Notice of Pre-AIA or AIA Status
The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA .
Status of Claims
Claims 22-39 are pending and examined.
Claim Objections
Claim 24 is objected to for failing to define the abbreviation “CAPS”.
Appropriate action is advised.
Claim Rejections - 35 USC § 112
The following is a quotation of 35 U.S.C. 112(b):
(b) CONCLUSION.—The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the inventor or a joint inventor regards as the invention.
The following is a quotation of 35 U.S.C. 112 (pre-AIA ), second paragraph:
The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the applicant regards as his invention.
Claims 22-39 are rejected under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter which the inventor or a joint inventor (or for applications subject to pre-AIA 35 U.S.C. 112, the applicant), regards as the invention.
Claim 1 recites the limitation one or more prolamin box binding factor (“WPBF”) gene(s) selected from the A genome.
The metes and bounds of the claim are indefinite because it is not clear if there are more than one WPBF genes in the A genome, B genome or D genomes, or if the claim intends to encompass a mutation to the WPBF gene in the A genome, the WPBF gene in the B genome and/or the WPBF gene in the D genome.
Claim 24 appears to contain trademark/trade name(s), for example, “Axoim SNP array” and “iSelect Array”, etc. Where a trademark or trade name is used in a claim as a limitation to identify or describe a particular material or product, the claim does not comply with the requirements of 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph. See Ex parte Simpson, 218 USPQ 1020 (Bd. App. 1982).
The claim scope is uncertain since the trademark or trade name cannot be used properly to identify any particular material or product. A trademark or trade name is used to identify a source of goods, and not the goods themselves.
Thus, a trademark or trade name does not identify or describe the goods associated with the trademark or trade name. In the present case, the trademark/trade name is used to identify/describe products for detecting mutations and, accordingly, the identification/description is indefinite.
Claim 25 recites the limitation “chromosomal allele”: there is insufficient antecedent basis for this claim limitation as the claim from which claim 25 depends is not drawn to a chromosomal allele.
Claim 26 recites the limitation “the” WPBF-A gene: there is insufficient antecedent basis for this claim limitation as the claim from which claim 26 depends is not drawn to a WPBF-A gene.
Claims 27-35 present the same issue and are therefore rejected for the same reason as provided for claim 26.
Claims 36-39 are rejected for depending upon a rejected base claim and for failing to remedy the issues of indefiniteness.
The following is a quotation of the first paragraph of 35 U.S.C. 112(a):
(a) IN GENERAL.—The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor or joint inventor of carrying out the invention.
The following is a quotation of the first paragraph of pre-AIA 35 U.S.C. 112:
The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor of carrying out his invention.
Claim 39 is rejected under 35 U.S.C. 112(a) or 35 U.S.C. 112 (pre-AIA ), first paragraph, as failing to comply with the written description requirement. The claim(s) contains subject matter which was not described in the specification in such a way as to reasonably convey to one skilled in the relevant art that the inventor or a joint inventor, or for applications subject to pre-AIA 35 U.S.C. 112, the inventor(s), at the time the application was filed, had possession of the claimed invention.
Claim 39 is drawn to a food product made from wheat flour from wheat grain comprising one or more non-transgenic mutations in a WPBF protein comprising an amino acid sequence having at least 95% sequence identity to SEQ ID NO: 3, 6 or 9.
However, the claim does not require the food product comprise the mutations of the wheat grain and would therefore be indistinguishable from other available food products having increased lysine content.
For example, Hussain et al disclose wheat flour and a food product therefrom with increased lysing content (2004, Food and Nutrition Bulletin, 25(2)114-122; see Abstract; see also p. 116, col. 1; see p. 120, col. 2, last ¶).
Applicant should note that the written description requirement serves to warn an innocent purchaser of the infringement of a patent, and conversely requires the patentee to distinguish the invention in the disclosure, and thus prevents the inventor from practicing upon the credulity or fears of other persons or from pretending that the invention is more than what it is. see Vas-Cath Inc. v. Mahurkar 1991 (CA FC) 19 USPQ2d 1111, 1115.
Here, the instant specification has failed to distinguish between the products as encompassed by claim 39 from other products that are found in the art so that the innocent purchaser would not know whether the instant claims are infringed.
As such, these claims are “reach through” claims in which Applicant has only described a starting material, but has not described the resulting product such that the genus of products that can be produced is so large that one of skill in the art would not readily envision the members of the claimed genus. (See Univ. of Rochester v. G.D. Searle & Co., 358 F.3d 916, 920-23, 69 USPQ2d 1886, 1890-93 (Fed. Cir. 2004)).
Claim Rejections - 35 USC § 102
In the event the determination of the status of the application as subject to AIA 35 U.S.C. 102 and 103 (or as subject to pre-AIA 35 U.S.C. 102 and 103) is incorrect, any correction of the statutory basis (i.e., changing from AIA to pre-AIA ) for the rejection will not be considered a new ground of rejection if the prior art relied upon, and the rationale supporting the rejection, would be the same under either status.
The following is a quotation of the appropriate paragraphs of 35 U.S.C. 102 that form the basis for the rejections under this section made in this Office action:
A person shall be entitled to a patent unless –
(a)(1) the claimed invention was patented, described in a printed publication, or in public use, on sale, or otherwise available to the public before the effective filing date of the claimed invention.
Claim 39 is rejected under 35 U.S.C. 103 as being unpatentable over Hussain et al (2004, Food and Nutrition Bulletin, 25(2)114-122).
Claim 39 is drawn to a food product made from wheat flour from wheat grain comprising one or more non-transgenic mutations in a WPBF protein comprising an amino acid sequence having at least 95% sequence identity to SEQ ID NO: 3, 6 or 9.
Here, the claim does not require the food product comprise the mutations of the wheat grain. Therefore, any prior art food product made from flour with increased lysine is indistinguishable from the food product as claimed.
Hussain et al disclose wheat flour and a food product therefrom with increased lysing content (see Abstract; see also p. 116, col. 1; see p. 120, col. 2, last ¶).
Therefore, a food product made from wheat flour from wheat grain comprising one or more non-transgenic mutations in a WPBF protein comprising an amino acid sequence having at least 95% sequence identity to SEQ ID NO: 3, 6 or 9 is anticipated by Hussain et al.
Double Patenting
The nonstatutory double patenting rejection is based on a judicially created doctrine grounded in public policy (a policy reflected in the statute) so as to prevent the unjustified or improper timewise extension of the “right to exclude” granted by a patent and to prevent possible harassment by multiple assignees.
A nonstatutory double patenting rejection is appropriate where the conflicting claims are not identical, but at least one examined application claim is not patentably distinct from the reference claim(s) because the examined application claim is either anticipated by, or would have been obvious over, the reference claim(s). See, e.g., In re Berg, 140 F.3d 1428, 46 USPQ2d 1226 (Fed. Cir. 1998); In re Goodman, 11 F.3d 1046, 29 USPQ2d 2010 (Fed. Cir. 1993); In re Longi, 759 F.2d 887, 225 USPQ 645 (Fed. Cir. 1985); In re Van Ornum, 686 F.2d 937, 214 USPQ 761 (CCPA 1982); In re Vogel, 422 F.2d 438, 164 USPQ 619 (CCPA 1970); In re Thorington, 418 F.2d 528, 163 USPQ 644 (CCPA 1969).
A timely filed terminal disclaimer in compliance with 37 CFR 1.321(c) or 1.321(d) may be used to overcome an actual or provisional rejection based on nonstatutory double patenting provided the reference application or patent either is shown to be commonly owned with the examined application, or claims an invention made as a result of activities undertaken within the scope of a joint research agreement. See MPEP § 717.02 for applications subject to examination under the first inventor to file provisions of the AIA as explained in MPEP § 2159. See MPEP §§ 706.02(l)(1) - 706.02(l)(3) for applications not subject to examination under the first inventor to file provisions of the AIA . A terminal disclaimer must be signed in compliance with 37 CFR 1.321(b).
The USPTO Internet website contains terminal disclaimer forms which may be used. Please visit www.uspto.gov/patent/patents-forms. The filing date of the application in which the form is filed determines what form (e.g., PTO/SB/25, PTO/SB/26, PTO/AIA /25, or PTO/AIA /26) should be used. A web-based eTerminal Disclaimer may be filled out completely online using web-screens. An eTerminal Disclaimer that meets all requirements is auto-processed and approved immediately upon submission. For more information about eTerminal Disclaimers, refer to www.uspto.gov/patents/process/file/efs/guidance/eTD-info-I.jsp.
Claims 22-39 are rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1-28 of Patent No. US 12,133,494 (referred to herein as ‘494). Although the claims at issue are not identical, they are not patentably distinct from each other because:
Instant claims 22-39 are drawn to a method of breeding a wheat variety comprising one or more non-transgenic mutations in a WPBF protein comprising an amino acid sequence having at least 95% sequence identity to SEQ ID NO: 3, 6 or 9 and where the grain from said plant comprises increased high molecular weight glutenin content or lysine content, wherein the method comprises detecting said mutations, progeny produced therefrom, grain produced from said progeny, flour made from said grain and food made from said flour.
‘494 claims wheat flour from wheat grain comprising: a wheat prolamin box binding factor (“WPBF”) gene with one or more non-transgenic human induced mutation(s) encoding a WPBF protein comprising one or more of the following: an amino acid sequence of the WPBF gene of an A genome having 95% or greater identity to SEQ ID NO:3, an amino acid sequence of the WPBF gene of a B genome having 95% or greater identity to SEQ ID NO:6, and an amino acid sequence of the WPBF gene of a D genome having 95% or greater identity to SEQ ID NO:9, wherein the flour comprises the one or more non-transgenic human induced WPBF mutation(s) of the wheat grain and an increase in high molecular weight glutenin content and an increase in lysine content as compared to flour from a wild type wheat plant and a method of producing said grain by growing and selecting a plant having said mutations (see claims 1 and 16)
Therefore, prior to the effective filing date of the instant invention it would have been prima facie obvious to one of ordinary skill in the art to arrive at the methods as claimed and with a reasonable expectation of success because ‘494 also claims methods for producing the grain wheat, grain and flour as claimed, and because breeding the claimed wheat variety as opposed to introducing mutations would lead to progeny plants with an increase in high molecular weight glutenin content and an increase in lysine content.
Claims 22-39 are rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1-18 of Patent No. US 11,553,659 (referred to herein as ‘659). Although the claims at issue are not identical, they are not patentably distinct from each other because:
Instant claims 22-39 are drawn to a method of breeding a wheat variety comprising one or more non-transgenic mutations in a WPBF protein comprising an amino acid sequence having at least 95% sequence identity to SEQ ID NO: 3, 6 or 9 and where the grain from said plant comprises increased high molecular weight glutenin content or lysine content, wherein the method comprises detecting said mutations, progeny produced therefrom, grain produced from said progeny, flour made from said grain and food made from said flour.
‘659 claims wheat grain comprising one or more non-transgenic mutations in a WPBF protein comprising an amino acid sequence having at least 95% sequence identity to SEQ ID NO: 3, 6 or 9 or wherein the gene comprises a nucleic acid sequence having at least 95% sequence identity to SEQ ID NO: 2, 5 or 8, and a method of altering glutenin content in a wheat plant comprising introducing said mutations.
Therefore, prior to the effective filing date of the instant invention it would have been prima facie obvious to one of ordinary skill in the art to arrive at the methods as claimed and with a reasonable expectation of success because ‘659 also claims methods for producing the grain wheat, grain and flour as claimed, and because breeding the claimed wheat variety as opposed to introducing mutations would lead to progeny plants with an increase in high molecular weight glutenin content and an increase in lysine content.
Claims 22-39 are rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1-15 of Patent No. US 10,827,703 (referred to herein as ‘703). Although the claims at issue are not identical, they are not patentably distinct from each other because:
Instant claims 22-39 are drawn to a method of breeding a wheat variety comprising one or more non-transgenic mutations in a WPBF protein comprising an amino acid sequence having at least 95% sequence identity to SEQ ID NO: 3, 6 or 9 and where the grain from said plant comprises increased high molecular weight glutenin content or lysine content, wherein the method comprises detecting said mutations, progeny produced therefrom, grain produced from said progeny, flour made from said grain and food made from said flour.
‘703 claims wheat grain comprising one or more non-transgenic mutations in a WPBF protein comprising an amino acid sequence having at least 95% sequence identity to SEQ ID NO: 3, 6 or 9 and methods for altering glutenin content in a wheat flour comprising introducing said mutations into plant parts or materials and wherein lysine content is increased in addition to reduced gluten content and a reduction in gliadin content.
Therefore, prior to the effective filing date of the instant invention it would have been prima facie obvious to one of ordinary skill in the art to arrive at the methods as claimed and with a reasonable expectation of success because ‘703 also claims methods for producing the grain wheat, grain and flour as claimed, and because breeding the claimed wheat variety as opposed to introducing mutations would lead to progeny plants with an increase in high molecular weight glutenin content and an increase in lysine content.
Claims 22-28, 30 and 32-39 are rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1-8, 10 and 13 of Patent No. US 10,412,909 (referred to herein as ‘909). Although the claims at issue are not identical, they are not patentably distinct from each other because:
Instant claims 22-39 are drawn to a method of breeding a wheat variety comprising one or more non-transgenic mutations in a WPBF protein comprising an amino acid sequence having at least 95% sequence identity to SEQ ID NO: 3, 6 or 9 and where the grain from said plant comprises increased high molecular weight glutenin content or lysine content, wherein the method comprises detecting said mutations, progeny produced therefrom, grain produced from said progeny, flour made from said grain and food made from said flour.
‘909 claims a wheat plant comprising one or more non-transgenic mutations in a WPBF gene of the A genome and comprises specific mutations in SEQ ID NO: 3, wherein the grain further comprises one or more mutations in the B or B and D genomes, wherein the grain has reduced gliadin content, a food product comprising said plant and progeny of said plant.
Therefore, prior to the effective filing date of the instant invention it would have been prima facie obvious to one of ordinary skill in the art to arrive at the methods as claimed and with a reasonable expectation of success because ‘909 also claims wheat plants, grain and flour as claimed, and because one would readily appreciated that the plant of ‘909 could be used in method of breeding in order to produce additional plants with an increase in high molecular weight glutenin content or lysine content.
Claims 22-29 and 32-39 are provisionally rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1-12 of Patent No. US 10,750,690 (referred to herein as ‘690). Although the claims at issue are not identical, they are not patentably distinct from each other because:
Instant claims 22-39 are drawn to a method of breeding a wheat variety comprising one or more non-transgenic mutations in a WPBF protein comprising an amino acid sequence having at least 95% sequence identity to SEQ ID NO: 3, 6 or 9 and where the grain from said plant comprises increased high molecular weight glutenin content or lysine content, wherein the method comprises detecting said mutations, progeny produced therefrom, grain produced from said progeny, flour made from said grain and food made from said flour.
‘690 claims a wheat plant comprising one or more mutations in a wheat prolamin box binding factor (WPBF) gene in at least the B genome, wherein the WPBF gene of the B genome codes for a WPBF protein having a tryptophan to a stop codon substitution at position 70 of SEQ ID NO. 6, wherein the one or more mutations contributes to grain from said wheat plant having reduced gluten as compared to grain from a wild type plant, wherein the one or more mutations in the WPBF gene is in the A and B genomes, wherein the one or more mutations in the WPBF gene is in the A and D genomes, wherein the one or more mutations in the WPBF gene is in the A, B, and D genomes, wherein the one or more mutations results in reduced low molecular weight glutenins in grain from said wheat plant relative to grain from a wild-type wheat plant (see claims 1-5).
Therefore, prior to the effective filing date of the instant invention it would have been prima facie obvious to one of ordinary skill in the art to arrive at the methods as claimed and with a reasonable expectation of success because ‘690 also claims wheat plants, grain and flour as claimed, and because one would readily appreciated that the plant of ‘690 could be used in method of breeding in order to produce additional plants with an increase in high molecular weight glutenin content or lysine content.
Conclusion
No claim is allowed.
The closest prior art is Gil-Humanes et al (2008, Journal of Cereal Science, 48:565-568), which teaches methods for reducing total gliadin content in the seeds of hexaploid wheat using RNAi, while Dong et al teach that WPBF trans-activates native alpha gliadin promoter transcription through binding to the PB, and that when WBPF and TaQM are co-transfected the transcription activity of the alpha gliadin promoter shows a six-fold increase (2006, Plant Mol Biol, 63:73-84; e.g. see Abstract; see also p. 74, col. 1, last par. bridging col. 2).
Thus, while there was a tentative nexus between WPBF function and gliadin content, and while the amino acid sequence of SEQ ID NO: 9 was known in the art (e.g., see Attachment A), Dong et al does not provide a reasonable teaching, suggestion or motivation to mutate the specific amino acids sequences as claimed, especially light of the fact that the function of the gene was unknown (e.g., see Dong et al, p. 82, col. 2, last ¶).
Moreover, there would be no reasonable expectation of success in obtaining the phenotypes as claimed based on the state of the art.
Any inquiry concerning this communication or earlier communications from the examiner should be directed to JASON DEVEAU-ROSEN whose telephone number is (571)272-2828. The examiner can normally be reached 7:30am - 4pm.
Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice.
If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Bratislav Stankovic can be reached at (571)270-0305. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300.
Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000.
/JASON DEVEAU ROSEN/Primary Examiner, Art Unit 1662
ATTACHMENT A
Alignment of GenBank Accession No. AY496057 from Dong et al with SEQ ID NO: 3 of the instant invention
RL Submitted (DEC-2005) to the EMBL/GenBank/DDBJ databases.
RN [2] {ECO:0000313|EMBL:AAS19857.1}
RP NUCLEOTIDE SEQUENCE.
RX PubMed=17021941; DOI=10.1007/s11103-006-9073-3;
RA Dong G., Ni Z., Yao Y., Nie X., Sun Q.;
RT "Wheat Dof transcription factor WPBF interacts with TaQM and activates
RT transcription of an alpha-gliadin gene during wheat seed development.";
RL Plant Mol. Biol. 63:73-84(2007).
CC -!- FUNCTION: Transcription factor that binds specifically to a 5'-AA[AG]G-
CC 3' consensus core sequence. {ECO:0000256|RuleBase:RU369094}.
CC -!- SUBCELLULAR LOCATION: Nucleus {ECO:0000256|PROSITE-ProRule:PRU00071,
CC ECO:0000256|RuleBase:RU369094}.
CC ---------------------------------------------------------------------------
CC Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
CC Distributed under the Creative Commons Attribution (CC BY 4.0) License
CC ---------------------------------------------------------------------------
DR EMBL; AY496057; AAS19857.1; -; mRNA.
Query Match 93.1%; Score 1666; Length 330;
Best Local Similarity 93.0%;
Matches 307; Conservative 5; Mismatches 18; Indels 0; Gaps 0;
Qy 1 MEEVFPSNSKSKAGQMAGEATAAAEKKPRPKPEQKVECPRCKSGNTKFCYYNNYSMSQPR 60
|||||||||||||||||||| | |||||||||||||||||||||||||||||||||||||
Db 1 MEEVFPSNSKSKAGQMAGEAIA GAEKKPRPKPEQKVECPRCKSGNTKFCYYNNYSMSQPR 60
Qy 61 YFCKACRRYWTHGGSLRNVPIGGGCRKPKRPGTSDAHKLGVASSSEPTVVMPPSTCTGMN 120
|||||||||||||||||||||||||||||| ||||||||||||| ||| |:|||||||||
Db 61 YFCKACRRYWTHGGSLRNVPIGGGCRKPKRSGTSDAHKLGVASSPEPTTVVPPSTCTGMN 120
Qy 121 FANVLPTFMSAGFEIPSSLSLTAFGSSSSSNTAAVMSPGGTTSFLDVLRGGAGGLLDGSL 180
|||||||||| |||||||||||||||||||||||:||||||||||||||||| |||||||
Db 121 FANVLPTFMSVGFEIPSSLSLTAFGSSSSSNTAAMMSPGGTTSFLDVLRGGARGLLDGSL 180
Qy 181 SQNNGYYYGGPATGSGIGMLMTPPVASFGIPGPMQQHGDLVVGGNGIGAATASIFQGGTG 240
|||||||||||| ||| ||||||| ||||| ||||||||||||||||||||||||| |
Db 181 SQNNGYYYGGPAIGSGNGMLMTPPAVSFGIPVPMQQHGDLVVGGNGIGAATASIFQGATS 240
Qy 241 EEGDDGTGGVMGLQWQPQVGNGGGAGVVSGGVHHLGTGNNVTMGNNNIHNNNNNNSGGDD 300
|||||| ||||||||||||||||| | ||||||||||||||||||:||||||||:|||||
Db 241 EEGDDGMGGVMGLQWQPQVGNGGGGGGVSGGVHHLGTGNNVTMGNSNIHNNNNNDSGGDD 300
Qy 301 NNGASSRDCYWINNGGSNPWQSLLNNSSLM 330
||| |||||||||||||||||||||:||||
Db 301 NNGGSSRDCYWINNGGSNPWQSLLNSSSLM 330
Alignment of GenBank Accession No. AY496057 from Dong et al with SEQ ID NO: 6 of the instant invention
RN [2] {ECO:0000313|EMBL:AAS19857.1}
RP NUCLEOTIDE SEQUENCE.
RX PubMed=17021941; DOI=10.1007/s11103-006-9073-3;
RA Dong G., Ni Z., Yao Y., Nie X., Sun Q.;
RT "Wheat Dof transcription factor WPBF interacts with TaQM and activates
RT transcription of an alpha-gliadin gene during wheat seed development.";
RL Plant Mol. Biol. 63:73-84(2007).
CC -!- FUNCTION: Transcription factor that binds specifically to a 5'-AA[AG]G-
CC 3' consensus core sequence. {ECO:0000256|RuleBase:RU369094}.
CC -!- SUBCELLULAR LOCATION: Nucleus {ECO:0000256|PROSITE-ProRule:PRU00071,
CC ECO:0000256|RuleBase:RU369094}.
CC ---------------------------------------------------------------------------
CC Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
CC Distributed under the Creative Commons Attribution (CC BY 4.0) License
CC ---------------------------------------------------------------------------
DR EMBL; AY496057; AAS19857.1; -; mRNA.
Query Match 88.5%; Score 1578; Length 330;
Best Local Similarity 88.8%;
Matches 293; Conservative 8; Mismatches 27; Indels 2; Gaps 1;
Qy 1 MEEVFPSNSKSKAGQMAGEATAAAEKKPRPKPEQKVECPRCKSGNTKFCYYNNYSMSQPR 60
|||||||||||||||||||| | |||||||||||||||||||||||||||||||||||||
Db 1 MEEVFPSNSKSKAGQMAGEAIA GAEKKPRPKPEQKVECPRCKSGNTKFCYYNNYSMSQPR 60
Qy 61 YFCKACRRYWTHGGSLRNVPIGGGCRKPKRSGTSDAHKLGVASSSEHTAVMPPSTCTGIN 120
|||||||||||||||||||||||||||||||||||||||||||| | | |:|||||||:|
Db 61 YFCKACRRYWTHGGSLRNVPIGGGCRKPKRSGTSDAHKLGVASSPEPTTVVPPSTCTGMN 120
Qy 121 FANVLPTFMSAGFEIPRSLSLTTFGSSSSSNTTAVMSPGGTTSFLDVLRGGTGGLLDGNL 180
|||||||||| ||||| ||||| ||||||||| |:|||||||||||||||| |||||:|
Db 121 FANVLPTFMSVGFEIPSSLSLTAFGSSSSSNTAAMMSPGGTTSFLDVLRGGARGLLDGSL 180
Qy 181 GQNNGYYYGGSR--SGIGMLMTPPAASFGIPGPMQQHGDLMVGGNGIGAATASIFQGGTG 238
||||||||| || |||||||| ||||| ||||||||:|||||||||||||||| |
Db 181 SQNNGYYYGGPAIGSGNGMLMTPPAVSFGIPVPMQQHGDLVVGGNGIGAATASIFQGATS 240
Qy 239 EEGDDGKGAMMGLQWQPHVGNGGGGGVVSGGVHHLGTGNNVTMGNNNINNNNNNGSHSDD 298
|||||| | :||||||| |||||||| ||||||||||||||||||:||:||||| | ||
Db 241 EEGDDGMGGVMGLQWQPQVGNGGGGGGVSGGVHHLGTGNNVTMGNSNIHNNNNNDSGGDD 300
Qy 299 NTGGSSRDCYWINNGGSNPWQSLLNSSSLM 328
| ||||||||||||||||||||||||||||
Db 301 NNGGSSRDCYWINNGGSNPWQSLLNSSSLM 330
Alignment of GenBank Accession No. AY496057 from Dong et al with SEQ ID NO: 9 of the instant invention
RN [2] {ECO:0000313|EMBL:AAS19857.1}
RP NUCLEOTIDE SEQUENCE.
RX PubMed=17021941; DOI=10.1007/s11103-006-9073-3;
RA Dong G., Ni Z., Yao Y., Nie X., Sun Q.;
RT "Wheat Dof transcription factor WPBF interacts with TaQM and activates
RT transcription of an alpha-gliadin gene during wheat seed development.";
RL Plant Mol. Biol. 63:73-84(2007).
CC -!- FUNCTION: Transcription factor that binds specifically to a 5'-AA[AG]G-
CC 3' consensus core sequence. {ECO:0000256|RuleBase:RU369094}.
CC -!- SUBCELLULAR LOCATION: Nucleus {ECO:0000256|PROSITE-ProRule:PRU00071,
CC ECO:0000256|RuleBase:RU369094}.
CC ---------------------------------------------------------------------------
CC Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
CC Distributed under the Creative Commons Attribution (CC BY 4.0) License
CC ---------------------------------------------------------------------------
DR EMBL; AY496057; AAS19857.1; -; mRNA.
Query Match 99.6%; Score 1781; Length 330;
Best Local Similarity 99.7%;
Matches 329; Conservative 0; Mismatches 1; Indels 0; Gaps 0;
Qy 1 MEEVFPSNSKSKAGQMAGEAIA GAEKKPRPKPEQKVECPRCKSGNTKFCYYNNYSMSQPR 60
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Db 1 MEEVFPSNSKSKAGQMAGEAIA GAEKKPRPKPEQKVECPRCKSGNTKFCYYNNYSMSQPR 60
Qy 61 YFCKACRRYWTHGGSLRNVPIGGGCRKPKRSGTSDAHKLGVASSPEPTTVVPPSTCTGMN 120
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Db 61 YFCKACRRYWTHGGSLRNVPIGGGCRKPKRSGTSDAHKLGVASSPEPTTVVPPSTCTGMN 120
Qy 121 FANVLPTFMSVGFEIPSSLSLTAFGSSSSSNTAAMMSPGGTTSFLDVLRGGAGGLLDGSL 180
|||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||
Db 121 FANVLPTFMSVGFEIPSSLSLTAFGSSSSSNTAAMMSPGGTTSFLDVLRGGARGLLDGSL 180
Qy 181 SQNNGYYYGGPAIGSGNGMLMTPPAVSFGIPVPMQQHGDLVVGGNGIGAATASIFQGATS 240
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Db 181 SQNNGYYYGGPAIGSGNGMLMTPPAVSFGIPVPMQQHGDLVVGGNGIGAATASIFQGATS 240
Qy 241 EEGDDGMGGVMGLQWQPQVGNGGGGGGVSGGVHHLGTGNNVTMGNSNIHNNNNNDSGGDD 300
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Db 241 EEGDDGMGGVMGLQWQPQVGNGGGGGGVSGGVHHLGTGNNVTMGNSNIHNNNNNDSGGDD 300
Qy 301 NNGGSSRDCYWINNGGSNPWQSLLNSSSLM 330
||||||||||||||||||||||||||||||
Db 301 NNGGSSRDCYWINNGGSNPWQSLLNSSSLM 330