Prosecution Insights
Last updated: October 02, 2026
Application No. 18/953,224

EDITED NAC GENES IN PLANTS

Non-Final OA §103§112
Filed
Nov 20, 2024
Priority
Jun 29, 2018 — provisional 62/692,182 +3 more
Examiner
KEOGH, MATTHEW R
Art Unit
1663
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Pioneer Hi-bred International Inc.
OA Round
1 (Non-Final)
78%
Grant Probability
Favorable
1-2
OA Rounds
9m
Est. Remaining
93%
With Interview

Examiner Intelligence

Grants 78% — above average
78%
Career Allowance Rate
557 granted / 711 resolved
+18.3% vs TC avg
Moderate +14% lift
Without
With
+14.5%
Interview Lift
resolved cases with interview
Typical timeline
2y 7m
Avg Prosecution
34 currently pending
Career history
743
Total Applications
across all art units

Statute-Specific Performance

§101
6.4%
-33.6% vs TC avg
§103
25.7%
-14.3% vs TC avg
§102
15.3%
-24.7% vs TC avg
§112
42.2%
+2.2% vs TC avg
Black line = Tech Center average estimate • Based on career data from 711 resolved cases

Office Action

§103 §112
DETAILED ACTION Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Election/Restrictions Applicant’s election without traverse of Group I in the reply filed on 27 May 2026 is acknowledged. Claims 32-40 are withdrawn from further consideration pursuant to 37 CFR 1.142(b) as being drawn to a nonelected invention, there being no allowable generic or linking claim. Election was made without traverse in the reply filed on 27 May 2026. Claim Status Claims 21-40 are pending and newly presented. Claims 32-40 are withdrawn from consideration. Claims 21-31 are examined on the merits. Claim Rejections - 35 USC § 112 Indefiniteness The following is a quotation of 35 U.S.C. 112(b): (b) CONCLUSION.—The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the inventor or a joint inventor regards as the invention. Claims 22, 28, and 31 are rejected under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter which the inventor or a joint inventor, or for pre-AIA the applicant regards as the invention. Claim 22 recites, “wherein the one or more genetic modifications is an insertion or deletion of at least one nucleotide in or near the NAC7 coding region and wherein the insertion or deletion effects a frameshift in the endogenous NAC7 gene.” It is unclear how a mutation near but not in the coding region of the NAC7 gene can cause a frameshift mutation. It is unclear what structure such a mutant allele would have. As such, the metes and bounds of the claim cannot be determined. Claim 28 recites the limitation "wherein the one or more genetic modifications in at least one allele of the NAC7 genomic locus" in 21. Claim 21 fails to recite anything regarding alleles. There is insufficient antecedent basis for this limitation in the claim. While claim 21 does recite, “one or more genetic modifications” the lack of connection to the phrase, “at least one allele” renders claim 28 unclear. It is as if this recitation in claim 28 seems to indicate that claim 21 does not require that that “at least one allele” comprises “one or more genetic modifications,” but this is not possible given the plain language of claim 21. As such, the metes and bounds of the claim cannot be determined. Claim 31 is drawn to methods of modifying the NAC7 motif in maize (requiring the use of CRISPR/Cas to modify a motif set for in N1-N9 wherein N1=F,R,T,V, or Y; N2=W; N3=H,K,R,N, or S; N4=S,P,T,I,A, or K; N5=T,S,A,V, or E; N6= G,A, or C; N7=R,K,A,S,T,P, or N; N8= D,S,T,E, or P; or N9=K,E,C,G,T, or R. NAC7 in maize appears to only comprise a single embodiment of this large genus of motifs in residues 96-104 SEQ ID NO:3 comprises YWKATGKDR. It is unclear how the maize gene could comprise any more of these motifs such that they could be targeted in the method. This issue is worsened by the fact that the conjunction “or” is used between the listing of N8 and N9. As such, the metes and bounds of the claims cannot be determined. Improper Claim Dependency The following is a quotation of 35 U.S.C. 112(d): (d) REFERENCE IN DEPENDENT FORMS.—Subject to subsection (e), a claim in dependent form shall contain a reference to a claim previously set forth and then specify a further limitation of the subject matter claimed. A claim in dependent form shall be construed to incorporate by reference all the limitations of the claim to which it refers. . Claim 27 is rejected under 35 U.S.C. 112(d) or pre-AIA 35 U.S.C. 112, 4th paragraph, as being of improper dependent form for failing to further limit the subject matter of the claim upon which it depends, or for failing to include all the limitations of the claim upon which it depends. Claim 27 is drawn to the method of claim 25, wherein the functional motif is edited or replaced. Claim 25 already requires that there are one or more modifications in the functional motif. It is unclear how the “one or more modifications in the functional motif” are considered anything more than edits given that the modifications are required to be introduced via a Cas endonuclease as claims 25 depends upon claim 21. As such, claim 27 fails to further limit claim 25. Applicant may cancel the claim(s), amend the claim(s) to place the claim(s) in proper dependent form, rewrite the claim(s) in independent form, or present a sufficient showing that the dependent claim(s) complies with the statutory requirements. Claim Rejections - 35 USC § 103 The following is a quotation of 35 U.S.C. 103 which forms the basis for all obviousness rejections set forth in this Office action: A patent for a claimed invention may not be obtained, notwithstanding that the claimed invention is not identically disclosed as set forth in section 102, if the differences between the claimed invention and the prior art are such that the claimed invention as a whole would have been obvious before the effective filing date of the claimed invention to a person having ordinary skill in the art to which the claimed invention pertains. Patentability shall not be negated by the manner in which the invention was made. The factual inquiries for establishing a background for determining obviousness under 35 U.S.C. 103 are summarized as follows: 1. Determining the scope and contents of the prior art. 2. Ascertaining the differences between the prior art and the claims at issue. 3. Resolving the level of ordinary skill in the pertinent art. 4. Considering objective evidence present in the application indicating obviousness or nonobviousness. Claims 21-31 is/are rejected under 35 U.S.C. 103 as being unpatentable over Fengler et al 2016 (WO 2016/099918 A1) and further in view of Zhu et al (US 2016/0264982 A1). Fengler et al disclose reduced activity of YEP6 gene (same as instant NAC7, see alignment below) results in favorable phenotypes including increase staygreen and drought tolerance (see entire document). They teach that there are several ways to reduce YEP6 activity including inducing mutations and detection of such mutations using TILLING and that the effected plant is maize (p. 3-6, 24, 32-33, 37, 59-60, 93-97). Note that TILLING is used to detect substitution mutations; therefore, such mutations are contemplated. The additional claimed features regarding kernel phenotype and moisture naturally flow from the reduction in YEP6 activity and thus those limitations are also met. Further note that Example 3 in the instant specification indicates that reduction in activity in maize NAC7 via either promoter mutation or coding sequence mutation leads to a dominant phenotype (paragraph 0561). Fengler et al do not teach to make the claimed modifications or to use CRISPR to modify a NAC7 gene. Zhu et al teach methods of modifying plant genomes using the CRISPR system which uses a Cas endonuclease and a guide RNA (see entire document). They further teach that donor template can be used to make multiple mutations via insertion, deletion, and/or replacement and contemplate that this method can be used to modify expression regulatory elements, including promoters (paragraphs 37-38, 171, claim 5). At the time of filing, it would have been obvious for a person of ordinary skill in the art to make reduced function NAC7 alleles in plants to the end of achieving the improved phenotype taught by Fengler et al which would be dominant mutation based on the findings of the instant specification. A person of ordinary skill in the art would have recognized that the method of Zhu et al would have been useful in creating such mutant alleles, including mutations in the promoters to reduce expression as Zhu et al suggest their method is useful in altering expression regulatory elements. Moreover, a person skilled in the art would have recognized that targeting any region conserved among NAC proteins would likely lead to a loss of function. It is particularly well-understood in the art that substitution of prolines tend to interfere with function as substitution to any other amino acid residue will dramatically change the geometry of the peptide backbone at that site. Additionally, it is widely known that indel mutations that are not of base 3 in number generally lead to introduction of a premature stop codon and often loss of function. Accordingly, claims 21-31 are rejected under 35 U.S.C. 103 as being unpatentable over Fengler et al and further in view of Zhu et al. BDB53953 ID BDB53953 standard; protein; 338 AA. XX AC BDB53953; XX DT 11-AUG-2016 (first entry) XX DE Zea mays NAC-domain containing protein (YEP6) sequence, SEQ ID 2. XX KW NAC-domain containing protein; YEP6 protein; abiotic stress tolerance; KW biomass; crop improvement; dna polymorphism; gene silencing; KW genetic marker; plant; rna interference; screening; seed; KW transgenic plant. XX OS Zea mays. XX CC PN WO2016099918-A1. XX CC PD 23-JUN-2016. XX CC PF 03-DEC-2015; 2015WO-US063639. XX PR 17-DEC-2014; 2014US-0092933P. XX CC PA (DUPO ) PIONEER HI-BRED INT INC. CC PA (DUPO ) DU PONT DE NEMOURS & CO E I. CC PA (UYIL-) UNIV ILLINOIS URBANA-CHAMPAIGN. XX CC PI Fengler K, Gupta R, Li B, Moose SP, Weers B, Fengler W; XX DR WPI; 2016-38266T/46. DR N-PSDB; BDB53952. XX CC PT Plant has reduced endogenous YEP6 gene expression, where YEP6 gene CC PT encodes YEP6 polypeptide, and plant exhibits phenotype i.e. increased CC PT yield, abiotic stress tolerance, staygreen or biomass as compared to CC PT control plant. XX CC PS Claim 4; SEQ ID NO 2; 132pp; English. XX CC The present invention relates to a transgenic plant having reduced CC endogenous NAC-domain containing protein (YEP6) gene expression. The CC transgenic plant exhibits at least one phenotype selected from increased CC yield, abiotic stress tolerance, staygreen or biomass as compared to a CC control plant. The invention further relates to: (1) a suppression DNA CC construct for reducing the expression of endogenous YEP6 gene in a plant, CC which comprises a polynucleotide that is operably linked in sense or CC antisense orientation to a heterologous promoter; (2) a method for CC producing a transgenic plant having reduced endogenous YEP6 gene CC expression, which involves introducing the suppression DNA construct into CC the plant; (3) a method for enhancing seed yield in a plant; (4) a method CC for identifying one or more alleles associated with increased yield in a CC population of maize plants, which involves detecting polymorphisms in a CC genomic region encoding a polypeptide or a regulatory region controlling CC expression of a polypeptide in a population of maize plants and CC identifying alleles at polymorphisms that are associated with increased CC yield; and (5) a method for identifying trait loci or gene controlling CC trait loci, which involves developing breeding population of maize CC plants, where the breeding population is generated by crossing first CC maize inbred line characterized as high protein line with second maize CC inbred line characterized as low protein line, selecting progeny maize CC plants based on phenotype of interest, performing marker analysis for CC phenotypes identified in progeny of plants, and identifying trait loci or CC gene controlling trait loci. The suppression DNA construct is sense CC suppression construct, antisense suppression construct, ribozyme CC construct, RNA interference construct or miRNA construct, preferably RNA CC interference construct. The methods of the invention can be used for CC producing a transgenic plant exhibiting increased yield, abiotic stress CC tolerance, staygreen or biomass. The present sequence is a Zea mays NAC- CC domain containing protein sequence, whose encoding gene is used in the CC invention as a target for producing a transgenic plant exhibiting CC increased yield, abiotic stress tolerance, staygreen or biomass. XX SQ Sequence 338 AA; Query Match 100.0%; Score 1803; DB 23; Length 338; Best Local Similarity 100.0%; Matches 338; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MSMSFLSMVEAELPPGFRFHPRDDELICDYLAPKLGAKPGFSGCRPPMVDVDLNKVEPWD 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MSMSFLSMVEAELPPGFRFHPRDDELICDYLAPKLGAKPGFSGCRPPMVDVDLNKVEPWD 60 Qy 61 LPVAASVGPREWYFFSLKDRKYATGQRTNRATVSGYWKATGKDRPVVAARRGALVGMRKT 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 LPVAASVGPREWYFFSLKDRKYATGQRTNRATVSGYWKATGKDRPVVAARRGALVGMRKT 120 Qy 121 LVFYQGRAPKGRKTEWVMHEYRMEPAAPLLDHQPSSSNSKDEDWVLCRVICKKKLAAGGR 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 LVFYQGRAPKGRKTEWVMHEYRMEPAAPLLDHQPSSSNSKDEDWVLCRVICKKKLAAGGR 180 Qy 181 AGGGSSRSLVASNGGRETAPATPPPPPLPPRMDTDATLAQLQAAMHATAGALEQVPCFSS 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 AGGGSSRSLVASNGGRETAPATPPPPPLPPRMDTDATLAQLQAAMHATAGALEQVPCFSS 240 Qy 241 FNNNTASSRAAAAAAAAQPCYLPSMATGGSHGTTSYYLDHAMLPPELGGCFDPLHGDKKL 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 FNNNTASSRAAAAAAAAQPCYLPSMATGGSHGTTSYYLDHAMLPPELGGCFDPLHGDKKL 300 Qy 301 LKAVLGQLGGDAVAPGLSLQHEMAAGAVVASSAWMNHF 338 |||||||||||||||||||||||||||||||||||||| Db 301 LKAVLGQLGGDAVAPGLSLQHEMAAGAVVASSAWMNHF 338 Conclusion No claims are allowed. Any inquiry concerning this communication or earlier communications from the examiner should be directed to MATTHEW R KEOGH whose telephone number is (571)272-2960. The examiner can normally be reached M-Th 7-4:30, half day on Fridays. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Amjad Abraham can be reached on 571-270-7058. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /MATTHEW R KEOGH/Primary Examiner, Art Unit 1663
Read full office action

Prosecution Timeline

Nov 20, 2024
Application Filed
Jun 10, 2026
Non-Final Rejection mailed — §103, §112 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12747445
METHODS AND COMPOSITIONS FOR INCREASING HARVESTABLE YIELD VIA EDITING GA20 OXIDASE GENES TO GENERATE SHORT STATURE PLANTS
6y 1m to grant Granted Sep 29, 2026
Patent 12740530
INBRED CORN LINE KL20746C1
2y 6m to grant Granted Sep 22, 2026
Patent 12733605
INBRED CORN LINE KL20745C1
2y 5m to grant Granted Sep 15, 2026
Patent 12735716
OPTIMAL MAIZE LOCI
2y 4m to grant Granted Sep 15, 2026
Patent 12729383
OPTIMAL SOYBEAN LOCI
2y 3m to grant Granted Sep 08, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

Strategy Recommendation AI-generated — please review before filing

Get a prosecution strategy drawn from examiner precedents, rejection analysis, and claim mapping.
Typically takes 5-10 seconds — AI-generated, attorney review required before filing

Prosecution Projections

1-2
Expected OA Rounds
78%
Grant Probability
93%
With Interview (+14.5%)
2y 7m (~9m remaining)
Median Time to Grant
Low
PTA Risk
Based on 711 resolved cases by this examiner. Grant probability derived from career allowance rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month