Prosecution Insights
Last updated: April 19, 2026
Application No. 18/879,096

L-GLUTAMIC ACID-PRODUCING MUTANT MICROORGANISM OF GENUS CORYNEBACTERIUM, AND METHOD FOR PRODUCING L-GLUTAMIC ACID USING SAME

Non-Final OA §102
Filed
Dec 26, 2024
Examiner
PAK, YONG D
Art Unit
1652
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Daesang Corporation
OA Round
1 (Non-Final)
74%
Grant Probability
Favorable
1-2
OA Rounds
3y 0m
To Grant
88%
With Interview

Examiner Intelligence

Grants 74% — above average
74%
Career Allow Rate
685 granted / 924 resolved
+14.1% vs TC avg
Moderate +14% lift
Without
With
+14.0%
Interview Lift
resolved cases with interview
Typical timeline
3y 0m
Avg Prosecution
55 currently pending
Career history
979
Total Applications
across all art units

Statute-Specific Performance

§101
7.0%
-33.0% vs TC avg
§103
21.0%
-19.0% vs TC avg
§102
21.8%
-18.2% vs TC avg
§112
32.6%
-7.4% vs TC avg
Black line = Tech Center average estimate • Based on career data from 924 resolved cases

Office Action

§102
Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . DETAILED ACTION This application is a continuation of PCT/KR2023/007159. The amendment filed on December 26, 2024 has been entered. Status of Claims Claim 6 is pending. Claim 6 is under examination. Claim for Foreign Priority Receipt is acknowledged of certified copies of papers required by 37 CFR 1.55. Information Disclosure Statement The information disclosure statement (IDS) submitted on December 26, 2024 is in compliance with the provisions of 37 CFR 1.97. Accordingly, the information disclosure statement is being considered by the examiner. Claim Rejections - 35 USC § 102 In the event the determination of the status of the application as subject to AIA 35 U.S.C. 102 and 103 (or as subject to pre-AIA 35 U.S.C. 102 and 103) is incorrect, any correction of the statutory basis for the rejection will not be considered a new ground of rejection if the prior art relied upon, and the rationale supporting the rejection, would be the same under either status. The following is a quotation of the appropriate paragraphs of 35 U.S.C. 102 that form the basis for the rejections under this section made in this Office action: A person shall be entitled to a patent unless – (a)(1) the claimed invention was patented, described in a printed publication, or in public use, on sale or otherwise available to the public before the effective filing date of the claimed invention. (a)(2) the claimed invention was described in a patent issued under section 151, or in an application for patent published or deemed published under section 122(b), in which the patent or application, as the case may be, names another inventor and was effectively filed before the effective filing date of the claimed invention. Claim(s) 6 is/are rejected under 35 U.S.C. 102(a)(1) as being anticipated by Ma (CN 112725253 - form PTO-892 and the English translation of CN 112725253. Retrieved on January 29, 2026 – form PTO-892. The English translation of CN 112725253 is used for specific passages of Ma). Regarding claim 6, Ma discloses a method of producing L-glutamic acid by (1) culturing a microorganism belonging to the genus of Corynebacterium or Corynebacterium glutamicum transformant comprising the enzyme variant consisting of the amino acid sequence of SEQ ID NO:4 (BBD29_14900D372N) a polynucleotide encoding the variant in a medium and (2) recovering L-glutamic acid from the medium in which the transformant has been cultured (page 4, page 9, page 14, and claim 10). The enzyme variant of SEQ ID NO:4 of Ma has 100% sequence identity to the NADP-dependent malic enzyme variant of SEQ ID NO:2 of the instant application (see the sequence alignment below). MPEP 2112.01. II. states that “[p]roducts of identical chemical composition cannot have mutually exclusive properties.” In re Spada, 911 F.2d 705, 709, 15 USPQ2d 1655, 1658 (Fed. Cir. 1990). A chemical composition and its properties are inseparable. Therefore, if the prior art teaches the identical chemical structure, the properties applicant discloses and/or claims are necessarily present.”. MPEP 2112. II. states that “[t]here is no requirement that a person of ordinary skill in the art would have recognized the inherent disclosure at the relevant time, but only that the subject matter is in fact inherent in the prior art reference.”. In the instant case, since the enzyme variant of SEQ ID NO:4 of Ma has identical structure as the NADP-dependent malic enzyme variant of SEQ ID NO:2 of the instant application, the enzyme variant of SEQ ID NO:4 of Ma is an NADP-dependent malic enzyme. Therefore, the reference of Ma anticipates claim 6. Claim(s) 6 is/are rejected under 35 U.S.C. 102(a)(2) as being anticipated by Ma (US20240076701 - form PTO-892). Regarding claim 6, Ma discloses a method of producing L-glutamic acid by (1) culturing a microorganism belonging to the genus of Corynebacterium or Corynebacterium glutamicum transformant comprising the enzyme variant consisting of the amino acid sequence of SEQ ID NO:4 (BBD29_14900D372N) or a polynucleotide encoding the variant in a medium and (2) recovering L-glutamic acid from the medium in which the transformant has been cultured ([0025]-[0026], [0035], [0187], Example 6, and claims 16-17). The enzyme variant of SEQ ID NO:4 of Ma has 100% sequence identity to the NADP-dependent malic enzyme variant of SEQ ID NO:2 of the instant application (see the sequence alignment below). MPEP 2112.01. II. states that “[p]roducts of identical chemical composition can not have mutually exclusive properties.” In re Spada, 911 F.2d 705, 709, 15 USPQ2d 1655, 1658 (Fed. Cir. 1990). A chemical composition and its properties are inseparable. Therefore, if the prior art teaches the identical chemical structure, the properties applicant discloses and/or claims are necessarily present.”. MPEP 2112. II. states that “[t]here is no requirement that a person of ordinary skill in the art would have recognized the inherent disclosure at the relevant time, but only that the subject matter is in fact inherent in the prior art reference.”. In the instant case, since the enzyme variant of SEQ ID NO:4 of Ma has identical structure as the NADP-dependent malic enzyme variant of SEQ ID NO:2 of the instant application, the enzyme variant of SEQ ID NO:4 of Ma is an NADP-dependent malic enzyme. Therefore, the reference of Ma anticipates claim 6. Conclusion Claim 6 is pending. Claim 6 is rejected. Any inquiry concerning this communication or earlier communications from the examiner should be directed to YONG D PAK whose telephone number is (571)272-0935. The examiner can normally be reached M-Th: 5:30 am - 3:30 pm. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Robert Mondesi can be reached on 408-918-7584. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /YONG D PAK/Primary Examiner, Art Unit 1652 Sequence alignment between the NDP-dependent malic enzyme variant of SEQ ID NO:2 of the instant application (“Qy”) and the enzyme variant of SEQ ID NO:4 of Ma CN112725253-A (“Db”) BJG54485 ID BJG54485 standard; protein; 392 AA. XX AC BJG54485; XX DT 24-JUN-2021 (first entry) XX DE Corynebacterium glutamicum BBD29_14900 protein mutant/D372N, SEQ ID 4. XX KW BBD29_14900 protein; amino acid production; fermentation; microorganism; KW mutein. XX OS Corynebacterium glutamicum; Strain ATCC 13869 CGMCC No. 21220. OS Synthetic. XX CC PN CN112725253-A. XX CC PD 30-APR-2021. XX CC PF 30-DEC-2020; 2020CN-11628757. XX PR 30-DEC-2020; 2020CN-11628757. XX CC PA (NING-) NINGXIA EPPEN BIOTECH CO LTD. XX CC PI Ma F, Wei A, Meng G, Zhao C, Jia H, Su H, Yang L, Guo X; CC PI Tian B, Zhou X; XX DR WPI; 2021-48206J/047. DR N-PSDB; BJG54483. XX CC PT New bacterium useful for producing L-glutamic acid, comprises CC PT polynucleotide encoding amino acid sequence. XX CC PS Claim 6; SEQ ID NO 4; 28pp; Chinese. XX CC The present invention relates to a novel bacterium, useful for producing CC L-glutamic acid. The bacterium comprises: improved expression of a CC polynucleotide encoding the amino acid sequence, the amino acid sequence CC of SEQ ID NO: 3 (see BJG54484) or its homologous sequence, preferably, CC the improved expression is enhanced the expression of the polynucleotide CC encoding the amino acid sequence of SEQ ID NO: 3 or its homologous CC sequence or the polynucleotide encoding the amino acid sequence of SEQ ID CC NO: 3 or its homologous sequence has a point mutation or the CC polynucleotide encoding the amino acid sequence of SEQ ID NO: 3 or its CC homologous sequence has a point mutation and the expression is enhanced. CC The invention also provides: a method for producing L-glutamic acid. XX SQ Sequence 392 AA; Query Match 100.0%; Score 1936; Length 392; Best Local Similarity 100.0%; Matches 392; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MTIDLQRSTQNLTHEEIFEAHEGGKLSISSTRPLRDMRDLSLAYTPGVAQVCEAIKEDPE 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MTIDLQRSTQNLTHEEIFEAHEGGKLSISSTRPLRDMRDLSLAYTPGVAQVCEAIKEDPE 60 Qy 61 VARTHTGIGNTVAVISDGTAVLGLGDIGPQASLPVMEGKAQLFSSFAGLKAIPIVLDVHD 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 VARTHTGIGNTVAVISDGTAVLGLGDIGPQASLPVMEGKAQLFSSFAGLKAIPIVLDVHD 120 Qy 121 VDALVETIAAIA PSFGAINLEDISAPRCFEVERRLIERLDIPVMHDDQHGTAVVILAALR 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 VDALVETIAAIA PSFGAINLEDISAPRCFEVERRLIERLDIPVMHDDQHGTAVVILAALR 180 Qy 181 NSLKLLDRKIEDLKIVISGAGAAGVAAVDMLTNAGATDIVVLDSRGIIHDSREDLSPVKA 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 NSLKLLDRKIEDLKIVISGAGAAGVAAVDMLTNAGATDIVVLDSRGIIHDSREDLSPVKA 240 Qy 241 ALAEKTNPRGISGGINEAFTGADLFIGVSGGNIGEDALKLMAPQPILFTLANPTPEIDPE 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 ALAEKTNPRGISGGINEAFTGADLFIGVSGGNIGEDALKLMAPQPILFTLANPTPEIDPE 300 Qy 301 LSQKYGAIVATGRSDLPNQINNVLAFPGIFAGALAAKAKKITPEMKLAAAEAIA DIAAED 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 LSQKYGAIVATGRSDLPNQINNVLAFPGIFAGALAAKAKKITPEMKLAAAEAIA DIAAED 360 Qy 361 LEVGRIVPTALNPRVAPAVKAAVQAVAEAQNA 392 |||||||||||||||||||||||||||||||| Db 361 LEVGRIVPTALNPRVAPAVKAAVQAVAEAQNA 392 Sequence alignment between the NDP-dependent malic enzyme variant of SEQ ID NO:2 of the instant application (“Qy”) and the enzyme variant of SEQ ID NO:4 of Ma of US20240076701 (“Db”) US-18-270-493-4 Sequence 4, US/18270493 Publication No. US20240076701A1 GENERAL INFORMATION APPLICANT: NINGXIA EPPEN BIOTECH CO., LTD TITLE OF INVENTION: Recombinant Strain with Modified Gene BBD29_14900, and Method for TITLE OF INVENTION: Constructing the Same and Use Thereof FILE REFERENCE: GNPYX21083 CURRENT APPLICATION NUMBER: US/18/270,493 CURRENT FILING DATE: 2023-06-30 NUMBER OF SEQ ID NOS: 32 SEQ ID NO 4 LENGTH: 392 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: Glutamate synthesis Query Match 100.0%; Score 1936; Length 392; Best Local Similarity 100.0%; Matches 392; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MTIDLQRSTQNLTHEEIFEAHEGGKLSISSTRPLRDMRDLSLAYTPGVAQVCEAIKEDPE 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MTIDLQRSTQNLTHEEIFEAHEGGKLSISSTRPLRDMRDLSLAYTPGVAQVCEAIKEDPE 60 Qy 61 VARTHTGIGNTVAVISDGTAVLGLGDIGPQASLPVMEGKAQLFSSFAGLKAIPIVLDVHD 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 VARTHTGIGNTVAVISDGTAVLGLGDIGPQASLPVMEGKAQLFSSFAGLKAIPIVLDVHD 120 Qy 121 VDALVETIAAIA PSFGAINLEDISAPRCFEVERRLIERLDIPVMHDDQHGTAVVILAALR 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 VDALVETIAAIA PSFGAINLEDISAPRCFEVERRLIERLDIPVMHDDQHGTAVVILAALR 180 Qy 181 NSLKLLDRKIEDLKIVISGAGAAGVAAVDMLTNAGATDIVVLDSRGIIHDSREDLSPVKA 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 NSLKLLDRKIEDLKIVISGAGAAGVAAVDMLTNAGATDIVVLDSRGIIHDSREDLSPVKA 240 Qy 241 ALAEKTNPRGISGGINEAFTGADLFIGVSGGNIGEDALKLMAPQPILFTLANPTPEIDPE 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 ALAEKTNPRGISGGINEAFTGADLFIGVSGGNIGEDALKLMAPQPILFTLANPTPEIDPE 300 Qy 301 LSQKYGAIVATGRSDLPNQINNVLAFPGIFAGALAAKAKKITPEMKLAAAEAIA DIAAED 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 LSQKYGAIVATGRSDLPNQINNVLAFPGIFAGALAAKAKKITPEMKLAAAEAIA DIAAED 360 Qy 361 LEVGRIVPTALNPRVAPAVKAAVQAVAEAQNA 392 |||||||||||||||||||||||||||||||| Db 361 LEVGRIVPTALNPRVAPAVKAAVQAVAEAQNA 392
Read full office action

Prosecution Timeline

Dec 26, 2024
Application Filed
Jan 31, 2026
Non-Final Rejection — §102 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12595472
MANNANASE VARIANTS
2y 5m to grant Granted Apr 07, 2026
Patent 12590301
METHODS FOR SAFE AND EFFECTIVE THROMBOLYSIS USING SEQUENTIAL ADMINISTRATION OF TISSUE PLASMINOGEN ACTIVATOR AND MUTANT PRO-UROKINASE
2y 5m to grant Granted Mar 31, 2026
Patent 12570964
Bacterium And Obtaining Method And Application Thereof
2y 5m to grant Granted Mar 10, 2026
Patent 12559734
Reverse Transcriptase Mutants with Increased Activity and Thermostability
2y 5m to grant Granted Feb 24, 2026
Patent 12540160
METHODS FOR THE PURIFICATION OF REFOLDED FC-PEPTIDE FUSION PROTEIN
2y 5m to grant Granted Feb 03, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

AI Strategy Recommendation

Get an AI-powered prosecution strategy using examiner precedents, rejection analysis, and claim mapping.
Powered by AI — typically takes 5-10 seconds

Prosecution Projections

1-2
Expected OA Rounds
74%
Grant Probability
88%
With Interview (+14.0%)
3y 0m
Median Time to Grant
Low
PTA Risk
Based on 924 resolved cases by this examiner. Grant probability derived from career allow rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month