Notice of Pre-AIA or AIA Status
The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA .
Claims 1-15 are pending and being acted upon in this Office Action.
Priority
Receipt is acknowledged of papers submitted under 35 U.S.C. 119(a)-(d), which papers have been placed of record in the file.
Objection and Rejection Withdrawn
The objection to claim 2 is withdrawn in view of the claim amendment.
The rejection of claims 1-5 and 8 under 35 U.S.C. 102 (a)(1) as being anticipated by WO2013067301 (Nadarajah hereafter, published May 10, 2013; PTO 892) is withdrawn in light of the claim amendment.
The rejection of claims 1-2 and 9-11 under 35 U.S.C. 103 as being unpatentable over WO2013067301 (Nadarajah hereafter, published May 10, 2013; PTO 892) in view of Wang (US20130336957, published December 19, 2013; PTO 892) and WO2014207763 publication (Mendiratta hereafter, published Dec 31, 2014; PTO 892) is withdrawn in light of the claim amendment. The addition of Wang and Mendiratta does not cure the deficiency of Nadarajah.
The rejection of claim 12 under 35 U.S.C. 103 as being unpatentable over WO2013067301 (Nadarajah hereafter, published May 10, 2013; PTO 892) in view of Wang (US20130336957, published December 19, 2013; PTO 892) and WO2014207763 publication (Mendiratta hereafter, published Dec 31, 2014; PTO 892) as applied to claims 1-2 and 9-11 mentioned above and further in view of US20120283416 (published November 8, 2012; PTO 892) is withdrawn in light of the claim amendment. The addition of US20120283416 does not cure the deficiency of Nadarajah.
The rejection of claims 13-15 under 35 U.S.C. 103 as being unpatentable over WO2013067301 (Nadarajah hereafter, published May 10, 2013; PTO 892) in view of Wang (US20130336957, published December 19, 2013; PTO 892) and WO2014207763 publication (Mendiratta hereafter, published Dec 31, 2014; PTO 892) as applied to claims 1-2 and 9-11 mentioned above and further in view of US Patent No. 8,945,552 (issued February 3, 2015; PTO 892) is withdrawn in light of the claim amendment. The addition of the ‘552 patent does not cure the deficiency of Nadarajah.
The provisional rejection of claims 1-15 on the ground of nonstatutory obviousness-type double patenting as being unpatentable over claims 1, 6-10, 13-14, 17-18 of copending Application No. 17/335,680 is withdrawn in view of the terminal disclaimer filed on December 8, 2025.
New Ground of Rejections Necessitated by Amendment filed December 8, 2025
Double Patenting
The nonstatutory double patenting rejection is based on a judicially created doctrine grounded in public policy (a policy reflected in the statute) so as to prevent the unjustified or improper timewise extension of the “right to exclude” granted by a patent and to prevent possible harassment by multiple assignees. A nonstatutory double patenting rejection is appropriate where the claims at issue are not identical, but at least one examined application claim is not patentably distinct from the reference claim(s) because the examined application claim is either anticipated by, or would have been obvious over, the reference claim(s). See, e.g., In re Berg, 140 F.3d 1428, 46 USPQ2d 1226 (Fed. Cir. 1998); In re Goodman, 11 F.3d 1046, 29 USPQ2d 2010 (Fed. Cir. 1993); In re Longi, 759 F.2d 887, 225 USPQ 645 (Fed. Cir. 1985); In re Van Ornum, 686 F.2d 937, 214 USPQ 761 (CCPA 1982); In re Vogel, 422 F.2d 438, 164 USPQ 619 (CCPA 1970); and In re Thorington, 418 F.2d 528, 163 USPQ 644 (CCPA 1969).
A timely filed terminal disclaimer in compliance with 37 CFR 1.321(c) or 1.321(d) may be used to overcome an actual or provisional rejection based on a nonstatutory double patenting ground provided the reference application or patent either is shown to be commonly owned with this application, or claims an invention made as a result of activities undertaken within the scope of a joint research agreement. A terminal disclaimer must be signed in compliance with 37 CFR 1.321(b).
The USPTO internet Web site contains terminal disclaimer forms which may be used. Please visit http://www.uspto.gov/forms/. The filing date of the application will determine what form should be used. A web-based eTerminal Disclaimer may be filled out completely online using web-screens. An eTerminal Disclaimer that meets all requirements is auto-processed and approved immediately upon submission. For more information about eTerminal Disclaimers, refer to http://www.uspto.gov/patents/process/file/efs/guidance/eTD-info-I.jsp.
Claims 1-12 and 14 are rejected on the ground of nonstatutory obviousness-type double patenting as being unpatentable over claims 1, 6-12 and 14 of U.S. Patent No. 12,503,487 (reference). Although the conflicting claims are not identical, they are not patentably distinct from each other because the claims 1, 6-8 and 14 and the disclosure of the '487 patent teaches a method of purifying bispecific antibody comprising the step of washing the affinity chromatography column, e.g., protein A chromatography column with a low conductivity aqueous solution value of about 0.5 mS/cm or less (genus) whereas the present claims limited the conductivity value of from 0.03 to 0.35 mS/cm (species). The reference term “or less” encompasses the claimed range from “0.03 to 0.35 mS/cm. The ‘487 patent also teaches that the low conductivity aqueous solution has a conductivity value of from about 0.03 μS/cm to about 0.5 mS/cm. In one embodiment the low conductivity aqueous solution has a conductivity value of from about 0.05 μS/cm to about 0.35 mS/cm, see col. 6, lines 54-58, in particular. The low conductivity aqueous solution comprises about 0.1 mM to about 10 mM Tris.
Issued claim 1. A method of reducing content of a host cell protein in a sample including a human IgG4 or IgG1 isotype antibody and the host cell protein (aka purifying), the method comprising the steps of:
contacting a protein A chromatography material with the sample;
washing the protein A chromatography material, after the contacting step, with a low conductivity aqueous solution, wherein the low conductivity aqueous solution has a conductivity value of about 0.5 mS/cm or less, wherein the amount of the host cell protein in the sample after the washing step is reduced, wherein said host cell protein is phospholipase B-like 2 (PLBL2), and wherein the low conductivity aqueous solution is deionized water, which corresponds to instant claim 2.
6. The method according to claim 1, wherein the human IgG1 isotype antibody is an antibody against Influenza B or an antibody against VEGF-A or an antibody against CD22 or a bispecific antibody against HER3 and EGFR or an antibody against amyloid beta or an antibody against Her2 or a bispecific antibody against Ang2 and VEGF-A or a bispecific antibody against carcinoembryonic antigen (CEA) and CD3.
7. A method for producing a human IgG4 or IgG1 isotype antibody comprising the steps of:
a) cultivating a cell comprising a nucleic acid encoding a human IgG4 or IgG1 isotype antibody,
b) recovering the human IgG4 or IgG1 isotype antibody from the cell or the cultivation medium,
c) contacting the human IgG4 or IgG1 isotype antibody with a protein A chromatography material,
d) washing the protein A chromatography material, after the contacting step, with a low conductivity aqueous solution, wherein the low conductivity aqueous solution has a conductivity value of about 0.5 mS/cm or less, wherein the amount of a host cell protein in the sample after the washing step is reduced, wherein said host cell protein is phospholipase B-like 2 (PLBL2),
e) recovering the human IgG4 or IgG1 isotype antibody from the protein A chromatography material and thereby producing the human IgG4 or IgG1 isotype antibody; wherein the low conductivity aqueous solution is deionized water, which corresponds to instant claims 1, 2 and 14.
8. A method for purifying a human IgG4 or IgG1 isotype antibody from a sample comprising the steps of:
a) providing a sample comprising a human IgG4 or IgG1 isotype antibody,
b) purifying the human IgG4 or IgG1 isotype antibody with a protein A chromatography method/step, comprising contacting the sample with a protein A chromatography material and
washing the protein A chromatography material, after the contacting step, with a low conductivity aqueous solution, wherein the low conductivity aqueous solution has a conductivity value of about 0.5 mS/cm or less, wherein the amount of a host cell protein in the sample after the washing step is reduced and wherein said host cell protein is phospholipase B-like 2 (PLBL2), wherein the low conductivity aqueous solution is deionized water, which corresponds to instant claim 2.
9. The method according to claims 7 or 8, wherein the method additionally comprises washing the affinity chromatography material with a high conductivity aqueous solution and/or with a medium conductivity aqueous solution before or after washing the protein A chromatography material with low conductivity aqueous solution, which corresponds to instant claim 9.
10. The method according to claim 9, wherein the high conductivity aqueous solution has a conductivity value of about 20 mS/cm or higher, which corresponds to instant claim 10.
11. The method according to claim 9, wherein the medium conductivity aqueous solution has a conductivity value of from more than 0.5 mS/cm to less than 20 mS/cm, which corresponds to instant claim 11.
12. The method according to claim 9, wherein the high or medium conductivity aqueous solution comprises Histidine, which corresponds to instant claim 12.
14. The method according to claims 7 or 8, wherein the human IgG1 isotype antibody is an antibody against Influenza B or an antibody against VEGF-A or an antibody against CD22 or a bispecific antibody against HER3 and EGFR or an antibody against amyloid beta or an antibody against Her2 or a bispecific antibody against Ang2 and VEGF-A or a bispecific antibody against carcinoembryonic antigen (CEA) and CD3, which corresponds to instant claim 14.
Patent No.:
Rejected over Patent claims:
Low conductivity value
About 0.1 mM to about 8 mM Tris
About 0.05 to about 2 mM Potassium phosphate
pH of about 7 or higher
12503487
1, 6-11 and 14
about 0.5 mS/cm or less, col. 6, lines 54-58
About 0.1 to about 10 mM Tris, col.
Col. 7, lines 32-36
Col. 7, line 41-42
Col. 7, line 47-50
Claims 1, 2, 13 and 15 are rejected on the ground of nonstatutory obviousness-type double patenting as being unpatentable over claims 1, 6-12 and 14 of U.S. Patent No. 12,503,487 (reference) in view of the US Patent No. 8,945,552 (of record, issued February 3, 2015; PTO 892).
The teachings of the ‘487 patent have been discussed supra.
The reference above does not teach the method of producing bispecific antibody wherein the bispecific antibody comprising a) the heavy chain and the light chain of a first full length antibody that specifically binds to a first antigen; and b) the modified heavy chain and the modified light chain of a second full length antibody that specifically binds to a second antigen, wherein the constant domains CL and CH1 are replaced by each other as per claim 13, wherein the first antigen is human VEGF and the second antigen is human ANG-2 or the first antigen is human ANG-2 and the second antigen is human VEGF as per claim 14 and wherein said first antigen-binding site comprises as heavy chain variable domain (VH) the SEQ ID NO: 1, and as light chain variable domain (VL) the SEQ ID NO: 2; and said second antigen-binding site comprises as heavy chain variable domain (VH) the SEQ ID NO: 3, and as light chain variable domain (VL) the SEQ ID NO: 4 as per claim 15.
Regarding claim 13, the ‘552 patent teaches that the bispecific antibody is a full-length antibody wherein the constant domains CL and CH1 are replaced by each other, see Fig. 1 right side, in particular.
PNG
media_image1.png
421
548
media_image1.png
Greyscale
Regarding claim 15, the ‘552 patent teaches bispecific anti-VEGF/anti-ANG-2 antibody wherein the first antigen-binding site that binds to VEGF comprise as heavy chain variable domain (VH) the SEQ ID NO: 1, which is 100% identical to the claimed SEQ ID NO: 1, see Summary of the invention, reference SEQ ID NO: 1, sequence alignment below:
Query Match 100.0%; Score 676; Length 230;
Best Local Similarity 100.0%;
Matches 123; Conservative 0; Mismatches 0; Indels 0; Gaps 0;
Qy 1 EVQLVESGGGLVQPGGSLRLSCAASGYTFTNYGMNWVRQAPGKGLEWVGWINTYTGEPTY 60
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Db 1 EVQLVESGGGLVQPGGSLRLSCAASGYTFTNYGMNWVRQAPGKGLEWVGWINTYTGEPTY 60
Qy 61 AADFKRRFTFSLDTSKSTAYLQMNSLRAEDTAVYYCAKYPHYYGSSHWYFDVWGQGTLVT 120
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Db 61 AADFKRRFTFSLDTSKSTAYLQMNSLRAEDTAVYYCAKYPHYYGSSHWYFDVWGQGTLVT 120
Qy 121 VSS 123
|||
Db 121 VSS 123
and a light chain variable domain (VL) comprising SEQ ID NO: 2, which is 100% identical to the claimed SEQ ID NO: 2, see reference SEQ ID NO: 2, sequence alignment below:
Qy 1 DIQMTQSPSSLSASVGDRVTITCSASQDISNYLNWYQQKPGKAPKVLIYFTSSLHSGVPS 60
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Db 1 DIQMTQSPSSLSASVGDRVTITCSASQDISNYLNWYQQKPGKAPKVLIYFTSSLHSGVPS 60
Qy 61 RFSGSGSGTDFTLTISSLQPEDFATYYCQQYSTVPWTFGQGTKVEIK 107
|||||||||||||||||||||||||||||||||||||||||||||||
Db 61 RFSGSGSGTDFTLTISSLQPEDFATYYCQQYSTVPWTFGQGTKVEIK 107
And the second antigen binding site that binds to angiopoietin 2 (Ang2) comprises SEQ ID NO: 3, which is identical to the claimed SEQ ID NO: 3, see reference SEQ ID NO: 3, sequence alignment below:
Query Match 100.0%; Score 700; Length 128;
Best Local Similarity 100.0%;
Matches 128; Conservative 0; Mismatches 0; Indels 0; Gaps 0;
Qy 1 QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQGLEWMGWINPNSGGTNY 60
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Db 1 QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQGLEWMGWINPNSGGTNY 60
Qy 61 AQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARSPNPYYYDSSGYYYPGAFDIWG 120
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Db 61 AQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARSPNPYYYDSSGYYYPGAFDIWG 120
Qy 121 QGTMVTVS 128
||||||||
Db 121 QGTMVTVS 128
And a light chain variable domain (VL) comprises the amino acid sequence of SEQ ID NO: 4, which is 100% identical to the claimed SEQ ID NO: 4, see reference SEQ ID NO: 4, sequence alignment below:
Query Match 100.0%; Score 579; Length 110;
Best Local Similarity 100.0%;
Matches 108; Conservative 0; Mismatches 0; Indels 0; Gaps 0;
Qy 1 QPGLTQPPSVSVAPGQTARITCGGNNIGSKSVHWYQQKPGQAPVLVVYDDSDRPSGIPER 60
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Db 1 QPGLTQPPSVSVAPGQTARITCGGNNIGSKSVHWYQQKPGQAPVLVVYDDSDRPSGIPER 60
Qy 61 FSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSDHYVFGTGTKVTVL 108
||||||||||||||||||||||||||||||||||||||||||||||||
Db 61 FSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSDHYVFGTGTKVTVL 108
The ‘522 patent teaches the bispecific antibody is useful for treating cancer or suffering from vascular diseases, see col. 29-30.
In view of the combined teachings of the references, it would have been prima facie obvious to a person of ordinary skill in the art before the effective filling date of the claimed invention to have produced and purified the bispecific antibody of the ‘552 patent using the method of the ‘487 patent by substituting ‘487 patent’s bispecific antibody for the ‘552 patent’s antibody that binds to VEGF and angiopoietin 2 (Ang-2) wherein the first antigen-binding site comprises as heavy chain variable domain (VH) the SEQ ID NO: 1, and as light chain variable domain (VL) the SEQ ID NO: 2; and said second antigen-binding site comprises as heavy chain variable domain (VH) the SEQ ID NO: 3, and as light chain variable domain (VL) the SEQ ID NO: 4 with a reasonable expectation of success, e.g., removing host cell proteins contaminants.
One of ordinary skill in the art would have had a reasonable expectation of success in producing the full-length IgG bispecific antibody that binds to human VEGF and human angiopoietin 2 (Ang-2) because the ‘522 patent teaches the heavy and light chain variable regions of the bispecific antibody that binds to human VEGF and human Ang-2 and the wherein the constant domains CL and CH1 are replaced by each other to facilitate heavy and light chain pairing and Nadarajah teaches that low conductivity buffer can used to wash the affinity chromatography materials for better removal of host cells contaminants.
One of ordinary skill in the art would have been motivated to do so because the ‘522 patent teaches the bispecific antibody is useful for treating cancer or suffering from vascular diseases, see col. 29-30.
Claim Rejections - 35 USC § 112
The following is a quotation of 35 U.S.C. 112(b):
(b) CONCLUSION.—The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the inventor or a joint inventor regards as the invention.
The following is a quotation of 35 U.S.C. 112 (pre-AIA ), second paragraph:
The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the applicant regards as his invention.
Claims 8 and 10 are rejected under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter which applicant regards as the invention.
The recitation of “higher” in claims 8 and 10 is indefinite because it is not clear what would constitute “higher”, and one of ordinary skill in the art would not be reasonably apprised the metes and bounds of the of the invention.
Conclusion
No claim is allowed.
Applicant's amendment necessitated the new ground(s) of rejection presented in this Office action. Accordingly, THIS ACTION IS MADE FINAL. See MPEP § 706.07(a). Applicant is reminded of the extension of time policy as set forth in 37 CFR 1.136(a).
A shortened statutory period for reply to this final action is set to expire THREE MONTHS from the mailing date of this action. In the event a first reply is filed within TWO MONTHS of the mailing date of this final action and the advisory action is not mailed until after the end of the THREE-MONTH shortened statutory period, then the shortened statutory period will expire on the date the advisory action is mailed, and any nonprovisional extension fee (37 CFR 1.17(a)) pursuant to 37 CFR 1.136(a) will be calculated from the mailing date of the advisory action. In no event, however, will the statutory period for reply expire later than SIX MONTHS from the mailing date of this final action.
Any inquiry concerning this communication or earlier communications from the examiner should be directed to PHUONG HUYNH whose telephone number is (571)272-0846. The examiner can normally be reached on 9:00 a.m. to 6:30 p.m. The examiner can also be reached on alternate alternative Friday from 9:00 a.m. to 5:30 p.m.
If attempts to reach the examiner by telephone are unsuccessful, the examiner's supervisor, Misook Yu, can be reached at 571-270-3497. The fax phone number for the organization where this application or proceeding is assigned is 571-272-0839.
Information regarding the status of an application may be obtained from Patent Center. Status information for published applications may be obtained from Patent Center. Status information for unpublished applications is available through Patent Center for authorized users only. Should you have questions about access to Patent Center, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free).
Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) Form at https://www.uspto.gov/patents/uspto-automated- interview-request-air-form.
/PHUONG HUYNH/ Primary Examiner, Art Unit 1641