Prosecution Insights
Last updated: October 02, 2026
Application No. 19/016,469

NOVEL RNA-PROGRAMMABLE ENDONUCLEASE SYSTEMS AND USES THEREOF

Non-Final OA §102§103
Filed
Jan 10, 2025
Priority
Mar 19, 2018 — EU 18162681.3 +10 more
Examiner
RAMIREZ, DELIA M
Art Unit
1652
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Bayer HealthCare LLC
OA Round
1 (Non-Final)
65%
Grant Probability
Favorable
1-2
OA Rounds
1y 1m
Est. Remaining
99%
With Interview

Examiner Intelligence

Grants 65% — above average
65%
Career Allowance Rate
557 granted / 855 resolved
+5.1% vs TC avg
Strong +56% interview lift
Without
With
+56.3%
Interview Lift
resolved cases with interview
Typical timeline
2y 9m
Avg Prosecution
51 currently pending
Career history
902
Total Applications
across all art units

Statute-Specific Performance

§101
7.0%
-33.0% vs TC avg
§103
21.9%
-18.1% vs TC avg
§102
19.5%
-20.5% vs TC avg
§112
37.9%
-2.1% vs TC avg
Black line = Tech Center average estimate • Based on career data from 855 resolved cases

Office Action

§102 §103
DETAILED ACTION Status of the Application Claims 42-51 are pending. The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . A preliminary amendment cancelling claims 1-41 and adding claims 42-51 as submitted in a communication filed on 4/30/2025 is acknowledged. Specification The disclosure is objected to because it contains an embedded hyperlink and/or other form of browser-executable code. See page 42, paragraph [0145], two instances. Applicant is required to delete the embedded hyperlink and/or other form of browser-executable code. See MPEP § 608.01. Priority Acknowledgment is made of a claim for domestic priority under 35 U.S.C. 119(e) to provisional application No. 62/745,239 filed on 10/12/2018, 62/745,238 filed on 10/12/2018, 62/745,246 filed on 10/12/2018, and 62/745,240 filed on 10/12/2018. Acknowledgment is made of a claim for foreign priority under 35 U.S.C. 119(a)-(d) to EUROPEAN PATENT OFFICE (EPO) 18181680.2 filed on 07/04/2018, EUROPEAN PATENT OFFICE (EPO) 18174707.2 filed on 05/29/2018, EUROPEAN PATENT OFFICE (EPO) 18172625.8 filed on 05/16/2018, EUROPEAN PATENT OFFICE (EPO) 18162683.9 filed on 03/19/2018, and EUROPEAN PATENT OFFICE (EPO) 18162681.3 filed on 03/19/2018. Receipt is acknowledged of papers submitted under 35 U.S.C. 119(a)-(d), which papers have been placed of record in the file. Acknowledgment is made of a claim for domestic priority under 35 U.S.C. 120 or 121 to US application No. 16/982,433 filed on 09/18/2020, which is the US national application which entered the national stage from PCT/US2019/023044 filed on 5/19/2019. Upon performing a sequence search and a cursory review of the specification of the provisional applications to which the instant application claims priority, it has been found that SEQ ID NO: 3 and SEQ ID NO: 4 were first disclosed in PCT/US2019/023044 filed on 5/19/2019. Drawings The drawings submitted on 1/10/2025 have been reviewed and are accepted by the Examiner for examination purposes. Claim Rejections - 35 USC § 102 (AIA ) The following is a quotation of the appropriate paragraphs of 35 U.S.C. 102 that form the basis for the rejections under this section made in this Office action: A person shall be entitled to a patent unless – (a)(2) the claimed invention was described in a patent issued under section 151, or in an application for patent published or deemed published under section 122(b), in which the patent or application, as the case may be, names another inventor and was effectively filed before the effective filing date of the claimed invention. Claims 42-46, 48, 50 are rejected under 35 U.S.C. 102(a)(1) as being anticipated by Cheng et al. (WO 2020/112908 published 6/4/2020, claims priority to application No. 62/772,278, effective filing date 11/28/2018). Claims 42-46, 48, 50 are directed in part to (i) a synthetic RNA-guided nuclease (sRGN) that comprises an amino acid sequence at least 95% identical to SEQ ID NO: 3 or SEQ ID NO: 4, wherein said sRGN further comprises one or more nuclear localization signals, (ii) a composition comprising the sRGN of (i), and (iii) a composition that comprises the sRGN of (i) and a guide RNA capable of hybridizing to a target nucleic acid, wherein the sRGN of (i) and the guide RNA can form a complex. Cheng et al. teach a sRGN that comprises an amino acid sequence which is 97.35% identical to SEQ ID NO: 3 (SEQ ID NO: 1; page 3, paragraph [0011]) and a sRGN that comprises an amino acid sequence which is 100% identical to SEQ ID NO: 4 (SEQ ID NO: 39; page 19, paragraph [0067]; page 47, paragraph [0145]). See alignments below. The protein of SEQ ID NO: 39 has the SV40 nuclear localization signal PKKKRKV (page 74, sequence 39, amino acids 3-9, GST-v1). Cheng et al. teach that the sRGN can comprise nuclear localization signals (page 3, paragraph [0010]). Cheng et al. teach CRISPR/Cas system that comprise a guide RNA which has a spacer that hybridizes to a target nucleic acid of interest and forms a ribonucleoprotein complex with the sRGN (page 21, paragraphs [0073]-[0074]). Cheng et al. teach the delivery of lipid-based nanoparticles that comprise nucleic acids encoding the sRGN and a guide RNA to cells and the successful editing of a target gene (page 46, paragraph [0143]). Since the nucleic acids in the nanoparticles had to be expressed to observe the editing of the target gene, the cells of Cheng et al. after delivery of the nanoparticles comprise a composition comprising the sRGN complexed with the guide RNA. In the absence of the specific components of a pharmaceutical composition, the intracellular contents of the cell after delivery of the nanoparticles are deemed a pharmaceutical composition which comprises water (pharmaceutically acceptable carrier). Therefore, the teachings of Cheng et al. anticipate the instant claims as written/interpreted. SEQ ID NO: 3 BHV54910 ID BHV54910 standard; protein; 1057 AA. XX AC BHV54910; XX DT 23-JUL-2020 (first entry) XX DE Staphylococcus sp. Cas9 protein (Gib11SpaCas9-1), SEQ ID 1. XX KW Cas9 protein; cardiovascular disease; cardiovascular-gen.; drug delivery; KW factor viii deficiency; genetic-disease-gen.; nanotechnology; KW therapeutic. XX OS Staphylococcus lugdunensis. OS Staphylococcus pasteuri. OS Staphylococcus microti. OS Staphylococcus hyicus. XX CC PN WO2020112908-A2. XX CC PD 04-JUN-2020. XX CC PF 26-NOV-2019; 2019WO-US063456. XX PR 28-NOV-2018; 2018US-0772278P. XX CC PA (CASE-) CASEBIA THERAPEUTICS LLP. XX CC PI Cheng CJ, Scharenberg A, Wang K, Sane S; XX DR WPI; 2020-491643/051. DR N-PSDB; BHV54916, BHV54922. XX CC PT Lipid-based nanoparticle composition for delivering nucleic acid molecule CC PT into cell, and for editing genome of cell, comprisesnucleic acid molecule CC PT comprising nucleotide sequence encoding site-specific endonuclease, and CC PT lipid moieties. XX CC PS Claim 9; SEQ ID NO 1; 100pp; English. XX CC The present invention relates to a novel lipid-based nanoparticle (LNP) CC composition, useful for a delivering nucleic acid molecule into a cell. CC The LNP composition comprises a nucleic acid molecule containing a CC nucleotide sequence encoding a site-specific endonuclease of SEQ ID NO: 1 CC -6 (see BHV54910-BHV54915); and lipid moieties selected from amino CC lipids, ionizable lipids, neutral lipids, polyethylene glycol (PEG) CC lipids, helper lipids and cholesterol or cholesterol derivatives. The CC invention further claims: (1) a method for delivering a nucleic acid CC molecule into a cell; and (2) a method for editing a genome of the cell. CC The LNP composition is useful for: delivering a nucleic acid molecule CC into a target cell, which is useful for editing a genome of the cell; and CC treating disease such as hemophilia A (HemA) or cardiovascular disease. XX SQ Sequence 1057 AA; Query Match 97.7%; Score 5355; Length 1057; Best Local Similarity 97.4%; Matches 1029; Conservative 18; Mismatches 10; Indels 0; Gaps 0; Qy 1 MNQKFILGLDIGITSVGYGLIDYETKNIIDAGVRLFPEANVENNEGRRSKRGSRRLKRRR 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MNQKFILGLDIGITSVGYGLIDYETKNIIDAGVRLFPEANVENNEGRRSKRGSRRLKRRR 60 Qy 61 IHRLERVKLLLTEYDLINKEQIPTSNNPYQIRVKGLSEILSKDELAIA LLHLAKRRGIHN 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 IHRLERVKLLLTEYDLINKEQIPTSNNPYQIRVKGLSEILSKDELAIA LLHLAKRRGIHN 120 Qy 121 VDVAADKEETASDSLSTKDQINKNAKFLESRYVCELQKERLENEGHVRGVENRFLTKDIV 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 VDVAADKEETASDSLSTKDQINKNAKFLESRYVCELQKERLENEGHVRGVENRFLTKDIV 180 Qy 181 REAKKIIDTQMQYYPEIDETFKEKYISLVETRREYFEGPGQGSPFGWNGDLKKWYEMLMG 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 REAKKIIDTQMQYYPEIDETFKEKYISLVETRREYFEGPGQGSPFGWNGDLKKWYEMLMG 240 Qy 241 HCTYFPQELRSVKYAYSADLFNALNDLNNLIIQRDNSEKLEYHEKYHIIENVFKQKKKPT 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 HCTYFPQELRSVKYAYSADLFNALNDLNNLIIQRDNSEKLEYHEKYHIIENVFKQKKKPT 300 Qy 301 LKQIAKEIGVNPEDIKGYRITKSGTPEFTSFKLFHDLKKVVKDHAILDDIDLLNQIAEIL 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 LKQIAKEIGVNPEDIKGYRITKSGTPEFTSFKLFHDLKKVVKDHAILDDIDLLNQIAEIL 360 Qy 361 TIYQDKDSIVAELGQLEYLMSEADKQSISELTGYTGTHSLSLKCMNMIIDELWHSSMNQM 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 TIYQDKDSIVAELGQLEYLMSEADKQSISELTGYTGTHSLSLKCMNMIIDELWHSSMNQM 420 Qy 421 EVFTYLNMRPKKYELKGYQRIPTDMIDDAILSPVVKRTFIQSINVINKVIEKYGIPEDII 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 EVFTYLNMRPKKYELKGYQRIPTDMIDDAILSPVVKRTFIQSINVINKVIEKYGIPEDII 480 Qy 481 IELARENNSDDRKKFINNLQKKNEATRKRINEIIGQTGNQNAKRIVEKIRLHDQQEGKCL 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 481 IELARENNSDDRKKFINNLQKKNEATRKRINEIIGQTGNQNAKRIVEKIRLHDQQEGKCL 540 Qy 541 YSLESIPLEDLLNNPNHYEVDHIIPRSVSFDNSYHNKVLVKQSENSKKSNLTPYQYFNSG 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 541 YSLESIPLEDLLNNPNHYEVDHIIPRSVSFDNSYHNKVLVKQSENSKKSNLTPYQYFNSG 600 Qy 601 KSKLSYNQFKQHILNLSKSQDRISKKKKEYLLEERDINKFEVQKEFINRNLVDTRYATRE 660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 601 KSKLSYNQFKQHILNLSKSQDRISKKKKEYLLEERDINKFEVQKEFINRNLVDTRYATRE 660 Qy 661 LTNYLKAYFSANNMNVKVKTINGSFTDYLRKVWKFKKERNHGYKHHAEDALIIANADFLF 720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 661 LTNYLKAYFSANNMNVKVKTINGSFTDYLRKVWKFKKERNHGYKHHAEDALIIANADFLF 720 Qy 721 KENKKLKAVNSVLEKPEIETKQLDIQVDSEDNYSEMFIIPKQVQDIKDFRNFKFSHRVDK 780 |||||||||||||||||||||||||||||||||||||||||||||||||||||:|||||| Db 721 KENKKLKAVNSVLEKPEIETKQLDIQVDSEDNYSEMFIIPKQVQDIKDFRNFKYSHRVDK 780 Qy 781 KPNRQLINDTLYSTRMKDEHDYIVQTITDIYGKDNTNLKKQFNKNPEKFLMYQNDPKTFE 840 ||||||||||||||| || |||||| ||| |||| |||||:|:||||||||:||:||| Db 781 KPNRQLINDTLYSTRKKDNSTYIVQTIKDIYAKDNTTLKKQFDKSPEKFLMYQHDPRTFE 840 Qy 841 KLSIIMKQYSDEKNPLAKYYEETGEYLTKYSKKNNGPIVKKIKLLGNKVGNHLDVTNKYE 900 || :|||||::||||||||:|||||||||||||||||||| :| :|||:|:|||||:::: Db 841 KLEVIMKQYANEKNPLAKYHEETGEYLTKYSKKNNGPIVKSLKYIGNKLGSHLDVTHQFK 900 Qy 901 NSTKKLVKLSIKNYRFDVYLTEKGYKFVTIAYLNVFKKDNYYYIPKDKYQELKEKKKIKD 960 :||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 901 SSTKKLVKLSIKNYRFDVYLTEKGYKFVTIAYLNVFKKDNYYYIPKDKYQELKEKKKIKD 960 Qy 961 TDQFIASFYKNDLIKLNGDLYKIIGVNSDDRNIIELDYYDIKYKDYCEINNIKGEPRIKK 1020 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 961 TDQFIASFYKNDLIKLNGDLYKIIGVNSDDRNIIELDYYDIKYKDYCEINNIKGEPRIKK 1020 Qy 1021 TIGKKTESIEKFTTDVLGNLYLHSTEKAPQLIFKRGL 1057 ||||||||||||||||||||||||||||||||||||| Db 1021 TIGKKTESIEKFTTDVLGNLYLHSTEKAPQLIFKRGL 1057 SEQ ID NO: 4 RESULT 2 BHV54948 ID BHV54948 standard; protein; 1082 AA. XX AC BHV54948; XX DT 23-JUL-2020 (first entry) XX DE LNP composition preparation related fusion protein (GST3-v1), SEQ ID 39. XX KW Cas9 protein; Nucleoplasmin; cardiovascular disease; cardiovascular-gen.; KW drug delivery; factor viii deficiency; fusion protein; KW genetic-disease-gen.; nanotechnology; therapeutic. XX OS Macaca mulatta polyomavirus 1. OS Staphylococcus lugdunensis. OS Staphylococcus pasteuri. OS Staphylococcus microti. OS Staphylococcus hyicus. OS Chimeric. OS Synthetic. OS Unidentified. XX CC PN WO2020112908-A2. XX CC PD 04-JUN-2020. XX CC PF 26-NOV-2019; 2019WO-US063456. XX PR 28-NOV-2018; 2018US-0772278P. XX CC PA (CASE-) CASEBIA THERAPEUTICS LLP. XX CC PI Cheng CJ, Scharenberg A, Wang K, Sane S; XX DR WPI; 2020-491643/051. DR N-PSDB; BHV54947. XX CC PT Lipid-based nanoparticle composition for delivering nucleic acid molecule CC PT into cell, and for editing genome of cell, comprisesnucleic acid molecule CC PT comprising nucleotide sequence encoding site-specific endonuclease, and CC PT lipid moieties. XX CC PS Example 2; SEQ ID NO 39; 100pp; English. XX CC The present invention relates to a novel lipid-based nanoparticle (LNP) CC composition, useful for a delivering nucleic acid molecule into a cell. CC The LNP composition comprises a nucleic acid molecule containing a CC nucleotide sequence encoding a site-specific endonuclease of SEQ ID NO: 1 CC -6 (see BHV54910-BHV54915); and lipid moieties selected from amino CC lipids, ionizable lipids, neutral lipids, polyethylene glycol (PEG) CC lipids, helper lipids and cholesterol or cholesterol derivatives. The CC invention further claims: (1) a method for delivering a nucleic acid CC molecule into a cell; and (2) a method for editing a genome of the cell. CC The LNP composition is useful for: delivering a nucleic acid molecule CC into a target cell, which is useful for editing a genome of the cell; and CC treating disease such as hemophilia A (HemA) or cardiovascular disease. CC The present sequence is a fusion protein containing nucleoplasmin nuclear CC localization signal (NLS) peptide, Gly-Ser linker peptide, Staphylococcus CC sp. Cas9 protein and SV40 NLS peptide, which is useful for preparing LNP CC composition for editing a genome of the cell. XX SQ Sequence 1082 AA; Query Match 100.0%; Score 5494; Length 1082; Best Local Similarity 100.0%; Matches 1057; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MNQKFILGLDIGITSVGYGLIDYETKNIIDAGVRLFPEANVENNEGRRSKRGSRRLKRRR 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 10 MNQKFILGLDIGITSVGYGLIDYETKNIIDAGVRLFPEANVENNEGRRSKRGSRRLKRRR 69 Qy 61 IHRLERVKLLLTEYDLINKEQIPTSNNPYQIRVKGLSEILSKDELAIA LLHLAKRRGIHN 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 70 IHRLERVKLLLTEYDLINKEQIPTSNNPYQIRVKGLSEILSKDELAIA LLHLAKRRGIHN 129 Qy 121 VDVAADKEETASDSLSTKDQINKNAKFLESRYVCELQKERLENEGHVRGVENRFLTKDIV 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 130 VDVAADKEETASDSLSTKDQINKNAKFLESRYVCELQKERLENEGHVRGVENRFLTKDIV 189 Qy 181 REAKKIIDTQMQYYPEIDETFKEKYISLVETRREYFEGPGQGSPFGWNGDLKKWYEMLMG 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 190 REAKKIIDTQMQYYPEIDETFKEKYISLVETRREYFEGPGQGSPFGWNGDLKKWYEMLMG 249 Qy 241 HCTYFPQELRSVKYAYSADLFNALNDLNNLIIQRDNSEKLEYHEKYHIIENVFKQKKKPT 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 250 HCTYFPQELRSVKYAYSADLFNALNDLNNLIIQRDNSEKLEYHEKYHIIENVFKQKKKPT 309 Qy 301 LKQIAKEIGVNPEDIKGYRITKSGTPEFTSFKLFHDLKKVVKDHAILDDIDLLNQIAEIL 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 310 LKQIAKEIGVNPEDIKGYRITKSGTPEFTSFKLFHDLKKVVKDHAILDDIDLLNQIAEIL 369 Qy 361 TIYQDKDSIVAELGQLEYLMSEADKQSISELTGYTGTHSLSLKCMNMIIDELWHSSMNQM 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 370 TIYQDKDSIVAELGQLEYLMSEADKQSISELTGYTGTHSLSLKCMNMIIDELWHSSMNQM 429 Qy 421 EVFTYLNMRPKKYELKGYQRIPTDMIDDAILSPVVKRTFIQSINVINKVIEKYGIPEDII 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 430 EVFTYLNMRPKKYELKGYQRIPTDMIDDAILSPVVKRTFIQSINVINKVIEKYGIPEDII 489 Qy 481 IELARENNSDDRKKFINNLQKKNEATRKRINEIIGQTGNQNAKRIVEKIRLHDQQEGKCL 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 490 IELARENNSDDRKKFINNLQKKNEATRKRINEIIGQTGNQNAKRIVEKIRLHDQQEGKCL 549 Qy 541 YSLESIPLEDLLNNPNHYEVDHIIPRSVSFDNSYHNKVLVKQSENSKKSNLTPYQYFNSG 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 550 YSLESIPLEDLLNNPNHYEVDHIIPRSVSFDNSYHNKVLVKQSENSKKSNLTPYQYFNSG 609 Qy 601 KSKLSYNQFKQHILNLSKSQDRISKKKKEYLLEERDINKFEVQKEFINRNLVDTRYATRE 660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 610 KSKLSYNQFKQHILNLSKSQDRISKKKKEYLLEERDINKFEVQKEFINRNLVDTRYATRE 669 Qy 661 LTSYLKAYFSANNMDVKVKTINGSFTNHLRKVWRFDKYRNHGYKHHAEDALIIANADFLF 720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 670 LTSYLKAYFSANNMDVKVKTINGSFTNHLRKVWRFDKYRNHGYKHHAEDALIIANADFLF 729 Qy 721 KENKKLQNTNKILEKPTIENNTKKVTVEKEEDYNNVFETPKLVEDIKQYRDYKFSHRVDK 780 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 730 KENKKLQNTNKILEKPTIENNTKKVTVEKEEDYNNVFETPKLVEDIKQYRDYKFSHRVDK 789 Qy 781 KPNRQLINDTLYSTRMKDEHDYIVQTITDIYGKDNTNLKKQFNKNPEKFLMYQNDPKTFE 840 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 790 KPNRQLINDTLYSTRMKDEHDYIVQTITDIYGKDNTNLKKQFNKNPEKFLMYQNDPKTFE 849 Qy 841 KLSIIMKQYSDEKNPLAKYYEETGEYLTKYSKKNNGPIVKKIKLLGNKVGNHLDVTNKYE 900 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 850 KLSIIMKQYSDEKNPLAKYYEETGEYLTKYSKKNNGPIVKKIKLLGNKVGNHLDVTNKYE 909 Qy 901 NSTKKLVKLSIKNYRFDVYLTEKGYKFVTIAYLNVFKKDNYYYIPKDKYQELKEKKKIKD 960 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 910 NSTKKLVKLSIKNYRFDVYLTEKGYKFVTIAYLNVFKKDNYYYIPKDKYQELKEKKKIKD 969 Qy 961 TDQFIASFYKNDLIKLNGDLYKIIGVNSDDRNIIELDYYDIKYKDYCEINNIKGEPRIKK 1020 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 970 TDQFIASFYKNDLIKLNGDLYKIIGVNSDDRNIIELDYYDIKYKDYCEINNIKGEPRIKK 1029 Qy 1021 TIGKKTESIEKFTTDVLGNLYLHSTEKAPQLIFKRGL 1057 ||||||||||||||||||||||||||||||||||||| Db 1030 TIGKKTESIEKFTTDVLGNLYLHSTEKAPQLIFKRGL 1066 Claim Rejections - 35 USC § 103 (AIA ) The following is a quotation of 35 U.S.C. 103 which forms the basis for all obviousness rejections set forth in this Office action: A patent for a claimed invention may not be obtained, notwithstanding that the claimed invention is not identically disclosed as set forth in section 102 of this title, if the differences between the claimed invention and the prior art are such that the claimed invention as a whole would have been obvious before the effective filing date of the claimed invention to a person having ordinary skill in the art to which the claimed invention pertains. Patentability shall not be negated by the manner in which the invention was made. In the event the determination of the status of the application as subject to AIA 35 U.S.C. 102 and 103 (or as subject to pre-AIA 35 U.S.C. 102 and 103) is incorrect, any correction of the statutory basis for the rejection will not be considered a new ground of rejection if the prior art relied upon, and the rationale supporting the rejection, would be the same under either status. This application currently names joint inventors. In considering patentability of the claims the examiner presumes that the subject matter of the various claims was commonly owned as of the effective filing date of the claimed invention(s) absent any evidence to the contrary. Applicant is advised of the obligation under 37 CFR 1.56 to point out the inventor and effective filing dates of each claim that was not commonly owned as of the effective filing date of the later invention in order for the examiner to consider the applicability of 35 U.S.C. 102(b)(2)(C) for any potential 35 U.S.C. 102(a)(2) prior art against the later invention. Claims 47, 49, 51 are rejected under 35 U.S.C. 103 as being unpatentable over Cheng et al. (WO 2020/112908 published 6/4/2020, claims priority to application No. 62/772,278, effective filing date 11/28/2018). Cheng et al. further teach that homology directed repair requires a donor molecule to template repair of a target molecule and that in some situations, the donor polynucleotide integrates into the target DNA (page 11, paragraph [0046]). Cheng et al. discloses the intended use of mice to evaluate the integration of the FVIII gene into the albumin locus (page 50, paragraph [0152]). Cheng et al. teach lipid-based nanoparticles comprising mRNAs encoding the sRGN and guide RNAs (page 45, Example 2). Cheng et al. teach the use of kits with reagents and instructions according to the manufacturer with defined protocols (page 45, first four lines). Claims 47, 49, 51 are directed in part to the composition of claim 46 as described above, wherein the composition further comprises a donor polynucleotide, or wherein said composition is formulated in a liposome or a lipid nanoparticle, and a kit that comprises the sRGN of claim 42 as described above, a guide RNA and instructions for targeting, editing, modifying or manipulating a target DNA. It would have been obvious to one of ordinary skill in the art before the effective filing date of the claimed invention to (i) add a donor polynucleotide to the composition that comprises the sRGN and gRNA of Cheng et al., (ii) include the composition of Cheng et al. in a liposome or a lipid nanoparticle, or (iii) include the composition of Cheng et al. in a kit with instructions. A person of ordinary skill in the art is motivated to (i) add a donor polynucleotide to the composition that comprises the sRGN and gRNA of Cheng et al., for the benefit of including a molecule that would be required in homology directed repair so that the desired editing is achieved, (ii) include the composition of Cheng et al. in a liposome or a lipid nanoparticle for the benefit of aiding the delivery of the composition to a cell through its membrane, and (iii) include the composition of Cheng et al. in a kit with instructions to allow one of skill in the art to have the required components in a single item for facilitating targeting, cleaving and editing the desired target nucleic acid. One of ordinary skill in the art has a reasonable expectation of success at (i) adding a donor polynucleotide to a composition that comprises a sRGN and gRNA, (ii) including the composition of Cheng et al. in a liposome or a lipid nanoparticle, or (iii) include the composition of Cheng et al. in a kit with instructions because all that is required is including a nucleic acid to the composition, using a well known method to deliver a composition to a cell, and place all the required components in a single item (kit), which is a commonly used form of placing components for an assay, as evidenced by Cheng et al. Therefore, the invention as a whole would have been prima facie obvious to a person of ordinary skill in the art before the effective filing date of the claimed invention. Conclusion No claim is in condition for allowance. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. Applicant is advised that any Internet email communication by the Examiner has to be authorized by Applicant in written form. See MPEP § 502.03 (II). Without a written authorization by Applicant in place, the USPTO will not respond via Internet email to any Internet correspondence which contains information subject to the confidentiality requirement as set forth in 35 U.S.C. 122. Sample written authorization language can be found in MPEP § 502.03 (II). An Authorization for Internet Communications in a Patent Application or Request to Withdraw Authorization for Internet Communications form (SB/439) can be found at https://www.uspto.gov/patent/forms/ forms-patent-applications-filed-or-after-september-16-2012, which can be electronically filed. Any inquiry concerning this communication or earlier communications from the examiner should be directed to DELIA M RAMIREZ, Ph.D., whose telephone number is (571) 272-0938. The examiner can normally be reached on Monday-Friday from 8:30 AM to 5:00 PM. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Robert B. Mondesi, can be reached at (408) 918-7584. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. /DELIA M RAMIREZ/Primary Examiner, Art Unit 1652 DR September 17, 2026
Read full office action

Prosecution Timeline

Jan 10, 2025
Application Filed
Sep 21, 2026
Non-Final Rejection mailed — §102, §103 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12716081
MUTANT OF CORYNEBACTERIUM GLUTAMICUM WITH ENHANCED L-CITRULLINE PRODUCTIVITY AND METHOD FOR PREPARING L-CITRULLINE USING THE SAME
2y 10m to grant Granted Aug 25, 2026
Patent 12698515
GENETICALLY ENGINEERED BACTERIUM USING GLUCOSE AS SUBSTRATE FOR DE NOVO SYNTHESIS OF VANILLIN AND APPLICATION THEREOF
2y 4m to grant Granted Aug 04, 2026
Patent 12698492
ISOLATED CAS13 PROTEIN AND USE THEREOF
2y 3m to grant Granted Aug 04, 2026
Patent 12668785
COMBINATION TREATMENT
2y 11m to grant Granted Jun 30, 2026
Patent 12655405
SEQUENCE SPECIFIC DEGRADATION OF SINGLE-STRANDED POLYNUCLEOTIDES WITH CARD1 NUCLEASE
3y 4m to grant Granted Jun 16, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

Strategy Recommendation AI-generated — please review before filing

Get a prosecution strategy drawn from examiner precedents, rejection analysis, and claim mapping.
Typically takes 5-10 seconds — AI-generated, attorney review required before filing

Prosecution Projections

1-2
Expected OA Rounds
65%
Grant Probability
99%
With Interview (+56.3%)
2y 9m (~1y 1m remaining)
Median Time to Grant
Low
PTA Risk
Based on 855 resolved cases by this examiner. Grant probability derived from career allowance rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month