code; references to websites should be limited to the top-level domain name without any prefix such as http:// or other browser-executable code. See MPEP §608.01. For example, the specification contains links in paragraphs 2 and 50. Drawings Plants do not appear to be labeled in figures 10, 12, and 14 and the labels in the photos are illegible. Claim Interpretation Claims 1-3 are drawn to Protoporphyrinogen IX oxidase (PPO) polypeptides or bioactive fragments which have a mutation corresponding to the 422 position of SEQ ID NO: 1 which generates SEQ ID NO: 2 and is shown below with the mutation site highlighted. Paragraph 67 defines the "bioactive fragment" which refers to a portion of the mutant protein of the present invention which retains the biological activity of the mutant protein of the present invention. For example, a bioactive fragment of a mutant protein may be a portion that has one or more (e.g., 1-50, 1-25, 1-10 or 1-5; e.g., 1, 2, 3, 4 or 5) amino acid residues deleted from the N- and/or C-terminus of the protein while still retaining the biological activity of the full-length protein. Query SEQ ID NO:1 Sbjct SEQ ID NO:2 Query 1 MLSPATTFSSSSSSSSPSRAHARAPTRFAVAASARAARFRPARAMAASDDPRGGRSVAVV 60 MLSPATTFSSSSSSSSPSRAHARAPTRFAVAASARAARFRPARAMAASDDPRGGRSVAVV Sbjct 1 MLSPATTFSSSSSSSSPSRAHARAPTRFAVAASARAARFRPARAMAASDDPRGGRSVAVV 60 Query 61 GAGVSGLAAAYRLRKRGVQVTVFEAADRAGGKIRTNSEGGFIWDEGANTMTESELEASRL 120 GAGVSGLAAAYRLRKRGVQVTVFEAADRAGGKIRTNSEGGFIWDEGANTMTESELEASRL Sbjct 61 GAGVSGLAAAYRLRKRGVQVTVFEAADRAGGKIRTNSEGGFIWDEGANTMTESELEASRL 120 Query 121 IDDLGLQGKQQYPNSQHKRYIVKDGAPTLIPSDPIALMKSTVLSTKSKLKLFLEPFLYEK 180 IDDLGLQGKQQYPNSQHKRYIVKDGAPTLIPSDPIALMKSTVLSTKSKLKLFLEPFLYEK Sbjct 121 IDDLGLQGKQQYPNSQHKRYIVKDGAPTLIPSDPIALMKSTVLSTKSKLKLFLEPFLYEK 180 Query 181 SSRRTSGKVSDEHLSESVASFFERHFGKEVVDYLIDPFVAGTSGGDPESLSIRHAFPALW 240 SSRRTSGKVSDEHLSESVASFFERHFGKEVVDYLIDPFVAGTSGGDPESLSIRHAFPALW Sbjct 181 SSRRTSGKVSDEHLSESVASFFERHFGKEVVDYLIDPFVAGTSGGDPESLSIRHAFPALW 240 Query 241 NLENKYGSVIAGAILSKLSTKGDSVKTGGASPGKGRNKRVSFSFHGGMQSLIDALHNEVG 300 NLENKYGSVIAGAILSKLSTKGDSVKTGGASPGKGRNKRVSFSFHGGMQSLIDALHNEVG Sbjct 241 NLENKYGSVIAGAILSKLSTKGDSVKTGGASPGKGRNKRVSFSFHGGMQSLIDALHNEVG 300 Query 301 DGNVKLGTEVLSLACCCDGVSSSGGWSISVDSKDAKGKDLRKNQSFDAVIMTAPLSNVQR 360 DGNVKLGTEVLSLACCCDGVSSSGGWSISVDSKDAKGKDLRKNQSFDAVIMTAPLSNVQR Sbjct 301 DGNVKLGTEVLSLACCCDGVSSSGGWSISVDSKDAKGKDLRKNQSFDAVIMTAPLSNVQR 360 Query 361 MKFTKGGVPFVLDFLPKVDYLPLSLMVTAFKKEDVKKPLEGFGALIPYKEQQKHGLKTLG 420 MKFTKGGVPFVLDFLPKVDYLPLSLMVTAFKKEDVKKPLEGFGALIPYKEQQKHGLKTLG Sbjct 361 MKFTKGGVPFVLDFLPKVDYLPLSLMVTAFKKEDVKKPLEGFGALIPYKEQQKHGLKTLG 420 Query 421 TLFSSMMFPDRAPNDQYLYTSFIGGSHNRDLAGAPTAILKQLVTSDLRKLLGVEGQPTFV 480 T+FSSMMFPDRAPNDQYLYTSFIGGSHNRDLAGAPTAILKQLVTSDLRKLLGVEGQPTFV Sbjct 421 TMFSSMMFPDRAPNDQYLYTSFIGGSHNRDLAGAPTAILKQLVTSDLRKLLGVEGQPTFV 480 Query 481 KHVHWRNAFPLYGQNYDLVLEAIA KMENNLPGFFYAGNNKDGLAVGNVIASGSKAADLVI 540 KHVHWRNAFPLYGQNYDLVLEAIA KMENNLPGFFYAGNNKDGLAVGNVIASGSKAADLVI Sbjct 481 KHVHWRNAFPLYGQNYDLVLEAIA KMENNLPGFFYAGNNKDGLAVGNVIASGSKAADLVI 540 Query 541 SYLESCTDQDN 551 SYLESCTDQDN Sbjct 541 SYLESCTDQDN 551 Claim Objections Claim 1 is objected to because the terms “PPO2” and “PPO” in line 1 are undefined. Claim Rejections - 35 USC § 112 The following is a quotation of the first paragraph of 35 U.S.C. 112(a): (a) IN GENERAL.—The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor or joint inventor of carrying out the invention. The following is a quotation of the first paragraph of pre-AIA 35 U.S.C. 112: The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor of carrying out his invention. Written Description Claims 1-3 are rejected under 35 U.S.C. 112(a) or 35 U.S.C. 112 (pre-AIA ), first paragraph, as failing to comply with the written description requirement. The claim(s) contains subject matter which was not described in the specification in such a way as to reasonably convey to one skilled in the relevant art that the inventor or a joint inventor, or for applications subject to pre-AIA 35 U.S.C. 112, the inventor(s), at the time the application was filed, had possession of the claimed invention. The Federal Circuit has clarified the written description requirement. The court stated that a written description of an invention "requires a precise definition, such as by structure, formula, [or] chemical name, of the claimed subject matter sufficient to distinguish it from other materials". University of California v. Eli Lilly and Co., 119 F.3d 1559, 1568; 43 USPQ2d 1398, 1406 (Fed. Cir. 1997). The court also concluded that "naming a type of material generally known to exist, in the absence of knowledge as to what that material consists of, is not description of that material". Id. Further, the court held that to adequately describe a claimed genus, Patent Owner must describe a representative number of the species of the claimed genus, and that one of skill in the art should be able to "visualize or recognize the identity of the members of the genus". The claims are broadly drawn to PPO2 polypeptides which are tolerant to PPO inhibitors with a Leu to Met mutation corresponding to position 422 of SEQ ID NO:1 as well as all bioactive fragments and sequences with 80% sequence identity to SEQ ID NO:1 and 92% sequence identity to SEQ ID NO:2. Applicant describes: PPO-defective E. coli (ΔhemG) transformants transformed with the wild-type OsPP02 gene are unable to grow in compound A (i.e. a PPO inhibitor) but could grow when expressing the OsPP02 protein which contained the L422M mutation. The resistance could further be improved with the F442M mutation. Similar results were shown in Arabidopsis thaliana, rice, maize, and soybean plants overexpressing the OsPP02 protein with the L422M and F442M. Mutating the equivalent L422 and F442 position in the maize and soybean PPO1 protein also conveyed resistance in E. coli. Applicant does not describe: Any bioactive fragment of SEQ ID NOs:1-2. All possible polypeptide sequences with the equivalent L442M mutation with 80% sequence similarity to SEQ ID NO:1 or 92% similarity to SEQ ID NO:2. Claims 1-3 encompass a vast genus of polypeptide sequences. With the exception of sequences in the specification, the Applicants have failed to provide working examples of all possible claimed PPO2 polypeptides with the L to M amino acid mutation at the position corresponding to position 422 in SEQ ID NO:1 or bioactive fragments. Blasting SEQ ID NOs: 1 and 2 to NCBI BLAST® yielded many hypothetical or unnamed proteins (see below) indicating one of ordinary skill in the art may not know if any given protein with 80 or 92% similarity to SEQ ID NOs: 1-2 is a PPO2 protein. Additionally, the Applicant has not described and reduced to practice a genus of proteins with all possible amino acid sequences with 80 or 92% sequences similarity to SEQ ID NOs:1 and 2. This would require describing a genus of proteins with all possible single amino acid substitutions relative to the 551 amino acid long polypeptides of SEQ ID NOs:1-2 and reducing to practice 20551 amino acid sequences. Protein consisting of a sequence 80% identical to SEQ ID NO:1 would have up to ~110 random amino acid substitutions relative to SEQ ID NO: 1 while protein consisting of a sequence 92% identical to SEQ ID NO:2 would have up to ~44 random amino acid substitutions relative to SEQ ID NO: 2. Accordingly 44 x 20551 to 110 x 20551 amino acid sequences would need to be described and reduced to practice, most of which were not in Applicants’ possession at the time of filing. The instant Specification fails to provide guidance for which exact nucleotides could be modified so the PPO enzyme retains its function. More importantly, all bioactive fragment sequences are also not described and could be interpreted to mean any number, type, and length of sequence(s). PNG media_image1.png 1017 1232 media_image1.png Greyscale NCBI BLAST® of SEQ ID NO: 1 PNG media_image2.png 976 1230 media_image2.png Greyscale NCBI BLAST® of SEQ ID NO: 2 There is no little description in the specification as to what amino acids can be removed to generate a bioactive fragment. The specification does describe deleting up to 50 amino acid sequences from the C and/or N terminals of the Sequence (see claim interpretation). However, Koch, Michael, et al. "Crystal structure of protoporphyrinogen IX oxidase: a key enzyme in haem and chlorophyll biosynthesis." The EMBO journal 23.8 (2004): 1720 teaches this enzyme requires a FAD cofactor in the abstract and page 1 paragraph 3. Figure 2B describes that amino acids that come into contact with the FAD are located within 50 amino acids of the C and N terminals (and indicated with red/orange arrows), while the Figure 3A shows the 3-dimentional structure of PPO and the how the C and N terminals make up the FAD binding domain which is also demonstrated in supplementary Figure 1. All possible sequences or bioactive fragments with 80% identity to SEQ ID NO: 1 or 92% identity to SEQ ID NO:2 which are still tolerant to a PPO inhibitor were not described. Additionally, proteins with greater than 80 or 92% similarity remain unnamed, indicating one of ordinary skill in the art may not know if a protein was a PPO2 enzyme. Therefore, given the lack of written description in the instant disclosure with regard to the structural and functional characteristics of the claimed compositions, Applicant does not appear to have been in possession of the claimed genus at the time this application was filed. Claim Rejections - 35 USC § 102 In the event the determination of the status of the application as subject to AIA 35 U.S.C. 102 and 103 (or as subject to pre-AIA 35 U.S.C. 102 and 103) is incorrect, any correction of the statutory basis (i.e., changing from AIA to pre-AIA ) for the rejection will not be considered a new ground of rejection if the prior art relied upon, and the rationale supporting the rejection, would be the same under either status. The following is a quotation of the appropriate paragraphs of 35 U.S.C. 102 that form the basis for the rejections under this section made in this Office action: A person shall be entitled to a patent unless – (a)(1) the claimed invention was patented, described in a printed publication, or in public use, on sale, or otherwise available to the public before the effective filing date of the claimed invention. (a)(2) the claimed invention was described in a patent issued under section 151, or in an application for patent published or deemed published under section 122(b), in which the patent or application, as the case may be, names another inventor and was effectively filed before the effective filing date of the claimed invention. Claims 1-3 directed to PPO2 polypeptides which are tolerant to PPO inhibitors with a mutation corresponding to the L422M mutation in SEQ ID NO:1 as well as all bioactive fragments and sequences with 80% sequence identity to SEQ ID NO:1 and 92% sequence identity to SEQ ID NO:2 are rejected as being anticipated under 35 U.S.C. § 102 over US 2021/0002662 Al (Aponte) (see IDS filed 10/23/2024). Aponte is also directed to method for controlling undesired vegetation at a plant cultivation site and a plant that comprises at least one nucleic acid comprising a nucleotide sequence encoding protoporphyrinogen oxidase (PPO) which is resistant or tolerant to a PPO-inhibiting herbicide (see abstract). Paragraphs 35 and 37 teach a herbicide resistant or tolerant PPO polypeptide (i.e. PPO2 of Claim 1) that comprises a motif with the sequence comprising TLGTLFSS, where the Leu at position 5 within said motif is substituted by any other amino acid, and specifically lists methionine in paragraph 1795. The leucine at this position corresponds to position 422 in the amino acid sequence in instant SEQ ID NO:1 and is highlighted below. Query: Applicant’s SEQ ID NO:1 Sbjct: Applicant’s SEQ ID NO:2 Query 1 MLSPATTFSSSSSSSSPSRAHARAPTRFAVAASARAARFRPARAMAASDDPRGGRSVAVV 60 MLSPATTFSSSSSSSSPSRAHARAPTRFAVAASARAARFRPARAMAASDDPRGGRSVAVV Sbjct 1 MLSPATTFSSSSSSSSPSRAHARAPTRFAVAASARAARFRPARAMAASDDPRGGRSVAVV 60 Query 61 GAGVSGLAAAYRLRKRGVQVTVFEAADRAGGKIRTNSEGGFIWDEGANTMTESELEASRL 120 GAGVSGLAAAYRLRKRGVQVTVFEAADRAGGKIRTNSEGGFIWDEGANTMTESELEASRL Sbjct 61 GAGVSGLAAAYRLRKRGVQVTVFEAADRAGGKIRTNSEGGFIWDEGANTMTESELEASRL 120 Query 121 IDDLGLQGKQQYPNSQHKRYIVKDGAPTLIPSDPIALMKSTVLSTKSKLKLFLEPFLYEK 180 IDDLGLQGKQQYPNSQHKRYIVKDGAPTLIPSDPIALMKSTVLSTKSKLKLFLEPFLYEK Sbjct 121 IDDLGLQGKQQYPNSQHKRYIVKDGAPTLIPSDPIALMKSTVLSTKSKLKLFLEPFLYEK 180 Query 181 SSRRTSGKVSDEHLSESVASFFERHFGKEVVDYLIDPFVAGTSGGDPESLSIRHAFPALW 240 SSRRTSGKVSDEHLSESVASFFERHFGKEVVDYLIDPFVAGTSGGDPESLSIRHAFPALW Sbjct 181 SSRRTSGKVSDEHLSESVASFFERHFGKEVVDYLIDPFVAGTSGGDPESLSIRHAFPALW 240 Query 241 NLENKYGSVIAGAILSKLSTKGDSVKTGGASPGKGRNKRVSFSFHGGMQSLIDALHNEVG 300 NLENKYGSVIAGAILSKLSTKGDSVKTGGASPGKGRNKRVSFSFHGGMQSLIDALHNEVG Sbjct 241 NLENKYGSVIAGAILSKLSTKGDSVKTGGASPGKGRNKRVSFSFHGGMQSLIDALHNEVG 300 Query 301 DGNVKLGTEVLSLACCCDGVSSSGGWSISVDSKDAKGKDLRKNQSFDAVIMTAPLSNVQR 360 DGNVKLGTEVLSLACCCDGVSSSGGWSISVDSKDAKGKDLRKNQSFDAVIMTAPLSNVQR Sbjct 301 DGNVKLGTEVLSLACCCDGVSSSGGWSISVDSKDAKGKDLRKNQSFDAVIMTAPLSNVQR 360 Query 361 MKFTKGGVPFVLDFLPKVDYLPLSLMVTAFKKEDVKKPLEGFGALIPYKEQQKHGLKTLG 420 MKFTKGGVPFVLDFLPKVDYLPLSLMVTAFKKEDVKKPLEGFGALIPYKEQQKHGLKTLG Sbjct 361 MKFTKGGVPFVLDFLPKVDYLPLSLMVTAFKKEDVKKPLEGFGALIPYKEQQKHGLKTLG 420 Query 421 TLFSSMMFPDRAPNDQYLYTSFIGGSHNRDLAGAPTAILKQLVTSDLRKLLGVEGQPTFV 480 T+FSSMMFPDRAPNDQYLYTSFIGGSHNRDLAGAPTAILKQLVTSDLRKLLGVEGQPTFV Sbjct 421 TMFSSMMFPDRAPNDQYLYTSFIGGSHNRDLAGAPTAILKQLVTSDLRKLLGVEGQPTFV 480 Query 481 KHVHWRNAFPLYGQNYDLVLEAIA KMENNLPGFFYAGNNKDGLAVGNVIASGSKAADLVI 540 KHVHWRNAFPLYGQNYDLVLEAIA KMENNLPGFFYAGNNKDGLAVGNVIASGSKAADLVI Sbjct 481 KHVHWRNAFPLYGQNYDLVLEAIA KMENNLPGFFYAGNNKDGLAVGNVIASGSKAADLVI 540 Query 541 SYLESCTDQDN 551 SYLESCTDQDN Sbjct 541 SYLESCTDQDN 551 Among the homologues, orthologues and paralogues of PPO polypeptides taught and claimed by Aponte is the OsPPO2 protein (i.e. SEQ ID NO: 637) as well as a L422F mutation (i.e. SEQ ID NO: 634) and was disclosed in paragraphs 39, 1852, and claims 1-2. Alignments of these sequences to Applicant’s SEQ ID NOs:1-2 are below. Furthermore, claim 3 of Aponte also recites the OsPPO2 protein (i.e. SEQ ID NO: 637) which comprises the amino acid corresponding to Leu400 of Aponte’s SEQ ID NO: 1 is substituted by any other amino acid which corresponds to Applicant’s L442 position (see alignment below between applicant’s SEQ ID NO:1 and Aponte’s SEQ ID NO:1). Because Aponte teaches a protein sequence with 100% identity to applicant’s SEQ ID NO:1, mutations at the position corresponding to Applicant’s L442 position, and specifically recites Met in paragraph 1795, Aponte teaches the limitations of Claims 2-3. Query: Applicant’s SEQ ID NO:1 Sbjct: Aponte’s SEQ ID NO:637 Query 1 MLSPATTFSSSSSSSSPSRAHARAPTRFAVAASARAARFRPARAMAASDDPRGGRSVAVV 60 MLSPATTFSSSSSSSSPSRAHARAPTRFAVAASARAARFRPARAMAASDDPRGGRSVAVV Sbjct 1 MLSPATTFSSSSSSSSPSRAHARAPTRFAVAASARAARFRPARAMAASDDPRGGRSVAVV 60 Query 61 GAGVSGLAAAYRLRKRGVQVTVFEAADRAGGKIRTNSEGGFIWDEGANTMTESELEASRL 120 GAGVSGLAAAYRLRKRGVQVTVFEAADRAGGKIRTNSEGGFIWDEGANTMTESELEASRL Sbjct 61 GAGVSGLAAAYRLRKRGVQVTVFEAADRAGGKIRTNSEGGFIWDEGANTMTESELEASRL 120 Query 121 IDDLGLQGKQQYPNSQHKRYIVKDGAPTLIPSDPIALMKSTVLSTKSKLKLFLEPFLYEK 180 IDDLGLQGKQQYPNSQHKRYIVKDGAPTLIPSDPIALMKSTVLSTKSKLKLFLEPFLYEK Sbjct 121 IDDLGLQGKQQYPNSQHKRYIVKDGAPTLIPSDPIALMKSTVLSTKSKLKLFLEPFLYEK 180 Query 181 SSRRTSGKVSDEHLSESVASFFERHFGKEVVDYLIDPFVAGTSGGDPESLSIRHAFPALW 240 SSRRTSGKVSDEHLSESVASFFERHFGKEVVDYLIDPFVAGTSGGDPESLSIRHAFPALW Sbjct 181 SSRRTSGKVSDEHLSESVASFFERHFGKEVVDYLIDPFVAGTSGGDPESLSIRHAFPALW 240 Query 241 NLENKYGSVIAGAILSKLSTKGDSVKTGGASPGKGRNKRVSFSFHGGMQSLIDALHNEVG 300 NLENKYGSVIAGAILSKLSTKGDSVKTGGASPGKGRNKRVSFSFHGGMQSLIDALHNEVG Sbjct 241 NLENKYGSVIAGAILSKLSTKGDSVKTGGASPGKGRNKRVSFSFHGGMQSLIDALHNEVG 300 Query 301 DGNVKLGTEVLSLACCCDGVSSSGGWSISVDSKDAKGKDLRKNQSFDAVIMTAPLSNVQR 360 DGNVKLGTEVLSLACCCDGVSSSGGWSISVDSKDAKGKDLRKNQSFDAVIMTAPLSNVQR Sbjct 301 DGNVKLGTEVLSLACCCDGVSSSGGWSISVDSKDAKGKDLRKNQSFDAVIMTAPLSNVQR 360 Query 361 MKFTKGGVPFVLDFLPKVDYLPLSLMVTAFKKEDVKKPLEGFGALIPYKEQQKHGLKTLG 420 MKFTKGGVPFVLDFLPKVDYLPLSLMVTAFKKEDVKKPLEGFGALIPYKEQQKHGLKTLG Sbjct 361 MKFTKGGVPFVLDFLPKVDYLPLSLMVTAFKKEDVKKPLEGFGALIPYKEQQKHGLKTLG 420 Query 421 TLFSSMMFPDRAPNDQYLYTSFIGGSHNRDLAGAPTAILKQLVTSDLRKLLGVEGQPTFV 480 TLFSSMMFPDRAPNDQYLYTSFIGGSHNRDLAGAPTAILKQLVTSDLRKLLGVEGQPTFV Sbjct 421 TLFSSMMFPDRAPNDQYLYTSFIGGSHNRDLAGAPTAILKQLVTSDLRKLLGVEGQPTFV 480 Query 481 KHVHWRNAFPLYGQNYDLVLEAIA KMENNLPGFFYAGNNKDGLAVGNVIASGSKAADLVI 540 KHVHWRNAFPLYGQNYDLVLEAIA KMENNLPGFFYAGNNKDGLAVGNVIASGSKAADLVI Sbjct 481 KHVHWRNAFPLYGQNYDLVLEAIA KMENNLPGFFYAGNNKDGLAVGNVIASGSKAADLVI 540 Query 541 SYLESCTDQDN 551 SYLESCTDQDN Sbjct 541 SYLESCTDQDN 551 core Expect Method Identities Positives Gaps 1128 bits(2917) 0.0 Compositional matrix adjust. 550/551(99%) 550/551(99%) 0/551(0%) Query: Applicant’s SEQ ID NO:2 Sbjct: Aponte’s SEQ ID NO:634 Query 1 MLSPATTFSSSSSSSSPSRAHARAPTRFAVAASARAARFRPARAMAASDDPRGGRSVAVV 60 MLSPATTFSSSSSSSSPSRAHARAPTRFAVAASARAARFRPARAMAASDDPRGGRSVAVV Sbjct 1 MLSPATTFSSSSSSSSPSRAHARAPTRFAVAASARAARFRPARAMAASDDPRGGRSVAVV 60 Query 61 GAGVSGLAAAYRLRKRGVQVTVFEAADRAGGKIRTNSEGGFIWDEGANTMTESELEASRL 120 GAGVSGLAAAYRLRKRGVQVTVFEAADRAGGKIRTNSEGGFIWDEGANTMTESELEASRL Sbjct 61 GAGVSGLAAAYRLRKRGVQVTVFEAADRAGGKIRTNSEGGFIWDEGANTMTESELEASRL 120 Query 121 IDDLGLQGKQQYPNSQHKRYIVKDGAPTLIPSDPIALMKSTVLSTKSKLKLFLEPFLYEK 180 IDDLGLQGKQQYPNSQHKRYIVKDGAPTLIPSDPIALMKSTVLSTKSKLKLFLEPFLYEK Sbjct 121 IDDLGLQGKQQYPNSQHKRYIVKDGAPTLIPSDPIALMKSTVLSTKSKLKLFLEPFLYEK 180 Query 181 SSRRTSGKVSDEHLSESVASFFERHFGKEVVDYLIDPFVAGTSGGDPESLSIRHAFPALW 240 SSRRTSGKVSDEHLSESVASFFERHFGKEVVDYLIDPFVAGTSGGDPESLSIRHAFPALW Sbjct 181 SSRRTSGKVSDEHLSESVASFFERHFGKEVVDYLIDPFVAGTSGGDPESLSIRHAFPALW 240 Query 241 NLENKYGSVIAGAILSKLSTKGDSVKTGGASPGKGRNKRVSFSFHGGMQSLIDALHNEVG 300 NLENKYGSVIAGAILSKLSTKGDSVKTGGASPGKGRNKRVSFSFHGGMQSLIDALHNEVG Sbjct 241 NLENKYGSVIAGAILSKLSTKGDSVKTGGASPGKGRNKRVSFSFHGGMQSLIDALHNEVG 300 Query 301 DGNVKLGTEVLSLACCCDGVSSSGGWSISVDSKDAKGKDLRKNQSFDAVIMTAPLSNVQR 360 DGNVKLGTEVLSLACCCDGVSSSGGWSISVDSKDAKGKDLRKNQSFDAVIMTAPLSNVQR Sbjct 301 DGNVKLGTEVLSLACCCDGVSSSGGWSISVDSKDAKGKDLRKNQSFDAVIMTAPLSNVQR 360 Query 361 MKFTKGGVPFVLDFLPKVDYLPLSLMVTAFKKEDVKKPLEGFGALIPYKEQQKHGLKTLG 420 MKFTKGGVPFVLDFLPKVDYLPLSLMVTAFKKEDVKKPLEGFGALIPYKEQQKHGLKTLG Sbjct 361 MKFTKGGVPFVLDFLPKVDYLPLSLMVTAFKKEDVKKPLEGFGALIPYKEQQKHGLKTLG 420 Query 421 TMFSSMMFPDRAPNDQYLYTSFIGGSHNRDLAGAPTAILKQLVTSDLRKLLGVEGQPTFV 480 T FSSMMFPDRAPNDQYLYTSFIGGSHNRDLAGAPTAILKQLVTSDLRKLLGVEGQPTFV Sbjct 421 TFFSSMMFPDRAPNDQYLYTSFIGGSHNRDLAGAPTAILKQLVTSDLRKLLGVEGQPTFV 480 Query 481 KHVHWRNAFPLYGQNYDLVLEAIA KMENNLPGFFYAGNNKDGLAVGNVIASGSKAADLVI 540 KHVHWRNAFPLYGQNYDLVLEAIA KMENNLPGFFYAGNNKDGLAVGNVIASGSKAADLVI Sbjct 481 KHVHWRNAFPLYGQNYDLVLEAIA KMENNLPGFFYAGNNKDGLAVGNVIASGSKAADLVI 540 Query 541 SYLESCTDQDN 551 SYLESCTDQDN Sbjct 541 SYLESCTDQDN 551 Query: Aponte’s SEQ ID NO:1 Sbjct: Applicant’s SEQ ID NO:1 Query 38 EEPTSAKRVAVVGAGVSGLAAAYKLKSHGLSVTLFEADSRAGGKLKTVKKDGFIWDEGAN 97 ++P + VAVVGAGVSGLAAAY+L+ G+ VT+FEA RAGGK++T + GFIWDEGAN Sbjct 49 DDPRGGRSVAVVGAGVSGLAAAYRLRKRGVQVTVFEAADRAGGKIRTNSEGGFIWDEGAN 108 Query 98 TMTESEAEVSSLIDDLGLREKQQLPISQNKRYIARDGLPVLLPSNPAALLTSNILSAKSK 157 TMTESE E S LIDDLGL+ KQQ P SQ+KRYI +DG P L+PS+P AL+ S +LS KSK Sbjct 109 TMTESELEASRLIDDLGLQGKQQYPNSQHKRYIVKDGAPTLIPSDPIALMKSTVLSTKSK 168 Query 158 LQIMLEPFLWRK---HNATELSDEHVQESVGEFFERHFGKEFVDYVIDPFVAGTCGGDPQ 214 L++ LEPFL+ K + ++SDEH+ ESV FFERHFGKE VDY+IDPFVAGT GGDP+ Sbjct 169 LKLFLEPFLYEKSSRRTSGKVSDEHLSESVASFFERHFGKEVVDYLIDPFVAGTSGGDPE 228 Query 215 SLSMHHTFPEVWNIEKRFGSVFAGLIQSTLLSKKE--KGGENASIKKPRVRGSFSFQGGM 272 SLS+ H FP +WN+E ++GSV AG I S L +K + K G + K R SFSF GGM Sbjct 229 SLSIRHAFPALWNLENKYGSVIAGAILSKLSTKGDSVKTGGASPGKGRNKRVSFSFHGGM 288 Query 273 QTLVDTMCKQLGEDELKLQCEVLSLSYNQKGIPSLGNWSVSSMSNNTS-----EDQSYDA 327 Q+L+D + ++G+ +KL EVLSL+ G+ S G WS+S S + ++QS+DA Sbjct 289 QSLIDALHNEVGDGNVKLGTEVLSLACCCDGVSSSGGWSISVDSKDAKGKDLRKNQSFDA 348 Query 328 VVVTAPIRNVKEMKIMKFGNPFSLDFIPEVTYVPLSVMITAFKKDKVKRPLEGFGVLIPS 387 V++TAP+ NV+ MK K G PF LDF+P+V Y+PLS+M+TAFKK+ VK+PLEGFG LIP Sbjct 349 VIMTAPLSNVQRMKFTKGGVPFVLDFLPKVDYLPLSLMVTAFKKEDVKKPLEGFGALIPY 408 Query 388 KEQH-NGLKTLGTLFSSMMFPDRAPSDMCLFTTFVGGSRNRKLANASTDELKQIVSSDLQ 446 KEQ +GLKTLGTLFSSMMFPDRAP+D L+T+F+GGS NR LA A T LKQ+V+SDL+ Sbjct 409 KEQQKHGLKTLGTLFSSMMFPDRAPNDQYLYTSFIGGSHNRDLAGAPTAILKQLVTSDLR 468 Query 447 QLLGTEDEPSFVNHLFWSNAFPLYGHNYDSVLRAIDKMEKDLPGFFYAGNHKGGLSVGKA 506 +LLG E +P+FV H+ W NAFPLYG NYD VL AI KME +LPGFFYAGN+K GL+VG Sbjct 469 KLLGVEGQPTFVKHVHWRNAFPLYGQNYDLVLEAIA KMENNLPGFFYAGNNKDGLAVGNV 528 Query 507 MASGCKAAELVISYLDS 523 +ASG KAA+LVISYL+S Sbjct 529 IASGSKAADLVISYLES 545 Accordingly, Aponte anticipated the claimed invention. Citation of Relevant Prior Art The prior art made of record and not relied upon but is considered pertinent to the Applicant’s disclosure. US 12655441 B2 is drawn to mutations in PPO enzymes for herbicide resistance. US 20230287389 A1 is also drawn to mutating PPO1 enzymes for herbicide resistance. Conclusion No claims are allowed. Contact Information Any inquiry concerning this communication or earlier communications from the examiner should be directed to GEORGE W MEYER whose telephone number is (571)272-3733. The examiner can normally be reached Monday - Friday 8:00 am- 5:00 pm. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Bratislav Stankovic can be reached at (571) 270-0305. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /GEORGE W MEYER/Examiner, Art Unit 1662 /BRATISLAV STANKOVIC/Supervisory Patent Examiner, Art Units 1661 & 1662
Read full office action

Prosecution Timeline

Apr 03, 2025
Application Filed
Apr 07, 2025
Response after Non-Final Action
Sep 17, 2026
Non-Final Rejection mailed — §102, §112 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12740520
MAMMAL KINASE INHIBITORS TO PROMOTE IN VITRO EMBRYOGENESIS INDUCTION OF PLANTS
4y 4m to grant Granted Sep 22, 2026
Study what changed to get past this examiner. Based on 1 most recent grants.

Strategy Recommendation AI-generated — please review before filing

Get a prosecution strategy drawn from examiner precedents, rejection analysis, and claim mapping.
Typically takes 5-10 seconds — AI-generated, attorney review required before filing

Prosecution Projections

1-2
Expected OA Rounds
100%
Grant Probability
99%
With Interview (+0.0%)
2y 4m (~10m remaining)
Median Time to Grant
Low
PTA Risk
Based on 5 resolved cases by this examiner. Grant probability derived from career allowance rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month