Prosecution Insights
Last updated: October 02, 2026
Application No. 18/855,903

ALCOHOL ACYLTRANSFERASE AND A TRANSGENIC CELL, TISSUE, AND ORGANISM COMPRISING SAME

Non-Final OA §101§112§DP
Filed
Oct 10, 2024
Priority
Apr 13, 2022 — provisional 63/330,527 +1 more
Examiner
SHELTON, SYNPHANE LA'SHAWN
Art Unit
Tech Center
Assignee
Yeda Research and Development Co. Ltd.
OA Round
1 (Non-Final)
100%
Grant Probability
Favorable
1-2
OA Rounds
1y 6m
Est. Remaining
99%
With Interview

Examiner Intelligence

Grants 100% — above average
100%
Career Allowance Rate
2 granted / 2 resolved
+40.0% vs TC avg
Minimal +0% lift
Without
With
+0.0%
Interview Lift
resolved cases with interview
Typical timeline
3y 5m
Avg Prosecution
42 currently pending
Career history
24
Total Applications
across all art units

Statute-Specific Performance

§101
1.9%
-38.1% vs TC avg
§103
40.6%
+0.6% vs TC avg
§102
14.4%
-25.6% vs TC avg
§112
28.1%
-11.9% vs TC avg
Black line = Tech Center average estimate • Based on career data from 2 resolved cases

Office Action

§101 §112 §DP
DETAILED ACTION Status of Application Claims 1-2, 4-7, 10, 14, 16, 18-20, 28-34 are pending The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . A preliminary amendment of claims 2, 4, 6-7, 10, 14, 16, 18, 20, 28-30, 33-34 and cancellation of claims 3, 8-9, 11-13, 15, 17, 21-27 as submitted in a communication filed on 10/10/2024 is acknowledged. Because applicants did not distinctly and specifically point out the supposed errors in the restriction requirement, the election has been treated as an election without traverse (MPEP § 818.03(a)). Applicant’s election without traverse of Group I, claims 1-2, 4-7, 10, 14, 18, drawn in part to an isolated DNA molecule, an isolated alcohol acyltransferase protein encoded by the isolated DNA molecule, a transgenic cell comprising the isolated protein, an extract derived from the transgenic cell, and a composition comprising the isolated protein and an acceptable carrier, as submitted in communication filed on 08/04/2026 is acknowledged. The species election, in the reply filed on 08/04/2026, was made without traverse for the following species: Species Group 1: SEQ ID NO: 5; Species Group 2: SEQ ID NO: 20; Species Group 3: CBGA; Species Group 4: OH. Claims 16, 19-20, 28-34 are withdrawn from further consideration pursuant to 37 CFR 1.142(b) as being drawn to a nonelected invention, there being no allowable generic or linking claim. Election was made without traverse in the reply filed on 08/04/2026. Claims 1-2, 4-7, 10, 14, 18, are at issue and will be examined to the extent they encompass the elected invention. Priority Acknowledgment is made of applicants’ claim for domestic priority under 35 U.S.C. 119 (e) to provisional Application No. 63/330527 filed on 04/13/2022. This is the US national application which entered the national stage from Application No. PCT/IL2023/050393 filed on 04/13/2023. Information Disclosure Statement The information disclosure statements (IDS) submitted on 12/15/2025 and 08/04/2026 are acknowledged. The submissions are in compliance with the provisions of 37 CFR 1.97. Accordingly, the information disclosure statements are being considered by the examiner. Drawings The drawings submitted on 10/10/2024 have been reviewed and are accepted by the examiner for examination purposes. Claim Objections Claim 2 is objected to due to the recitation of “1,00 to 1,800 nucleotides”. It should be amended to recite “1,000 to 1,800 nucleotides”. Appropriate correction is required. Claim Rejections - 35 USC § 112(b) or Second Paragraph (pre-AIA ) The following is a quotation of 35 U.S.C. 112(b): (b) CONCLUSION.—The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the inventor or a joint inventor regards as the invention. The following is a quotation of 35 U.S.C. 112 (pre-AIA ), second paragraph: The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the applicant regards as his invention. Claims 1-2, 4-7, 10, 14, 18 are rejected under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter which the inventor or a joint inventor (or for applications subject to pre-AIA 35 U.S.C. 112, the applicant), regards as the invention. Claims 1-2, and 7 (claims 4-6, 10, 14, and 18 dependent thereon) is indefinite due to the term “homology” for the following reasons: Regarding claim 1-2, the term “87% homology” to SEQ ID NO: 5 is unclear and confusing in the absence of a definition providing the intended meaning of the term or the intended parameters required to determine the required homology value. While one could argue that the term “sequence homology” can be interpreted as “sequence identity”, as known in the art, these terms are not equivalent. The calculation of sequence homology takes into consideration the type of mismatches, i.e. even mismatches contribute to the % homology value, whereas mismatches do not have any weight in the calculation of sequence identity, i.e. only exact matches contribute to the % identity value. Thus, if there is no indication that the term “homology” is intended to mean “identity”, and the specification does not provide the specific parameters intended in the calculation of sequence homology (e.g., PAM matrices), one of skill in the art cannot determine the scope of the term “87% homology” because one could have a nucleic acid sequence which is 87% sequence homologous to a reference sequence based on a particular matrix/set of parameters, and at the same time, not 87% sequence homologous to the same reference sequence if other matrices/parameters are used. For examination purposes, it will be assumed that the term reads “87% identical”. Correction is required. Regarding claim 7, the term “homology” is unclear and confusing in the absence of a definition providing the intended meaning of the term or the intended parameters required to determine the required homology value. While one could argue that the term “sequence homology” can be interpreted as “sequence identity”, as known in the art, these terms are not equivalent. The calculation of sequence homology takes into consideration the type of mismatches, i.e. even mismatches contribute to the % homology value, whereas mismatches do not have any weight in the calculation of sequence identity, i.e. only exact matches contribute to the % identity value. Thus, if there is no indication that the term “homology” is intended to mean “identity”, and the specification does not provide the specific parameters intended in the calculation of sequence homology, one of skill in the art cannot determine the scope of the term “91% homology” because one could have a polypeptide which is 91% sequence homologous to a reference sequence based on a particular matrix, and at the same time not 91% sequence homologous to the same reference sequence if other matrices/parameters are used. For examination purposes, it will be assumed that the term reads “91% identical”. Correction is required. Claim Rejections - 35 USC § 112(a) or First Paragraph (pre-AIA ) The following is a quotation of the first paragraph of 35 U.S.C. 112(a): (a) IN GENERAL.—The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor or joint inventor of carrying out the invention. The following is a quotation of the first paragraph of pre-AIA 35 U.S.C. 112: The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor of carrying out his invention. Claims 1-2, 4-7, 10, 14, 18 are rejected under 35 U.S.C. 112(a) or 35 U.S.C. 112 (pre-AIA ), first paragraph, as failing to comply with the written description requirement. The claim(s) contains subject matter which was not described in the specification in such a way as to reasonably convey to one skilled in the relevant art that the inventor or a joint inventor, or for pre-AIA the inventor(s), at the time the application was filed, had possession of the claimed invention. As stated in MPEP 2111.01, during examination, the claims must be interpreted as broadly as their terms reasonably allow. Claims 1-2, 4-7, 10, 14, 18 encompass an isolated DNA molecule comprising a nucleic acid sequence having at least 87% identity to SEQ ID NO: 5 and an isolated protein comprising an amino acid sequence with at least 91% identity to SEQ ID NO: 20. As indicated in MPEP § 2163, the written description requirement for a claimed genus may be satisfied through sufficient description of a representative number of species by actual reduction to practice, reduction to drawings, or by disclosure of relevant, identifying characteristics, i.e., structure or other physical and/or chemical properties, by functional characteristics coupled with a known or disclosed correlation between function and structure, or by a combination of such identifying characteristics, sufficient to show that Applicant was in possession of the claimed genus. In addition, MPEP § 2163 states that a representative number of species means that the species which are adequately described are representative of the entire genus. Thus, when there is substantial variation within the genus, one must describe a sufficient variety of species to reflect the variation within the genus. A nucleic acid sequence having at least 87% identity to SEQ ID NO: 5, and an amino acid sequence having at least 91% sequence identity to SEQ ID NO: 20 allows for numerous variants of the disclosed DNA molecule and protein. A sufficient written description of a genus may be achieved by a recitation of a representative number of species falling within the scope of the genus or a recitation of structural features common to members of the genus, which features constitute a substantial portion of the genus. However, in the instant case, the specification does not disclose a representative number of SEQ ID NO: 5 and SEQ ID NO: 20 variants and does not identify structural features common to the members of the claimed genera. Accordingly, one cannot reasonably conclude that the few species disclosed are representative of the variants of SEQ ID Nos: 5 and 20 in the claimed invention. Therefore, one of ordinary skill in the art would not recognize from the disclosure that Applicant was in possession of the claimed invention. Claim Rejections - 35 USC § 101 35 U.S.C. 101 reads as follows: Whoever invents or discovers any new and useful process, machine, manufacture, or composition of matter, or any new and useful improvement thereof, may obtain a patent therefor, subject to the conditions and requirements of this title. Claims 6-7 and 18 are rejected under 35 U.S.C. 101 because the claimed invention is directed to a natural phenomenon, without significantly more. The claims are directed in part to a protein having the amino acid sequence of SEQ ID NO: 20. The protein having the amino acid sequence of SEQ ID NO:20 is a naturally occurring product, see Example 2 of the specification. This judicial exception is not integrated into a practical application because merely isolating a product of nature does not add a meaningful limitation. The claims do not include additional elements that are sufficient to amount to significantly more than the judicial exception. Furthermore, there is no indication in the claims or specification that isolating the protein results in any markedly different characteristics. Double Patenting The nonstatutory double patenting rejection is based on a judicially created doctrine grounded in public policy (a policy reflected in the statute) so as to prevent the unjustified or improper timewise extension of the “right to exclude” granted by a patent and to prevent possible harassment by multiple assignees. A nonstatutory double patenting rejection is appropriate where the conflicting claims are not identical, but at least one examined application claim is not patentably distinct from the reference claim(s) because the examined application claim is either anticipated by, or would have been obvious over, the reference claim(s). See, e.g., In re Berg, 140 F.3d 1428, 46 USPQ2d 1226 (Fed. Cir. 1998); In re Goodman, 11 F.3d 1046, 29 USPQ2d 2010 (Fed. Cir. 1993); In re Longi, 759 F.2d 887, 225 USPQ 645 (Fed. Cir. 1985); In re Van Ornum, 686 F.2d 937, 214 USPQ 761 (CCPA 1982); In re Vogel, 422 F.2d 438, 164 USPQ 619 (CCPA 1970); In re Thorington, 418 F.2d 528, 163 USPQ 644 (CCPA 1969). A timely filed terminal disclaimer in compliance with 37 CFR 1.321(c) or 1.321(d) may be used to overcome an actual or provisional rejection based on nonstatutory double patenting provided the reference application or patent either is shown to be commonly owned with the examined application, or claims an invention made as a result of activities undertaken within the scope of a joint research agreement. See MPEP § 717.02 for applications subject to examination under the first inventor to file provisions of the AIA as explained in MPEP § 2159. See MPEP § 2146 et seq. for applications not subject to examination under the first inventor to file provisions of the AIA . A terminal disclaimer must be signed in compliance with 37 CFR 1.321(b). The filing of a terminal disclaimer by itself is not a complete reply to a nonstatutory double patenting (NSDP) rejection. A complete reply requires that the terminal disclaimer be accompanied by a reply requesting reconsideration of the prior Office action. Even where the NSDP rejection is provisional the reply must be complete. See MPEP § 804, subsection I.B.1. For a reply to a non-final Office action, see 37 CFR 1.111(a). For a reply to final Office action, see 37 CFR 1.113(c). A request for reconsideration while not provided for in 37 CFR 1.113(c) may be filed after final for consideration. See MPEP §§ 706.07(e) and 714.13. The USPTO Internet website contains terminal disclaimer forms which may be used. Please visit www.uspto.gov/patent/patents-forms. The actual filing date of the application in which the form is filed determines what form (e.g., PTO/SB/25, PTO/SB/26, PTO/AIA /25, or PTO/AIA /26) should be used. A web-based eTerminal Disclaimer may be filled out completely online using web-screens. An eTerminal Disclaimer that meets all requirements is auto-processed and approved immediately upon submission. For more information about eTerminal Disclaimers, refer to www.uspto.gov/patents/apply/applying-online/eterminal-disclaimer. Claims 1, 4-7, 10, 14, 18 are provisionally rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1, 5, 7, 14, 16, 21, and 25 of copending Application No. 19/072119 (‘119). Claims 1, 4-7, 10, 14, 18, of the instant case, as interpreted are directed in part to an isolated DNA molecule comprising a nucleic acid sequence having at least 87% identity to SEQ ID NO: 5; an artificial nucleic acid molecule comprising the isolated DNA molecule; a plasmid or an agrobacterium comprising the artificial nucleic acid molecule; an isolated protein encoded by the isolated DNA molecule of having at least 87% homology; the isolated protein, comprising or consisting of an amino acid sequence with at least 91% homology to SEQ ID NO: 20; a transgenic cell comprising the isolated protein, optionally wherein said transgenic cell being any one of: a unicellular organism, a cell of a multicellular organism, and a cell in a culture, and optionally wherein said unicellular organism comprises a fungus or a bacterium, and optionally wherein said fungus is a yeast cell; an extract derived from the transgenic cell, or any fraction thereof, and optionally wherein said extract comprises said isolated protein; a composition comprising the isolated protein and an acceptable carrier. Claim 1 of ‘119 as interpreted is directed in part to an isolated DNA molecule comprising at least a first nucleic acid sequence encoding a first protein and at least a second nucleic acid sequence encoding a second protein, wherein said first protein and said second protein are derived from Helichrysum umbraculigerum and belonging to an enzyme family selected from the group consisting of: acyl activating enzyme (AAE), polyketide synthase (PKS), polyketide cyclase (PKC), prenyltransferase (PT), and cannabichromenic acid synthase (CBCAS), and wherein said first protein and said second protein belong to different enzyme families. Claim 5 of ‘119 as interpreted is directed in part to the isolated DNA molecule of claim 1 of ‘119, further comprising a nucleic acid sequence encoding a protein derived from H. umbraculigerum and belonging to an enzyme family selected from the group consisting of: uridine diphosphate (UDP)-glycosyltransferase (UGT), alcohol acyltransferase (AAT), and both, and optionally wherein: (a) said UGT comprises an amino acid sequence with at least 90% homology to any one of: SEQ ID Nos.: 102-114; (b) said AAT comprises an amino acid sequence with at least 91% homology to any one of: SEQ ID Nos.: 130-144; or (c) both (a) and (b). Claim 7 of ‘119 as interpreted is directed in part to the isolated DNA molecule of claim 5 of ‘119, wherein: a. said UGT is encoded by a nucleic acid sequence having at least 87% homology to any one of: SEQ ID Nos.: 89-101, and any combination thereof; b. said AAT is encoded by a nucleic acid sequence having at least 87% homology to any one of: SEQ ID Nos.: 115-129, and any combination thereof; or c. both (a) and (b). Claim 14 of ‘119 as interpreted is directed in part to an artificial nucleic acid molecule, a plasmid, or an agrobacterium comprising the isolated DNA molecule of claim 1 of ‘119. Claim 16 of ‘119 as interpreted is directed in part to a transgenic cell comprising the isolated DNA molecule of claim 1 of ‘119, and optionally wherein said transgenic cell is a transgenic Cannabis sativa cell. Claim 21 of ‘119 as interpreted is directed in part to an extract derived from the transgenic cell of claim 16 of ‘119, or any fraction thereof, and optionally wherein said extract comprises a cannabinoid, a precursor thereof, or a combination thereof Claim 25 of ‘119 as interpreted is directed in part to a composition comprising the isolated DNA molecule of claim 1 of ‘119, and an acceptable carrier. It is noted that SEQ ID NO: 5 and SEQ ID NO: 20 have 100% identity to SEQ ID NO: 119 and SEQ ID NO: 134, respectively. See alignments below. Therefore, although the claims at issue are not identical, they are not patentably distinct from each other. This is a provisional nonstatutory double patenting rejection because the patentably indistinct claims have not in fact been patented. Sequence 119, US/19072119 GENERAL INFORMATION APPLICANT: YEDA RESEARCH AND DEVELOPMENT CO. LTD. (en) TITLE OF INVENTION: COMBINATION OF NUCLEIC ACID SEQUENCES ENCODING PROTEINS DERIVED FROM HELICHRYSUM UMBRACULIGERUM, AND ANY TRANSGENIC CELL, TISSUE, AND ORGANISM COMPRISING SAME (en) FILE REFERENCE: YEDA-P-010-PCT CURRENT APPLICATION NUMBER: US/19/072,119 CURRENT FILING DATE: 2025-03-06 NUMBER OF SEQ ID NOS: 144 SEQ ID NO 119 LENGTH: 1608 TYPE: DNA FEATURE: NAME/KEY: source LOCATION: 1..1608 QUALIFIERS: mol_type = other DNA organism = Helicrysum umbraculigerum Query Match 100.0%; Score 1608; Length 1608; Best Local Similarity 100.0%; Matches 1608; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 ATGAAGTGGTTTTTCATAACCCATAAAGCAACCCAGCGTTGCCTTAATTCTAAACAATTT 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 ATGAAGTGGTTTTTCATAACCCATAAAGCAACCCAGCGTTGCCTTAATTCTAAACAATTT 60 Qy 61 CATCTTCACGGAGGTTCGAATTTCGTTTCCGGTAATAGATGTTTTCTTGCATCACACTCA 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 CATCTTCACGGAGGTTCGAATTTCGTTTCCGGTAATAGATGTTTTCTTGCATCACACTCA 120 Qy 121 ATGGAGCGGCCAAAATTCATGTTGATACCATATTATCCCTACCAAATTCGGTCCTTAAAT 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 ATGGAGCGGCCAAAATTCATGTTGATACCATATTATCCCTACCAAATTCGGTCCTTAAAT 180 Qy 181 TCGAGTCACCGATATAGTAGTACGTCACCCAGCGGATCCCCTCACAGTTTTCTGAATGGT 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 TCGAGTCACCGATATAGTAGTACGTCACCCAGCGGATCCCCTCACAGTTTTCTGAATGGT 240 Qy 241 ACTAAGAATGAAAACTATACGAAGAAGGTAGATCTTGAAATAATTTCAAGAGAAATCATC 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 ACTAAGAATGAAAACTATACGAAGAAGGTAGATCTTGAAATAATTTCAAGAGAAATCATC 300 Qy 301 AAACCAGCTTCTCCAACTCCACATCATTTAAGAAACTTCAACTTATCACTTTTGGACCAA 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 AAACCAGCTTCTCCAACTCCACATCATTTAAGAAACTTCAACTTATCACTTTTGGACCAA 360 Qy 361 ATAGTATTTGATTGCTACACCCCTGTAATCCTCTTTATTCCAAATAGTAATAAGGCTACT 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 ATAGTATTTGATTGCTACACCCCTGTAATCCTCTTTATTCCAAATAGTAATAAGGCTACT 420 Qy 421 GTTACGGATGTCATGATCAAAAGATTGAAACATCTCAAGGAGACTTTATCTCGAATTCTA 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 GTTACGGATGTCATGATCAAAAGATTGAAACATCTCAAGGAGACTTTATCTCGAATTCTA 480 Qy 481 AGTCAATTTTATCCCTTTGCGGGAGAAGTTAAGGACAGATTGCATATCGAATGCAATGAC 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 481 AGTCAATTTTATCCCTTTGCGGGAGAAGTTAAGGACAGATTGCATATCGAATGCAATGAC 540 Qy 541 AAGGGAGTCAATTACATCGAGGCTCAAATCAATGAGACATTGGAAGAATTTCTATGTCAT 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 541 AAGGGAGTCAATTACATCGAGGCTCAAATCAATGAGACATTGGAAGAATTTCTATGTCAT 600 Qy 601 CCAGATAACGAAAAGGCGAGGGAGCTTATGCCCGAAAGCCCTCATGTTCAAGAATCTGCA 660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 601 CCAGATAACGAAAAGGCGAGGGAGCTTATGCCCGAAAGCCCTCATGTTCAAGAATCTGCA 660 Qy 661 ATAGGAAACTATGCTATGGGTATTCAGATAAACATTTTCAGTTGCGGAGGGATTGGACTT 720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 661 ATAGGAAACTATGCTATGGGTATTCAGATAAACATTTTCAGTTGCGGAGGGATTGGACTT 720 Qy 721 TCCATGAGCATGGCACACAAGATCATGGACTTCTACACATATACGATCTTCATGAAAGCA 780 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 721 TCCATGAGCATGGCACACAAGATCATGGACTTCTACACATATACGATCTTCATGAAAGCA 780 Qy 781 TGGGCTGCAGCTGTTCGAGGTTCACCAGATACAATTATTTCACCAAGTTTTGTGGCTTCT 840 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 781 TGGGCTGCAGCTGTTCGAGGTTCACCAGATACAATTATTTCACCAAGTTTTGTGGCTTCT 840 Qy 841 GAGGTCTTTCCTAATGATCCCAGCCAAGAAGATTCAATTCCTATCGAGTTAAAGTCTAGT 900 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 841 GAGGTCTTTCCTAATGATCCCAGCCAAGAAGATTCAATTCCTATCGAGTTAAAGTCTAGT 900 Qy 901 AATTTGCTTAGCACAAAAAGATTTGAGTTTGATCCTACTGCGTTGGCTCTCCTAAAGGGA 960 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 901 AATTTGCTTAGCACAAAAAGATTTGAGTTTGATCCTACTGCGTTGGCTCTCCTAAAGGGA 960 Qy 961 CAAGTTGTCGCCAGCGGATCACCTCCCCAACGAGGACCAAGTCGTATGGAGGCGACAACA 1020 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 961 CAAGTTGTCGCCAGCGGATCACCTCCCCAACGAGGACCAAGTCGTATGGAGGCGACAACA 1020 Qy 1021 GCCGTTATTTGGAAGGCCGCTGCAAAAGCTGCATCGACTGTCAGAAGATTCGATCCAAAG 1080 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1021 GCCGTTATTTGGAAGGCCGCTGCAAAAGCTGCATCGACTGTCAGAAGATTCGATCCAAAG 1080 Qy 1081 TCACCTCATGCGCTGGCGTTACCAGTAAATATACGTAAAAGGGCATCACCTGCTCTCCCA 1140 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1081 TCACCTCATGCGCTGGCGTTACCAGTAAATATACGTAAAAGGGCATCACCTGCTCTCCCA 1140 Qy 1141 GACAATTCCATAGGAAACATAGTTATGCGAGGTATAGCAATTTGTTTTCCTGAGAGCCAA 1200 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1141 GACAATTCCATAGGAAACATAGTTATGCGAGGTATAGCAATTTGTTTTCCTGAGAGCCAA 1200 Qy 1201 CCGGACTTGCCAACTCTTATGGGTAAAGTGAGAGAATCAATAGCGAAACTTAACTCAGAT 1260 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1201 CCGGACTTGCCAACTCTTATGGGTAAAGTGAGAGAATCAATAGCGAAACTTAACTCAGAT 1260 Qy 1261 TACATTGAGTCCCTGAAAGGTGAAAAGGGGCATGAGACAGTTAATAAGATGTTGAAGGAG 1320 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1261 TACATTGAGTCCCTGAAAGGTGAAAAGGGGCATGAGACAGTTAATAAGATGTTGAAGGAG 1320 Qy 1321 TTGAAGCTTCGGACGAATATGACAAAGGTAGGAGGGAAATTCGTTGCTAGTTGCATATTT 1380 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1321 TTGAAGCTTCGGACGAATATGACAAAGGTAGGAGGGAAATTCGTTGCTAGTTGCATATTT 1380 Qy 1381 AATAGTGGAATATATGAGTTGGATTTCGGGTGGGGAAAACCGATATGGTTCTATGTTGTG 1440 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1381 AATAGTGGAATATATGAGTTGGATTTCGGGTGGGGAAAACCGATATGGTTCTATGTTGTG 1440 Qy 1441 AATCCAGGAAGCGATAGTTGTGTGGTTTTGACTGATACGCTGAAGGGTGGTGGTGTTGAA 1500 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1441 AATCCAGGAAGCGATAGTTGTGTGGTTTTGACTGATACGCTGAAGGGTGGTGGTGTTGAA 1500 Qy 1501 GCCACAATTACACTACCACCAGATGAAATGGAGATATTCGAACGTGATCATGAGCTTCTA 1560 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1501 GCCACAATTACACTACCACCAGATGAAATGGAGATATTCGAACGTGATCATGAGCTTCTA 1560 Qy 1561 TCCTATACTACCATCAACCCTAGTCCACTGCGATTTCTTGACCATTGA 1608 |||||||||||||||||||||||||||||||||||||||||||||||| Db 1561 TCCTATACTACCATCAACCCTAGTCCACTGCGATTTCTTGACCATTGA 1608 Sequence 134, US/19072119 Publication No. US20250230478A1 GENERAL INFORMATION APPLICANT: YEDA RESEARCH AND DEVELOPMENT CO. LTD. (en) TITLE OF INVENTION: COMBINATION OF NUCLEIC ACID SEQUENCES ENCODING PROTEINS DERIVED FROM HELICHRYSUM UMBRACULIGERUM, AND ANY TRANSGENIC CELL, TISSUE, AND ORGANISM COMPRISING SAME (en) FILE REFERENCE: YEDA-P-010-PCT CURRENT APPLICATION NUMBER: US/19/072,119 CURRENT FILING DATE: 2025-03-06 NUMBER OF SEQ ID NOS: 144 SEQ ID NO 134 LENGTH: 535 TYPE: PRT FEATURE: NAME/KEY: source LOCATION: 1..535 QUALIFIERS: mol_type = protein organism = Helicrysum umbraculigerum Query Match 100.0%; Score 2808; Length 535; Best Local Similarity 100.0%; Matches 535; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MKWFFITHKATQRCLNSKQFHLHGGSNFVSGNRCFLASHSMERPKFMLIPYYPYQIRSLN 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MKWFFITHKATQRCLNSKQFHLHGGSNFVSGNRCFLASHSMERPKFMLIPYYPYQIRSLN 60 Qy 61 SSHRYSSTSPSGSPHSFLNGTKNENYTKKVDLEIISREIIKPASPTPHHLRNFNLSLLDQ 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 SSHRYSSTSPSGSPHSFLNGTKNENYTKKVDLEIISREIIKPASPTPHHLRNFNLSLLDQ 120 Qy 121 IVFDCYTPVILFIPNSNKATVTDVMIKRLKHLKETLSRILSQFYPFAGEVKDRLHIECND 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 IVFDCYTPVILFIPNSNKATVTDVMIKRLKHLKETLSRILSQFYPFAGEVKDRLHIECND 180 Qy 181 KGVNYIEAQINETLEEFLCHPDNEKARELMPESPHVQESAIGNYAMGIQINIFSCGGIGL 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 KGVNYIEAQINETLEEFLCHPDNEKARELMPESPHVQESAIGNYAMGIQINIFSCGGIGL 240 Qy 241 SMSMAHKIMDFYTYTIFMKAWAAAVRGSPDTIISPSFVASEVFPNDPSQEDSIPIELKSS 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 SMSMAHKIMDFYTYTIFMKAWAAAVRGSPDTIISPSFVASEVFPNDPSQEDSIPIELKSS 300 Qy 301 NLLSTKRFEFDPTALALLKGQVVASGSPPQRGPSRMEATTAVIWKAAAKAASTVRRFDPK 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 NLLSTKRFEFDPTALALLKGQVVASGSPPQRGPSRMEATTAVIWKAAAKAASTVRRFDPK 360 Qy 361 SPHALALPVNIRKRASPALPDNSIGNIVMRGIAICFPESQPDLPTLMGKVRESIAKLNSD 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 SPHALALPVNIRKRASPALPDNSIGNIVMRGIAICFPESQPDLPTLMGKVRESIAKLNSD 420 Qy 421 YIESLKGEKGHETVNKMLKELKLRTNMTKVGGKFVASCIFNSGIYELDFGWGKPIWFYVV 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 YIESLKGEKGHETVNKMLKELKLRTNMTKVGGKFVASCIFNSGIYELDFGWGKPIWFYVV 480 Qy 481 NPGSDSCVVLTDTLKGGGVEATITLPPDEMEIFERDHELLSYTTINPSPLRFLDH 535 ||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 481 NPGSDSCVVLTDTLKGGGVEATITLPPDEMEIFERDHELLSYTTINPSPLRFLDH 535 Conclusion No claim is in condition for allowance. Any inquiry concerning this communication or earlier communications from the examiner should be directed to SYNPHANE SHELTON whose telephone number is (571)272-6318. The examiner can normally be reached 9:00am-7pm. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Robert Mondesi can be reached at (408) 918-7584. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /S.L.S./Examiner, Art Unit 1652 /ROBERT B MONDESI/Supervisory Patent Examiner, Art Unit 1652
Read full office action

Prosecution Timeline

Oct 10, 2024
Application Filed
Sep 21, 2026
Non-Final Rejection mailed — §101, §112, §DP (current)

Strategy Recommendation AI-generated — please review before filing

Get a prosecution strategy drawn from examiner precedents, rejection analysis, and claim mapping.
Typically takes 5-10 seconds — AI-generated, attorney review required before filing

Prosecution Projections

1-2
Expected OA Rounds
100%
Grant Probability
99%
With Interview (+0.0%)
3y 5m (~1y 6m remaining)
Median Time to Grant
Low
PTA Risk
Based on 2 resolved cases by this examiner. Grant probability derived from career allowance rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month