Prosecution Insights
Last updated: October 01, 2026
Application No. 19/092,212

METHODS OF ALTERING SEED WEIGHT AND SEED OIL CONTENT BY MANIPULATING ALPHA-CARBOXYL-TRANSFERASE (A-CT) ACTIVITY VIA CARBOXYL-TRANSFERASE INTERACTION (CTI) PROTEIN EXPRESSION

Non-Final OA §112§DP
Filed
Mar 27, 2025
Priority
May 30, 2018 — provisional 62/678,212 +2 more
Examiner
ZHONG, WAYNESHAOBIN
Art Unit
1662
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
The Curators of the University of Missouri
OA Round
1 (Non-Final)
72%
Grant Probability
Favorable
1-2
OA Rounds
1y 4m
Est. Remaining
94%
With Interview

Examiner Intelligence

Grants 72% — above average
72%
Career Allowance Rate
393 granted / 544 resolved
+12.2% vs TC avg
Strong +22% interview lift
Without
With
+21.5%
Interview Lift
resolved cases with interview
Typical timeline
2y 10m
Avg Prosecution
27 currently pending
Career history
566
Total Applications
across all art units

Statute-Specific Performance

§101
8.9%
-31.1% vs TC avg
§103
31.7%
-8.3% vs TC avg
§102
10.4%
-29.6% vs TC avg
§112
36.1%
-3.9% vs TC avg
Black line = Tech Center average estimate • Based on career data from 544 resolved cases

Office Action

§112 §DP
DETAILED ACTION Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Information Disclosure Statement The Information Disclosure Statements filed on 4/11/2025, 6/30/2025 have been entered and considered. Initialed copies of the form PTO-1449 are enclosed with this action. Restriction/Status of claims On 8/6/2026, the applicant elected species SEQ ID NO: 17 (from SEQ ID NOs: 17-33, 63-67), and SEQ ID NO: 43 (from SEQ ID NO; 43-59), without traverse. Claims 1-20 are pending and examined in this office action. Non-elected species are withdrawn. Priority Instant 19092212, filed 03/27/2025, is a Continuation of 17250117, filed 11/30/2020, now U.S. Patent 12286649. 17250117 is a National Stage entry of PCT/US2019/034754, International Filing Date: 05/30/2019. PCT/US2019/034754 Claims Priority from Provisional Application 62678212, filed 05/30/2018. Provisional Application 62678212 did not disclose the subject matter of the elected SEQ ID NO: 17 nor SEQ ID NO: 43. Thus, the priority is not recognized. PCT/US2019/034754 disclosed the claimed subject matter including SEQ ID NO: 17 and SEQ ID NO: 43, thus, the priority of 05/30/2018 is recognized. Objection to Sequence Listing The sequence listing of 3/27/2025 is objected, because: by the examiner’s alignment, SEQ ID NO: 55 is identical to SEQ ID NO: 43 (elected species), and both are from Brassica napus. Thus, SEQ ID NO: 55 is a duplicate of SEQ ID NO: 43 (elected species). Appropriate correction is required. Claim Objections Claims 3, 10, 19 are objected to because: By the examiner’s alignment, SEQ ID NO: 55 is identical to SEQ ID NO: 43 (elected species), and both are from Brassica napus. Thus, SEQ ID NO: 55 is a duplicate of SEQ ID NO: 43 (elected species). Appropriate corrections are required. Note: SEQ ID NO: 55 is a non-elected species, and is not examined in this office action, thus, no double patenting rejection is made. This objection is made for compact prosecution. Improper Markush Groups Claims 1, 3, 10, 12, 17, 19 and dependent claims 2, 4-9, 11, 13-16, 18, 20 are rejected on the basis that it contains an improper Markush grouping of alternatives. See In re Harnisch, 631 F.2d 716, 721-22 (CCPA 1980) and Ex parte Hozumi, 3 USPQ2d 1059, 1060 (Bd. Pat. App. & Int. 1984). A Markush grouping is proper if the alternatives defined by the Markush group (i.e., alternatives from which a selection is to be made in the context of a combination or process, or alternative chemical compounds as a whole) share a “single structural similarity” and a common use. A Markush grouping meets these requirements in two situations. First, a Markush grouping is proper if the alternatives are all members of the same recognized physical or chemical class or the same art-recognized class, and are disclosed in the specification or known in the art to be functionally equivalent and have a common use. Second, where a Markush grouping describes alternative chemical compounds, whether by words or chemical formulas, and the alternatives do not belong to a recognized class as set forth above, the members of the Markush grouping may be considered to share a “single structural similarity” and common use where the alternatives share both a substantial structural feature and a common use that flows from the substantial structural feature. See MPEP § 706.03(y). Claims 1, 12 and 17 recite polypeptide sequences selected from the group consisting of SEQ ID NOs: 17-33 and 63-67. Claims 3, 10 and 19 recite nucleotide sequences selected from the group consisting of SEQ ID NOs: 43-59. The Markush grouping of SEQ ID NOs: 17-33 and 63-67 and the Markush grouping of SEQ ID NOs: 43-59 are improper, because: According to MPEP 706.03 II. A., Members of a Markush group share a “single structural similarity” when they belong to the same recognized physical or chemical class or to the same art-recognized class (prong 1) and the members of a Markush group share a common function or use when they are disclosed in the specification or known in the art to be functionally equivalent (prong 2). In another word, both prong 1 and prong 2 must be satisfied. In this case, SEQ ID NO: 17 is the elected species. By the examiner’s alignments, only SEQ ID NOs: 18, 23-24, 30, 63-64 share significantly high sequence identities to SEQ ID NO: 17 (at least 95%). All of the other sequences have sequence identities below 30%. For example, SEQ ID NO: 19 has only 24.4% sequence identity to SEQ ID NO: 17; SEQ ID NO: 20 has only 25.3% sequence identity to SEQ ID NO: 17. SEQ ID NO: 43 is the elected species. By the examiner’s alignments, only SEQ ID NOs: 44, 49-50, 55-56 share significantly high sequence identities to SEQ ID NO: 43 (at least 95%). All of the other sequences have sequence identities below 30%. For example, SEQ ID NO: 45 has only 11.4% sequence identity to SEQ ID NO: 43; SEQ ID NO: 46 has only 12.7% sequence identity to SEQ ID NO: 43. In addition, according to the specification (Table 2 in page 22-25), only SEQ ID NOs: 17-18, 23-24, 30 are CTI1 protein homologs or orthologs. Only SEQ ID NOs: 43-44, 49-50, 55-56 are CTI1 gene homologs or orthologs. Other sequences are CTI2 or CTI3 homologs or orthologs, not CTI1 homologs or orthologs. Accordingly, SEQ ID NOs: 17-18, 23-24, 30, 63-64 (peptides), 43-44, 49-50, 55-56 (polynucleotides) are CTI1 homologs or orthologs, and are structurally distinct from the CTI2 or CTI3 sequences. Furthermore, according to the specification (Example 3 in [0195]-[0200]), knockout of CTI1, CTI2 or CTI3 have different genotypes and resultant phenotypes. Accordingly, SEQ ID NOs: 17-18, 23-24, 30, 63-64 (peptides), 43-44, 49-50, 55-56 (polynucleotides) are CTI1 homologs or orthologs, and are functionally distinct from the CTI2 or CTI3 sequences. Again, both prong 1 and prong 2 must be satisfied to put them into the same Markush group. In this case, neither prong 1 nor prong 2 is satisfied. To overcome this rejection, Applicant may set forth each alternative (or grouping of patentably indistinct alternatives) within an improper Markush grouping in a series of independent or dependent claims and/or present convincing arguments that the group members recited in the alternative within a single claim in fact share a single structural similarity as well as a common use. Dependent claims do not cure the deficiency, thus, are included. Claim Rejections - 35 USC § 112 Failing to further limit the parent claim The following is a quotation of 35 U.S.C. 112(d): (d) REFERENCE IN DEPENDENT FORMS—Subject to subsection (e), a claim in dependent form shall contain a reference to a claim previously set forth and then specify a further limitation of the subject matter claimed. A claim in dependent form shall be construed to incorporate by reference all the limitations of the claim to which it refers. Claim 16 is rejected under 35 U.S.C. 112(d) or pre-AIA 35 U.S.C. 112, 4th paragraph, as being of improper dependent form for failing to further limit the subject matter of the claim upon which it depends, or for failing to include all the limitations of the claim upon which it depends. Claim 16 depends on claims 14-15, 7, 1-2, but recites “gene orthologs of CTI1, CTI2, and CTI3, or artificial genes containing essential CTI motifs”. However, claim 1 has been amended to recite specific SEQ ID Nos setting forth specific CTI genes orthologs, which is narrower than “gene orthologs of CTI1, CTI2, and CTI3, or artificial genes containing essential CTI motifs”. In another word, claim 16 is broader in scope than claims 1-2, 7, 14-15. Thus, claim 16 does not further limit the subject matter of claim 1. Instead, the claim is broader in scope than claim 1 is. The applicant may cancel the claim(s), amend the claim(s) to place the claim(s) in proper dependent form, rewrite the claim(s) in independent form, or present a sufficient showing that the dependent claim(s) complies with the statutory requirements. Lacking written description The following is a quotation of 35 U.S.C. 112(a): (a) IN GENERAL.—The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor or joint inventor of carrying out the invention. Claims 1, 12 and dependent claims 2-11, 13-16, 18-19 are rejected under 35 U.S.C. 112(a), as failing to comply with the written description requirement. The claim(s) contains subject matter which was not described in the specification in such a way as to reasonably convey to one skilled in the relevant art that the inventor or a joint inventor, or for pre-AIA the inventor(s), at the time the application was filed, had possession of the claimed invention. To claim a genus under the written description requirement, the applicant is required to describe a representative number of species to reflect the variation within the genus or structures sufficient to define the genus. The factors to be considered include disclosure of complete or partial structure, physical and/or chemical properties, functional characteristics, structure/function correlation, methods of making the claimed product, or any combinations thereof. By court’s statement in Regents of the Univ. of Cal. v. Eli Lilly, 119 F.3d 1559, 1566, 43 USPQ2d 1398, 1404 (Fed. Cir. 1997), a written description of an invention “requires a precise definition, such as a structure, formula, or chemical name, of the claimed subject matter sufficient to distinguish it from other materials”; further, a written description of a claimed genus requires a description of a representative number of species of the claimed genus, and one of skill in the art should be able to “visualize or recognize the identity of the members of the genus”. Claim 1 is broadly drawn to methods comprising decreasing intracellular concentrations of a genus of CIT proteins having at least 90% sequence identities to SEQ ID NO: 17 (elected species), along with a genus of non-elected sequences and sequences having at least 90% sequence identities thereof, wherein a-CT comprises a catalytic subunit of acetyl-CoA carboxylase (AC Case}. Claim 12 is broadly drawn to modified plants having decreased expression of CTI genes, wherein the CTI genes comprise a genus of polynucleotide sequences encoding polypeptide sequences having at least 90% sequence identities to SEQ ID NO: 17 (elected species), along with a genus of non-elected polypeptide sequences and sequences having at least 90% sequence identities thereof. The claimed functions are increasing activity levels of alpha-carboxyltransferase (a-CT), and increasing fatty acid and/or triacylglycerol production in plants or algae. The specification describes the structure of SEQ ID NOs: 17 and 43 by providing sequence information. According to the specification (Table 2 in page 22-25), only SEQ ID NOs: 17 and 43 (elected species) are CTI1 protein and gene homologs or orthologs. The specification also provides example that CTI1 interacts and inhibits a-CT (Example 2, [0191]-[0193], Fig. 3). The specification further provides example of making knockout of CTI1 in plant cells and demonstrated increased content of fatty acid and/or triacylglycerol (Example 3, [0197]-[0201], Fig. 4B; Fig 28B). In prior art, Thelen (WO2018009626, published 1/11/2018, filed 7/6/2017) teaches that overexpressing a-CT compressing subunit of ACCase leads to increased content of fatty acid and/or triacylglycerol (Example 11, [00188]). Thus, it is deemed reasonably described that knocking out/decreasing activity level of CTI1 sequences, including SEQ ID NO: 17/encoded by SEQ ID NO: 43, leads to increased activity level of a-CT, and increased content of fatty acid and/or triacylglycerol. However, the specification or prior art does not describe common structure feature(s) of the genus of sequences having at least about 90% sequence identity to SEQ ID NO: 17, and the genus of sequences having at least about 90% sequence identity to SEQ ID NO: 43, are sufficiently associated to the function of interacting with a-CT and increasing content of fatty acid and/or triacylglycerol. According to specification ([0101]), the sequence identity is calculated by using bioinformatics tools like BLAST. According to specification ([0069], Example 4 in [0201]-[0203), the CTI orthologs are calculated and predicted by using bioinformatics tools like BLAST.. CTI1, CTI2 and CTI3 orthologs (including the claimed non-elected species) are predicted as CTI proteins using bioinformatics tools. The specification does not describe how the “essential” motifs are obtained. In the art, Friedberg (Automated protein function prediction--the genomic challenge. Brief. Bioinformatics. 7:225-242, 2006) teaches that homology-based transfer is not reliable for functional annotation even with high- alignment percentages (page 227, second column). Friedberg also teaches that identification of functionally significant sub-regions is critical to functional annotation, and that often addition, deletion, or re-shuffling of domains can lead to errors in annotation (page 227, second column; page 228, 1st paragraph). Friedberg teaches that sequence-based tools are just not sensitive enough to identify functional protein similarity as databases get larger, and diversity of sequences get larger (page 228, first full paragraph). Wang et al (From Protein Sequence to Protein Function via Multi-Label Linear Discriminant Analysis. IEEE/ACM TRANSACTIONS ON COMPUTATIONAL BIOLOGY AND BIOINFORMATICS, VOL. 14, NO. 3, 503-513, 2017) teach that FASTA and Basic Local Alignment Search Tool (BLAST) are useful but have limitations. Because a duplicate of a gene could adopt a new function in response to selective pressure during evolution, function transfer by homology on such gene and its product could produce erroneous results (p503, left col, 2nd para). There is no literature addressing the issue which criterion and which algorithm is optimal for protein function prediction. Moreover, genes evolve at different rates due to both uneven selection pressure on their functions and the inherent mutation rate of different species, which means that it is difficult to establish a similarity measure that is reliable in all cases (p504, left col, 1st para). Computational approaches to predict protein function is to assist biologist to discover new functional roles of proteins for experimental verification (p508, right col, last para). Thus, the sequences and percentage identical thereof obtained by algorisms of bioinformatics tools are not consistent or reliable. Experimental data is the most reliable, specifically for new proteins and new functions. In this case, SEQ ID NO: 17 is a newly characterized protein. Interacting with a-CT is a newly discovered function. Furthermore, critically, the following sequence is 94.7% identical to instant SEQ ID NO: 17, but is a “uncharacterized protein”. It is just an example of the claimed genus of sequences that are not described to have the claimed functions: A0A9W3CAQ7_RAPSA ID A0A9W3CAQ7_RAPSA Unreviewed; 167 AA. AC A0A9W3CAQ7; DT 08-NOV-2023, integrated into UniProtKB/TrEMBL. DT 08-NOV-2023, sequence version 1. DT 10-JUN-2026, entry version 13. DE SubName: Full=Uncharacterized protein LOC130498881 {ECO:0000313|RefSeq:XP_056848610.1}; GN Name=LOC130498881 {ECO:0000313|RefSeq:XP_056848610.1}; OS Raphanus sativus (Radish) (Raphanus raphanistrum var. sativus). OC Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; OC Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; OC rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus. OX NCBI_TaxID=3726 {ECO:0000313|Proteomes:UP000504610, ECO:0000313|RefSeq:XP_056848610.1}; RN [1] {ECO:0000313|Proteomes:UP000504610} RP NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. RC STRAIN=cv. WK10039 {ECO:0000313|Proteomes:UP000504610}; RX PubMed=30722041; RA Yu H.J., Baek S., Lee Y.J., Cho A., Mun J.H.; RT "The radish genome database (RadishGD): an integrated information resource RT for radish genomics."; RL Database 2019:5306501-5306501(2019). RN [2] {ECO:0000313|RefSeq:XP_056848610.1} RP IDENTIFICATION. RC TISSUE=Leaf {ECO:0000313|RefSeq:XP_056848610.1}; RG RefSeq; RL Submitted (JAN-2026) to UniProtKB. CC --------------------------------------------------------------------------- CC Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms CC Distributed under the Creative Commons Attribution (CC BY 4.0) License CC --------------------------------------------------------------------------- DR RefSeq; XP_056848610.1; XM_056992630.1. DR AlphaFoldDB; A0A9W3CAQ7; -. DR GeneID; 130498881; -. DR KEGG; rsz:130498881; -. DR OrthoDB; 1700403at2759; -. DR Proteomes; UP000504610; Chromosome 8. DR GO; GO:0009706; C:chloroplast inner membrane; IEA:TreeGrafter. DR GO; GO:0009535; C:chloroplast thylakoid membrane; IEA:TreeGrafter. DR InterPro; IPR040377; Ssl2009-like. DR PANTHER; PTHR34048:SF5; INNER MEMBRANE LOCALIZED PROTEIN; 1. DR PANTHER; PTHR34048; LOW-DENSITY RECEPTOR-LIKE PROTEIN; 1. DR Pfam; PF27515; Ssl2009_C; 1. PE 4: Predicted; KW Membrane {ECO:0000256|SAM:Phobius}; KW Reference proteome {ECO:0000313|Proteomes:UP000504610}; KW Transmembrane {ECO:0000256|SAM:Phobius}; KW Transmembrane helix {ECO:0000256|SAM:Phobius}. FT TRANSMEM 72..92 FT /note="Helical" FT /evidence="ECO:0000256|SAM:Phobius" FT REGION 1..23 FT /note="Disordered" FT /evidence="ECO:0000256|SAM:MobiDB-lite" FT REGION 144..167 FT /note="Disordered" FT /evidence="ECO:0000256|SAM:MobiDB-lite" FT COMPBIAS 1..18 FT /note="Polar residues" FT /evidence="ECO:0000256|SAM:MobiDB-lite" SQ SEQUENCE 167 AA; 17835 MW; 5669BAF0564C6397 CRC64; Query Match 94.7%; Score 779; Length 167; Best Local Similarity 94.0%; Matches 157; Conservative 2; Mismatches 8; Indels 0; Gaps 0; Qy 1 MAALSTSLSLSRNTQQLHPSSGFSLKPIGRRANVSFGLNPSKKIQLSAPSGKRILTIQSA 60 |||||||||| |||||||| |||||||: || |||||||||||:| ||| ||||||||| Db 1 MAALSTSLSLPRNTQQLHPPSGFSLKPVARRVNVSFGLNPSKKLQFSAPRSKRILTIQSA 60 Qy 61 YRDDDSSGSTGLFVGGFILGGLIVGALGCVYAPQISKAIA GADRKDFMRKLPKFIYDEEK 120 |||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||| Db 61 YRDDDSSGSTGLFVGGFILGGLIVGALGCVYAPQISKAIA GADRKDLMRKLPKFIYDEEK 120 Qy 121 ALEKTRKVLADKIAQLNSAIDDVSSQLKSEDTPNGAALSTDEVEATA 167 ||||||||||||||||||||||||||||||||||||||||||||||| Db 121 ALEKTRKVLADKIAQLNSAIDDVSSQLKSEDTPNGAALSTDEVEATA 167 Additionally regarding claims 3, 10 and 19, the claims are broadly drawn to a genus of CTI genes comprising a genus of non-elected polynucleotide sequences that are not CTI1 genes, and a genus of complements thereof. The claimed functions are the same as that of claims 1 and 12. The claims not only do not cure the deficiencies of the parent claims, but also introduce their own deficiencies: (1) The claims include non-elected species are that not CTI1 gene homologs or orthologs (except SEQ ID NOs: 43-44, 49-50, 55-56), and (2) the claims only require complement, but do not require full-length complement. Regarding the description of a representative number of species, SEQ ID NO: 17 is a polypeptide sequence of 167 amino acids. For 90% identical, 10%, or 16 amino acids, can be substituted, deleted or inserted by 19 different amino acids. The claimed genus has at least (16+15+14….+3+2+1) x 19 species for substitution only. Critically, as analyzed above, a sequence 94.7% identical to instant SEQ ID NO: 17 is a “uncharacterized protein”, and unlikely has the claimed function. SEQ ID NO: 43 is a polynucleotide sequence of 504 bases. For 90% identical, 10%, or 50 bases, can be substituted, deleted or inserted. Thus, the claimed genus has at least (50+49+48+….3+2+1) bases. In addition, the genus of polynucleotides can be from 1090-2022 bases long. Moreover, in theory, each bases change can change a codon and an encoded amino acid. Thus, the applicant claims an extremely large number of species that are also heterologous in structure and are not associated with the claimed function. Accordingly, SEQ ID NO: 17 does not demonstrate the common structure feature of the genus of sequences, and is not sufficient to represent the genus of sequences. Therefore, the application has not met either of the two elements of the written description requirement as set forth in the court' s decision in Eli Lilly, and has not shown her/his possession of the claimed genus. Dependent claims do not cure the deficiency and thus are included. Notes: claim 17 is included because non-elected species are not described. Remarks The sequence of SEQ ID NO: 17 (elected) was disclosed as BnaA08g04600D protein from Brassica napus, but was not characterized. See “Sequence Matches” at the end of office action. The sequence of SEQ ID NO: 43 (elected) was disclosed as a cDNA sequence from Brassica napus, but was not characterized. See “Sequence Matches” at the end of office action. Prior art does not teach or suggest knockout or reducing activity level of SEQ ID NO: 17 or 43, not even of CTI proteins or genes, not to mention for the function of increasing activity level of a-CT or ACCase, or increased content of fatty acid or triacylglycerol. Thus, no art rejection(s) is/are made. Double patenting rejection to U.S. Patent 12286649 is not made, because: Reference SEQ ID NO: 2, 4, 6 only shares 85.8%, 23.5% or 26.7% sequence identity, respectively, to SEQ ID NO: 17. The examiner cannot find evidence that the claimed SEQ ID NOs or CTI proteins are naturally down-regulated, not to mention that alpha-CT activity or expression is therefore increased (claim requirement), and not to mention fatty acid or triacylglycerol production is therefore increased. The following references are relevant to instant application, thus, are filed but not cited by the examiner: Thelen (WO2018009626, published 1/11/2018, filed 7/6/2017). Thelan et al (WO 2019232277, published 12/5/2019, filed 5/30/2019). Ye et al (Docking of acetyl-CoA carboxylase to the plastid envelope membrane attenuates fatty acid production in plants. Nature Communications. 1-14, 2020). Sequence Matches Against instant SEQ ID NO: 17 RESULT 1 A0A078HEC4_BRANA (NOTE: this sequence has 2 duplicates in the database searched. See complete list at the end of this report) ID A0A078HEC4_BRANA Unreviewed; 167 AA. AC A0A078HEC4; DT 29-OCT-2014, integrated into UniProtKB/TrEMBL. DT 29-OCT-2014, sequence version 1. DT 10-JUN-2026, entry version 38. DE SubName: Full=BnaA08g04600D protein {ECO:0000313|EMBL:CDY35799.1}; GN Name=BnaA08g04600D {ECO:0000313|EMBL:CDY35799.1}; GN ORFNames=GSBRNA2T00059296001 {ECO:0000313|EMBL:CDY35799.1}; OS Brassica napus (Rape). OC Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; OC Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; OC rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica. OX NCBI_TaxID=3708 {ECO:0000313|EMBL:CDY35799.1, ECO:0000313|Proteomes:UP000028999}; RN [1] {ECO:0000313|EMBL:CDY35799.1, ECO:0000313|Proteomes:UP000028999} RP NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. RC STRAIN=cv. Darmor-bzh {ECO:0000313|Proteomes:UP000028999}; RX PubMed=25146293; DOI=10.1126/science.1253435; RA Chalhoub B., Denoeud F., Liu S., Parkin I.A., Tang H., Wang X., Chiquet J., RA Belcram H., Tong C., Samans B., Correa M., Da Silva C., Just J., RA Falentin C., Koh C.S., Le Clainche I., Bernard M., Bento P., Noel B., RA Labadie K., Alberti A., Charles M., Arnaud D., Guo H., Daviaud C., RA Alamery S., Jabbari K., Zhao M., Edger P.P., Chelaifa H., Tack D., RA Lassalle G., Mestiri I., Schnel N., Le Paslier M.C., Fan G., Renault V., RA Bayer P.E., Golicz A.A., Manoli S., Lee T.H., Thi V.H., Chalabi S., Hu Q., RA Fan C., Tollenaere R., Lu Y., Battail C., Shen J., Sidebottom C.H., RA Wang X., Canaguier A., Chauveau A., Berard A., Deniot G., Guan M., Liu Z., RA Sun F., Lim Y.P., Lyons E., Town C.D., Bancroft I., Wang X., Meng J., RA Ma J., Pires J.C., King G.J., Brunel D., Delourme R., Renard M., Aury J.M., RA Adams K.L., Batley J., Snowdon R.J., Tost J., Edwards D., Zhou Y., Hua W., RA Sharpe A.G., Paterson A.H., Guan C., Wincker P.; RT "Plant genetics. Early allopolyploid evolution in the post-Neolithic RT Brassica napus oilseed genome."; RL Science 345:950-953(2014). CC --------------------------------------------------------------------------- CC Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms CC Distributed under the Creative Commons Attribution (CC BY 4.0) License CC --------------------------------------------------------------------------- DR EMBL; LK032361; CDY35799.1; -; Genomic_DNA. DR AlphaFoldDB; A0A078HEC4; -. DR STRING; 3708.A0A078HEC4; -. DR PaxDb; 3708-A0A078HEC4; -. DR Gramene; CDY35799; CDY35799; GSBRNA2T00059296001. DR KEGG; bna:106361260; -. DR OMA; QIEDEPN; -. DR OrthoDB; 1700403at2759; -. DR Proteomes; UP000028999; Unassembled WGS sequence. DR GO; GO:0009706; C:chloroplast inner membrane; IBA:GO_Central. DR InterPro; IPR040377; Ssl2009-like. DR PANTHER; PTHR34048:SF5; INNER MEMBRANE LOCALIZED PROTEIN; 1. DR PANTHER; PTHR34048; LOW-DENSITY RECEPTOR-LIKE PROTEIN; 1. DR Pfam; PF27515; Ssl2009_C; 1. PE 4: Predicted; KW Membrane {ECO:0000256|SAM:Phobius}; KW Reference proteome {ECO:0000313|Proteomes:UP000028999}; KW Transmembrane {ECO:0000256|SAM:Phobius}; KW Transmembrane helix {ECO:0000256|SAM:Phobius}. FT TRANSMEM 72..92 FT /note="Helical" FT /evidence="ECO:0000256|SAM:Phobius" FT REGION 1..24 FT /note="Disordered" FT /evidence="ECO:0000256|SAM:MobiDB-lite" FT REGION 144..167 FT /note="Disordered" FT /evidence="ECO:0000256|SAM:MobiDB-lite" FT COMPBIAS 1..23 FT /note="Polar residues" FT /evidence="ECO:0000256|SAM:MobiDB-lite" SQ SEQUENCE 167 AA; 17688 MW; EFD6C8ADB8D65341 CRC64; Query Match 100.0%; Score 823; Length 167; Best Local Similarity 100.0%; Matches 167; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MAALSTSLSLSRNTQQLHPSSGFSLKPIGRRANVSFGLNPSKKIQLSAPSGKRILTIQSA 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MAALSTSLSLSRNTQQLHPSSGFSLKPIGRRANVSFGLNPSKKIQLSAPSGKRILTIQSA 60 Qy 61 YRDDDSSGSTGLFVGGFILGGLIVGALGCVYAPQISKAIA GADRKDFMRKLPKFIYDEEK 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 YRDDDSSGSTGLFVGGFILGGLIVGALGCVYAPQISKAIA GADRKDFMRKLPKFIYDEEK 120 Qy 121 ALEKTRKVLADKIAQLNSAIDDVSSQLKSEDTPNGAALSTDEVEATA 167 ||||||||||||||||||||||||||||||||||||||||||||||| Db 121 ALEKTRKVLADKIAQLNSAIDDVSSQLKSEDTPNGAALSTDEVEATA 167 RESULT 4 A0A0D3DKD9_BRAOL ID A0A0D3DKD9_BRAOL Unreviewed; 167 AA. AC A0A0D3DKD9; DT 29-APR-2015, integrated into UniProtKB/TrEMBL. DT 29-APR-2015, sequence version 1. DT 10-JUN-2026, entry version 40. DE RecName: Full=Inner membrane localized protein {ECO:0008006|Google:ProtNLM}; OS Brassica oleracea var. oleracea. OC Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; OC Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; OC rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica. OX NCBI_TaxID=109376 {ECO:0000313|EnsemblPlants:Bo8g024300.1, ECO:0000313|Proteomes:UP000032141}; RN [1] {ECO:0000313|EnsemblPlants:Bo8g024300.1, ECO:0000313|Proteomes:UP000032141} RP NUCLEOTIDE SEQUENCE. RC STRAIN=cv. TO1000 {ECO:0000313|EnsemblPlants:Bo8g024300.1, RC ECO:0000313|Proteomes:UP000032141}; RX PubMed=24916971; DOI=10.1186/gb-2014-15-6-r77; RA Parkin I.A., Koh C., Tang H., Robinson S.J., Kagale S., Clarke W.E., RA Town C.D., Nixon J., Krishnakumar V., Bidwell S.L., Denoeud F., Belcram H., RA Links M.G., Just J., Clarke C., Bender T., Huebert T., Mason A.S., RA Pires J.C., Barker G., Moore J., Walley P.G., Manoli S., Batley J., RA Edwards D., Nelson M.N., Wang X., Paterson A.H., King G., Bancroft I., RA Chalhoub B., Sharpe A.G.; RT "Transcriptome and methylome profiling reveals relics of genome dominance RT in the mesopolyploid Brassica oleracea."; RL Genome Biol. 15:R77-R77(2014). RN [2] {ECO:0000313|EnsemblPlants:Bo8g024300.1} RP IDENTIFICATION. RG EnsemblPlants; RL Submitted (MAR-2015) to UniProtKB. CC --------------------------------------------------------------------------- CC Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms CC Distributed under the Creative Commons Attribution (CC BY 4.0) License CC --------------------------------------------------------------------------- DR RefSeq; XP_013604510.1; XM_013749056.1. DR AlphaFoldDB; A0A0D3DKD9; -. DR STRING; 109376.A0A0D3DKD9; -. DR EnsemblPlants; Bo8g024300.1; Bo8g024300.1; Bo8g024300. DR GeneID; 106311774; -. DR Gramene; Bo8g024300.1; Bo8g024300.1; Bo8g024300. DR KEGG; boe:106311774; -. DR eggNOG; ENOG502RXIP; Eukaryota. DR HOGENOM; CLU_105601_2_0_1; -. DR OMA; GERQYGV; -. DR OrthoDB; 70658at3699; -. DR Proteomes; UP000032141; Chromosome C8. DR GO; GO:0009706; C:chloroplast inner membrane; IEA:EnsemblPlants. DR GO; GO:0009535; C:chloroplast thylakoid membrane; IEA:TreeGrafter. DR InterPro; IPR040377; Ssl2009-like. DR PANTHER; PTHR34048:SF5; INNER MEMBRANE LOCALIZED PROTEIN; 1. DR PANTHER; PTHR34048; LOW-DENSITY RECEPTOR-LIKE PROTEIN; 1. DR Pfam; PF27515; Ssl2009_C; 1. PE 4: Predicted; KW Membrane {ECO:0000256|SAM:Phobius}; KW Reference proteome {ECO:0000313|Proteomes:UP000032141}; KW Transmembrane {ECO:0000256|SAM:Phobius}; KW Transmembrane helix {ECO:0000256|SAM:Phobius}. FT TRANSMEM 72..92 FT /note="Helical" FT /evidence="ECO:0000256|SAM:Phobius" FT REGION 144..167 FT /note="Disordered" FT /evidence="ECO:0000256|SAM:MobiDB-lite" SQ SEQUENCE 167 AA; 17706 MW; 6336865E8933C442 CRC64; Query Match 97.2%; Score 800; Length 167; Best Local Similarity 97.6%; Matches 163; Conservative 0; Mismatches 4; Indels 0; Gaps 0; Qy 1 MAALSTSLSLSRNTQQLHPSSGFSLKPIGRRANVSFGLNPSKKIQLSAPSGKRILTIQSA 60 |||||||||||||||||||||||||||| |||||||||||||||||||| ||||||| || Db 1 MAALSTSLSLSRNTQQLHPSSGFSLKPIARRANVSFGLNPSKKIQLSAPRGKRILTIPSA 60 Qy 61 YRDDDSSGSTGLFVGGFILGGLIVGALGCVYAPQISKAIA GADRKDFMRKLPKFIYDEEK 120 |||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||| Db 61 YRDDDSSGSTGLFVGGFILGGLIVGALGCVYAPQISKAIA GADRKDLMRKLPKFIYDEEK 120 Qy 121 ALEKTRKVLADKIAQLNSAIDDVSSQLKSEDTPNGAALSTDEVEATA 167 ||||||||||||||||||||||||||||||||||||||||||||||| Db 121 ALEKTRKVLADKIAQLNSAIDDVSSQLKSEDTPNGAALSTDEVEATA 167 Reference SEQ ID NO: 2 against instant SEQ ID NO: 17 US-17-250-117-2 (NOTE: this sequence has 1 duplicate in the database searched. See complete list at the end of this report) Sequence 2, US/17250117 Patent No. 12286649 GENERAL INFORMATION APPLICANT: The Curators of the University of Missouri APPLICANT: THELAN, Jay APPLICANT: YE, Yajin TITLE OF INVENTION: METHODS OF INCREASING SEED WEIGHT AND SEED OIL CONTENT BY TITLE OF INVENTION: MANIPULATING ALPHA-CARBOXYLTRANSFERASE (a-CT), TITLE OF INVENTION: CARBOXYLTRANSFERASE INTERACTOR 2, AND CARBOXYLTRANSFERASE TITLE OF INVENTION: INTERACTOR 3 FILE REFERENCE: 31458-39 (40451-PCT) CURRENT APPLICATION NUMBER: US/17/250,117 CURRENT FILING DATE: 2020-11-30 PRIOR APPLICATION NUMBER: US 62/678,212 PRIOR FILING DATE: 2018-05-30 NUMBER OF SEQ ID NOS: 92 SEQ ID NO 2 LENGTH: 168 TYPE: PRT ORGANISM: Arabidopsis thaliana Query Match 85.8%; Score 706.5; Length 168; Best Local Similarity 86.3%; Matches 145; Conservative 8; Mismatches 14; Indels 1; Gaps 1; Qy 1 MAAL-STSLSLSRNTQQLHPSSGFSLKPIGRRANVSFGLNPSKKIQLSAPSGKRILTIQS 59 ||:| |||||| :|: |||||||||| | | :|||||| | |: :||| |||||||| Db 1 MASLSSTSLSLPKNSHQLHPSSGFSLNPNARCVSVSFGLNHSNKLHISAPRTKRILTIQS 60 Qy 60 AYRDDDSSGSTGLFVGGFILGGLIVGALGCVYAPQISKAIA GADRKDFMRKLPKFIYDEE 119 |||||| |||||||||||||||||||||||||||||||||||||||| |||||||||||| Db 61 AYRDDDGSGSTGLFVGGFILGGLIVGALGCVYAPQISKAIA GADRKDLMRKLPKFIYDEE 120 Qy 120 KALEKTRKVLADKIAQLNSAIDDVSSQLKSEDTPNGAALSTDEVEATA 167 |||||||||||:|||||||||||||||||||||||||||||||:|||| Db 121 KALEKTRKVLAEKIAQLNSAIDDVSSQLKSEDTPNGAALSTDEIEATA 168 Reference SEQ ID NO: 4 against instant SEQ ID NO: 17 US-17-250-117-4 Sequence 4, US/17250117 Patent No. 12286649 GENERAL INFORMATION APPLICANT: The Curators of the University of Missouri APPLICANT: THELAN, Jay APPLICANT: YE, Yajin TITLE OF INVENTION: METHODS OF INCREASING SEED WEIGHT AND SEED OIL CONTENT BY TITLE OF INVENTION: MANIPULATING ALPHA-CARBOXYLTRANSFERASE (a-CT), TITLE OF INVENTION: CARBOXYLTRANSFERASE INTERACTOR 2, AND CARBOXYLTRANSFERASE TITLE OF INVENTION: INTERACTOR 3 FILE REFERENCE: 31458-39 (40451-PCT) CURRENT APPLICATION NUMBER: US/17/250,117 CURRENT FILING DATE: 2020-11-30 PRIOR APPLICATION NUMBER: US 62/678,212 PRIOR FILING DATE: 2018-05-30 NUMBER OF SEQ ID NOS: 92 SEQ ID NO 4 LENGTH: 168 TYPE: PRT ORGANISM: Arabidopsis thaliana Query Match 23.5%; Score 193; Length 168; Best Local Similarity 38.8%; Matches 47; Conservative 22; Mismatches 42; Indels 10; Gaps 4; Qy 55 LTIQSAYRDDDSSGSTGLFVGGFILGGLIVGALGCVYAPQISKAIA GADRKDFMRKLPKF 114 |:: : || | : || ||:|| : | | ::|||| ::: : | : Db 50 LSVSAGYRGGSKGGGSSDFVTGFLLGSAVFGTLAYIFAPQIRRSVLSENEYGFKKPEQPM 109 Qy 115 IYDEEKALEKTRKVLADKIAQLNSAIDDVSSQLK------SEDTPN-GAALSTD-EVEAT 166 ||| ||: |::| :|| ||||||| |||:|| |::| : : || | ||| Db 110 YYDE--GLEERREILNEKIGQLNSAIDKVSSRLKGGRSGSSKNTSSPSVPVETDAEAEAT 167 Qy 167 A 167 | Db 168 A 168 Reference SEQ ID NO: 6 against instant SEQ ID NO: 17 US-17-250-117-6 (NOTE: this sequence has 1 duplicate in the database searched. See complete list at the end of this report) Sequence 6, US/17250117 Patent No. 12286649 GENERAL INFORMATION APPLICANT: The Curators of the University of Missouri APPLICANT: THELAN, Jay APPLICANT: YE, Yajin TITLE OF INVENTION: METHODS OF INCREASING SEED WEIGHT AND SEED OIL CONTENT BY TITLE OF INVENTION: MANIPULATING ALPHA-CARBOXYLTRANSFERASE (a-CT), TITLE OF INVENTION: CARBOXYLTRANSFERASE INTERACTOR 2, AND CARBOXYLTRANSFERASE TITLE OF INVENTION: INTERACTOR 3 FILE REFERENCE: 31458-39 (40451-PCT) CURRENT APPLICATION NUMBER: US/17/250,117 CURRENT FILING DATE: 2020-11-30 PRIOR APPLICATION NUMBER: US 62/678,212 PRIOR FILING DATE: 2018-05-30 NUMBER OF SEQ ID NOS: 92 SEQ ID NO 6 LENGTH: 168 TYPE: PRT ORGANISM: Arabidopsis thaliana Query Match 26.7%; Score 219.5; Length 168; Best Local Similarity 44.2%; Matches 53; Conservative 23; Mismatches 35; Indels 9; Gaps 5; Qy 53 RILTIQSAYRDDDSSGSTGLFVGGFILGGLIVGALGCVYAPQISKAIA G-ADRKDFMRKL 111 | :: : ||| |||:| |: ||:||| : ||: ::|||| ::: | | : Db 51 RKFSVSAGYRDGSRSGSSGDFIAGFLLGGAVFGAVAYIFAPQIRRSVLNEEDEYGFEKPK 110 Qy 112 PKFIYDEEKALEKTRKVLADKIAQLNSAIDDVSSQLKSEDTPNGAALS----TD-EVEAT 166 ||| |||||: | :|| |||||||:|||:|: : | ::|: || ||||| Db 111 QPTYYDE--GLEKTRETLNEKIGQLNSAIDNVSSRLRGRE-KNTSSLNVPVETDPEVEAT 167 Against instant SEQ ID NO: 43 RESULT 1 ES991977 LOCUS ES991977 547 bp mRNA linear EST 09-JUN-2009 DEFINITION BNAEN1GH_UP_074_D10_22JUL2006_074 Brassica napus BNAEN1GH Brassica napus cDNA 5', mRNA sequence. ACCESSION ES991977 VERSION ES991977.1 DBLINK BioSample: SAMN00153146 KEYWORDS EST. SOURCE Brassica napus (rape) ORGANISM Brassica napus Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica. REFERENCE 1 (bases 1 to 547) AUTHORS Huang,Y., Chen,L., Wang,L., Vijayan,K., Phan,S., Liu,Z., Wan,L., Ross,A., Xiang,D., Datla,R., Pan,Y. and Zou,J. TITLE Probing the endosperm gene expression landscape in Brassica napus JOURNAL BMC Genomics 10 (1), 256 (2009) PUBMED 19490642 COMMENT Contact: Jitao Zou National Research Council of Canada Plant Biotechnology Institute, 110 Gymnasium Place, Saskatoon, Saskatchewan, S7N 0W9, Canada Tel: 1-306-975-5248 Fax: 1-306-975-4839 Email: Jitao.Zou\@nrc-cnrc.gc.ca. FEATURES Location/Qualifiers source 1..547 /organism="Brassica napus" /mol_type="mRNA" /db_xref="taxon:3708" /clone_lib="SAMN00153146 Brassica napus BNAEN1GH" /note="Sequences have been trimmed to remove vector and low quality regions." ORIGIN Query Match 100.0%; Score 504; Length 547; Best Local Similarity 100.0%; Matches 504; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 ATGGCGGCTCTTTCGACATCTCTCTCTCTTTCCAGGAATACTCAGCAACTCCATCCTTCA 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 11 ATGGCGGCTCTTTCGACATCTCTCTCTCTTTCCAGGAATACTCAGCAACTCCATCCTTCA 70 Qy 61 TCTGGCTTTTCTCTGAAGCCAATTGGTCGTCGTGCCAACGTTTCTTTCGGGCTGAATCCC 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 71 TCTGGCTTTTCTCTGAAGCCAATTGGTCGTCGTGCCAACGTTTCTTTCGGGCTGAATCCC 130 Qy 121 TCTAAAAAGATCCAGCTTTCTGCTCCTAGTGGCAAAAGGATCCTAACCATCCAATCAGCA 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 131 TCTAAAAAGATCCAGCTTTCTGCTCCTAGTGGCAAAAGGATCCTAACCATCCAATCAGCA 190 Qy 181 TACAGAGATGATGACAGTTCAGGCAGCACTGGCCTGTTTGTGGGAGGGTTCATTTTGGGC 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 191 TACAGAGATGATGACAGTTCAGGCAGCACTGGCCTGTTTGTGGGAGGGTTCATTTTGGGC 250 Qy 241 GGGCTCATAGTCGGTGCTCTTGGATGTGTGTATGCACCACAGATCAGCAAGGCTATAGCT 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 251 GGGCTCATAGTCGGTGCTCTTGGATGTGTGTATGCACCACAGATCAGCAAGGCTATAGCT 310 Qy 301 GGAGCAGACCGAAAGGATTTCATGAGGAAATTGCCTAAGTTCATATATGATGAGGAAAAA 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 311 GGAGCAGACCGAAAGGATTTCATGAGGAAATTGCCTAAGTTCATATATGATGAGGAAAAA 370 Qy 361 GCTTTGGAGAAAACTCGCAAGGTATTGGCTGACAAAATTGCTCAGCTCAACTCTGCTATC 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 371 GCTTTGGAGAAAACTCGCAAGGTATTGGCTGACAAAATTGCTCAGCTCAACTCTGCTATC 430 Qy 421 GACGATGTGTCCTCTCAGCTAAAATCAGAAGACACCCCTAATGGTGCAGCTCTAAGCACC 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 431 GACGATGTGTCCTCTCAGCTAAAATCAGAAGACACCCCTAATGGTGCAGCTCTAAGCACC 490 Qy 481 GATGAAGTCGAGGCTACAGCCTGA 504 |||||||||||||||||||||||| Db 491 GATGAAGTCGAGGCTACAGCCTGA 514 RESULT 38 ES937854 LOCUS ES937854 590 bp mRNA linear EST 05-JUL-2007 DEFINITION 46RDOAG_UP_056_C03_01FEB2006_027 Brassica oleracea 46RDOAG Brassica oleracea cDNA 5', mRNA sequence. ACCESSION ES937854 VERSION ES937854.1 DBLINK BioSample: SAMN00153111 KEYWORDS EST. SOURCE Brassica oleracea (wild cabbage) ORGANISM Brassica oleracea Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica. REFERENCE 1 (bases 1 to 590) AUTHORS Xiang,D., Venglat,P., Keller,G., Selvaraj,G. and Datla,R. TITLE Gene Expression Patterns during Brassica Zygotic Embryogenesis JOURNAL Unpublished COMMENT Contact: Raju Datla Molecular and Developmental Genetics National Research Council of Canada Plant Biotechnology Institute, 110 Gymnasium Place, Saskatoon, Saskatchewan, S7N 0W9, Canada Tel: 306 975 5248 Fax: 306 975 4839 Email: Raju.Datla\@nrc-cnrc.gc.ca. FEATURES Location/Qualifiers source 1..590 /organism="Brassica oleracea" /mol_type="mRNA" /db_xref="taxon:3712" /clone_lib="SAMN00153111 Brassica oleracea 46RDOAG" /note="Sequences have been trimmed to remove vector and low quality regions." ORIGIN Query Match 98.4%; Score 496; Length 590; Best Local Similarity 99.0%; Matches 499; Conservative 0; Mismatches 5; Indels 0; Gaps 0; Qy 1 ATGGCGGCTCTTTCGACATCTCTCTCTCTTTCCAGGAATACTCAGCAACTCCATCCTTCA 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 49 ATGGCGGCTCTTTCGACATCTCTCTCTCTTTCCAGGAATACTCAGCAACTCCATCCTTCA 108 Qy 61 TCTGGCTTTTCTCTGAAGCCAATTGGTCGTCGTGCCAACGTTTCTTTCGGGCTGAATCCC 120 ||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||| Db 109 TCTGGCTTTTCTCTGAAGCCAATTGCTCGTCGTGCCAACGTTTCTTTCGGGCTGAATCCC 168 Qy 121 TCTAAAAAGATCCAGCTTTCTGCTCCTAGTGGCAAAAGGATCCTAACCATCCAATCAGCA 180 ||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||| Db 169 TCTAAAAAGATCCAGCTTTCTGCTCCTAGAGGCAAAAGGATCCTAACCATCCAATCAGCA 228 Qy 181 TACAGAGATGATGACAGTTCAGGCAGCACTGGCCTGTTTGTGGGAGGGTTCATTTTGGGC 240 |||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||| Db 229 TACAGAGATGATGACAGTTCAGGCAGCACTGGCCTGTTTGTGGGGGGGTTCATTTTGGGC 288 Qy 241 GGGCTCATAGTCGGTGCTCTTGGATGTGTGTATGCACCACAGATCAGCAAGGCTATAGCT 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 289 GGGCTCATAGTCGGTGCTCTTGGATGTGTGTATGCACCACAGATCAGCAAGGCTATAGCT 348 Qy 301 GGAGCAGACCGAAAGGATTTCATGAGGAAATTGCCTAAGTTCATATATGATGAGGAAAAA 360 |||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||| Db 349 GGAGCAGACCGAAAGGATCTCATGAGGAAATTGCCTAAGTTCATATATGATGAGGAAAAA 408 Qy 361 GCTTTGGAGAAAACTCGCAAGGTATTGGCTGACAAAATTGCTCAGCTCAACTCTGCTATC 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 409 GCTTTGGAGAAAACTCGCAAGGTATTGGCTGACAAAATTGCTCAGCTCAACTCTGCTATC 468 Qy 421 GACGATGTGTCCTCTCAGCTAAAATCAGAAGACACCCCTAATGGTGCAGCTCTAAGCACC 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 469 GACGATGTGTCCTCTCAGCTAAAATCAGAAGACACCCCTAATGGTGCAGCTCTAAGCACC 528 Qy 481 GATGAAGTCGAGGCTACAGCCTGA 504 |||||||| ||||||||||||||| Db 529 GATGAAGTTGAGGCTACAGCCTGA 552 Conclusion No claim is allowed. Contact information Any inquiry concerning this communication or earlier communications from the examiner should be directed to WAYNE ZHONG whose telephone number is (571)270-0311. The examiner can normally be reached 8:30am to 5:00pm EST. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Bratislav Stankovic, can be reached on 571-270-0305. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /Wayne Zhong/ Primary Examiner, Art Unit 1662
Read full office action

Prosecution Timeline

Mar 27, 2025
Application Filed
Sep 03, 2026
Non-Final Rejection mailed — §112, §DP (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12733641
CELL DEATH INHIBITOR AND CELL DEATH INHIBITION METHOD
4y 8m to grant Granted Sep 15, 2026
Patent 12723251
MATERIALS AND METHODS FOR PUFA PRODUCTION, AND PUFA-CONTAINING COMPOSITIONS
3y 7m to grant Granted Sep 01, 2026
Patent 12716071
METHODS FOR PLANT TRANSFORMATION
5y 11m to grant Granted Aug 25, 2026
Patent 12709756
PLANT CELLS, PLANTS, AND SEEDS HAVING TARGETED ENHANCER ELEMENT INSERTIONS
3y 6m to grant Granted Aug 18, 2026
Patent 12708092
PEPPER HYBRID SVPB8161 AND PARENTS THEREOF
2y 5m to grant Granted Aug 18, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

Strategy Recommendation AI-generated — please review before filing

Get a prosecution strategy drawn from examiner precedents, rejection analysis, and claim mapping.
Typically takes 5-10 seconds — AI-generated, attorney review required before filing

Prosecution Projections

1-2
Expected OA Rounds
72%
Grant Probability
94%
With Interview (+21.5%)
2y 10m (~1y 4m remaining)
Median Time to Grant
Low
PTA Risk
Based on 544 resolved cases by this examiner. Grant probability derived from career allowance rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month