Prosecution Insights
Last updated: July 17, 2026
Application No. 17/531,200

MANAGEMENT OF CORN THROUGH SEMI-DWARF SYSTEMS

Final Rejection §103§112
Filed
Nov 19, 2021
Priority
Nov 23, 2020 — provisional 63/117,237 +5 more
Examiner
KUBELIK, ANNE R
Art Unit
1663
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Monsanto Technology LLC
OA Round
8 (Final)
76%
Grant Probability
Favorable
9-10
OA Rounds
0m
Est. Remaining
75%
With Interview

Examiner Intelligence

Grants 76% — above average
76%
Career Allowance Rate
1005 granted / 1326 resolved
+15.8% vs TC avg
Minimal -1% lift
Without
With
+-0.6%
Interview Lift
resolved cases with interview
Typical timeline
2y 8m
Avg Prosecution
41 currently pending
Career history
1375
Total Applications
across all art units

Statute-Specific Performance

§101
1.5%
-38.5% vs TC avg
§103
31.8%
-8.2% vs TC avg
§102
12.3%
-27.7% vs TC avg
§112
23.5%
-16.5% vs TC avg
Black line = Tech Center average estimate • Based on career data from 1326 resolved cases

Office Action

§103 §112
DETAILED ACTION Claims 1-5, 10, 17-23, 25-26, 31-38, and 40-44 are pending. Claims 31-32 and 34-37 are withdrawn from consideration as being drawn to nonelected species. The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Claim Rejections - 35 USC § 112 The following is a quotation of 35 U.S.C. 112(b): (B) CONCLUSION.—The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the inventor or a joint inventor regards as the invention. The following is a quotation of the second paragraph of 35 U.S.C. 112: The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the applicant regards as his invention. Claims 1-5, 10, 17-23, 25-26, 33, 38, and 40-44 are rejected under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter that the inventor or a joint inventor, or for pre-AIA the applicant, regards as the invention. Dependent claims are included in all rejections. Due to Applicant’s amendment of the claims, the rejection is modified from the rejection set forth in the Office action mailed 13 February 2026, applied to claims 1-5, 10, 17-26, 33, 38, and 40-42. Applicant’s arguments filed 28 April 2026 have been fully considered but they are not persuasive. The phrase “reduced by at least 30 % relative to control plants that do not comprise the recombinant DNA construct” in claim 1 is a relative term that renders the claims indefinite. The phrase is not defined by the claim, the specification does not provide a standard for ascertaining the requisite degree, and one of ordinary skill in the art would not be reasonably apprised of the scope of the invention. Although the height is compared to control plants that do not comprise the recombinant DNA construct, the height of plants comprising a dominant or semi-dominant transgene encoding a GA2 oxidase expressed from a plant promoter is affected by the environmental conditions under which a plant is grown. Depending on the year the plants are grown, the average height difference between the transgenic and control plant can vary by as much as about 20 cm (Chen et al, 2019, Transgenic Res. 28:589-599; see Table 1, transgenic line #4+ and control line #4-). This shows the height of the plants is dependent upon the environmental conditions under which the plants are growing. Thus, the phrase is a relative term that renders the claims indefinite. Additionally, the claims do not require that control plants be grown in the field to which the agricultural composition is applied. Without that, one would not know in any given year by what percent the height of the plants is reduced relative to a control plant. Response to Arguments Applicant urges that the claims no longer recites that the plants are grown in the same environmental conditions, eliminating the concern regarding variability in height reduction relative to control plants under different environmental conditions by specifying an absolute hsight measurement at later growth stages. This is not found persuasive. Not comparing them to plants grown in the same environmental conditions does not change the fact that the average height difference between plants transformed with a construct encoding a GA2 oxidase and control plants not so transformed varies due to environmental conditions. Chen et al show that the average height difference between corn plant transformed with a construct encoding a GA2 oxidase and control plants not so transformed varies due to year grown, i.e., environmental conditions (Table 1). For example, the average height of mature transgenic line #4+ is only 4.4% less than the average height of mature control line #4- in season 1, but it is 16.5% shorter than the control in season 2. Someone applying an agricultural composition as recited in the claimed method but to plants that have a stature or height that is reduced by less than 30 % relative to control plant would appear to outside the scope of the claims and would not be infringing. However, since the average height difference between transformed and control corn plants is affected by environmental conditions, that person may infringe solely as a result of the environmental conditions of a given growing year; thus, that person would have no way of knowing if they would be infringing at the time of planting. The following is a quotation of 35 U.S.C. 112(a): (a) IN GENERAL.—The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor or joint inventor of carrying out the invention. The following is a quotation of 35 U.S.C. 112 (pre-AIA ), first paragraph: The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same and shall set forth the best mode contemplated by the inventor of carrying out his invention. Claims 1-5, 10, 17-23, 25-26, 33, 38, and 40-44 are rejected under 35 U.S.C. 112(a) or 35 U.S.C. 112 (pre-AIA ), first paragraph, as failing to comply with the written description requirement. The claims contain subject matter that was not described in the specification in such a way as to reasonably convey to one skilled in the relevant art that the inventor or a joint inventor, or for pre-AIA the inventor(s), at the time the application was filed, had possession of the claimed invention. The rejection is modified from the rejection set forth in the Office action mailed Office action mailed 13 February 2026, applied to claims 1-5, 10, 17-26, 33, 38, and 40-42. Applicant’s arguments filed 28 April 2026 have been fully considered but they are not persuasive. The claimed methods require corn plants at the V12, V13, V14, V15, V16 or R1 stage and that comprise a dominant or semi-dominant transgene encoding a maize GA2 oxidase expressed from a plant promoter, where the corn plants have a height that is reduced by at least 30% relative to control plants that do not comprise the transgene. The specification describes no plants that comprise a dominant or semi-dominant transgene encoding a maize GA2 oxidase expressed from a plant promoter, where the corn plants have a height that is reduced by at least 30% relative to control plants that do not comprise the transgene. The specification describes no plants over the full scope of claimed maize GA2 oxidases. Newly added Example 4 describes transformation vectors for expression of the instant SEQ ID NOs:327, 329 and 341 from the RTBV promoter. WO 2022/133460, which claims priority to two of the same provisional applications to which the instant application claims priority (63/125,752 and 63/180,344), demonstrates that plants comprising these transformation vectors have a height that is reduced by at least 30% relative to control plants that do not comprise the transgene at the V5 and V9 stages (Tables 18 and 19). However, none of these plants have an average height that represents the full range required by the claims, up to 1.6 meters at the V12, V13, V14, V15, V16 and R1 stage. The full scope of plants with an average height of less than or equal to 1.6 meters at the V12, V13, V14, V15, V16 and R1 encompasses plants that an average height less than 10 cm, a height that none of the plants in Tables 18 and 19 had at the earlier V9 stage. As plant height doubled between V5 and B9 stages for all these plants, none would have a height at the lower end of the claimed height at the V12, V13, V14, V15, V16 and R1 stage, much less the full scope of the claimed height range. Further, only one event had an average height that is reduced by at least 30% relative to control plants that do not comprise the transgene at the V5 and V9 stage when the plants were hemizygous (Table 19). Only claim 21 limits the promoter to the RTBV promoter. The specification describes no plants expressing claimed maize GA2 oxidases from other promoters, where the plants have a height that is reduced by at least 30% relative to control plants that do not comprise the transgene. Further, the height of plants that comprise a dominant or semi-dominant transgene encoding a GA2 oxidase expressed from a plant promoter is dependent upon the environmental conditions under which the plants are growing. Depending on the year the plants are grown, the average height difference between the transgenic and control plant can vary by as much as about 20 cm (Chen et al, 2019, Transgenic Res. 28:589-599; see Table 1, transgenic line #4+ and control line #4-). Because height reduced maize plants transformed with nucleic acids encoding the claimed maize GA2 oxidases are not described over the full scope of the claims, the claimed methods of providing an agricultural composition to the plants are likewise not described, and the specification fails to provide an adequate written description of the claimed invention. Therefore, given the lack of written description in the specification with regard to the structural and functional characteristics of the compositions used in the claimed methods, Applicant does not appear to have been in possession of the claimed genus at the time this application was filed. Response to Arguments Applicant urges that the amended claims delete the limitation requiring height "reduced by at least 30% relative to control plants” and instead require that the plants have an average height of less than or equal to 1.6 meters at the V12-R1 stages (response pg 11). This is not found persuasive. Claim 1 recites “wherein the at least 95% of said plurality of corn plants have a stature or height that is reduced by at least 30 % relative to control plants that do not comprise the recombinant DNA construct” in lines 14-15. Applicant points to support for the amendment to recite the claimed average height. The examiner thanks Applicant for pointing to support for the amendment. However, Applicant has not provided evidence of possession of the full scope of plants with an average height of less than or equal to 1.6 meters at the V12, V13, V14, V15, V16 and R1. Claim Rejections - 35 USC § 103 The following is a quotation of 35 U.S.C. 103 which forms the basis for all obviousness rejections set forth in this Office action: A patent for a claimed invention may not be obtained, notwithstanding that the claimed invention is not identically disclosed as set forth in section 102, if the differences between the claimed invention and the prior art are such that the claimed invention as a whole would have been obvious before the effective filing date of the claimed invention to a person having ordinary skill in the art to which the claimed invention pertains. Patentability shall not be negated by the manner in which the invention was made. Claims 1-5, 10, 17-23, 25-26, 33, 38, and 40-42 are rejected under 35 U.S.C. 103(a) as being unpatentable over Barten et al (US 2019/0246619, published 15 August 2019) in view of Chen et al (8 October 2019, Transgenic Res. 28:589-599), Inze et al (US 2014/0344996) and Gou et al (2011, New Phytologist doi: 10.1111/j.1469-8137.2011.03837). The rejection is repeated for the reasons of record as set forth in the Office action mailed 13 February 2026, applied to claims 1-5, 10, 17-26, 33, 38, and 40-42. Applicant’s arguments filed 28 April 2026 have been fully considered but they are not persuasive. The claims are drawn to a method of providing an agricultural composition to a corn field comprising applying said agricultural composition on said corn field from above using a ground-based agricultural vehicle comprising an applicator for applying said agricultural composition, wherein the corn plants of said corn field comprise an average height less than 1.6 meters, wherein at least 95% of said corn plants are at V12, V13, V14, V15, V16, or R1 stage, wherein the corn plants have a height that is reduced by at least 30% relative to control plants that do not comprise the transgene, and wherein said corn plants comprise a dominant or semi-dominant transgene that encodes a GA2 oxidase encoded by SEQ ID NO:325 or 345 and causes a short stature phenotype in the one corn plants. Barten et al teach a method comprising applying an agriculture composition like water, a fertilizer, a pesticide, an insecticide, an herbicide, a fungicide, and/or cover crop seed to a corn field from above using a ground-based agricultural vehicle comprising an applicator for applying the agricultural composition, where at least 90% of said corn plants within said corn field are not damaged by the applicator, where the applicator of the ground-based agricultural vehicle is at a height above ground of 1.8 meters or less, and where at least 90% of the corn plants are at V12, V13, V14, V15, V16, or R1 stage (¶54-64). The ground-based agricultural vehicle comprises a main body, and where the applicator is attached to the main body, where the lower exterior surface of the main body is at a height above soil level of 1.8 meters or less and is equal to or less than 15 centimeters shorter than average height of said corn plant (¶7, 54-65). The corn plants are not damaged by said ground-based agricultural vehicle when their height is equal to or less than 1.8 meters (¶8). The corn plants are not damaged by the applicator when they are at the V12, V13, V14, V15, V16, or R1 stage and are 1.8 meters tall or even much shorter (¶68). Barten et al also teach the method where at least 90% of the corn plants at the V12, V13, V14, V15, V16, or R1 stage and at least 95% of the corn plants are less than full height (¶39; 53-60; 63-64); these plants would have a height that is 30% of that of control plants Barten et al also teach the method where the plants are dwarf because they have the Br2 allele; these plants include those that have a height that is reduced by least 30% compared to control plants (¶212). Barten et al teach that an applicator comprises an applicator arm or boom (¶218) and use of the method in a corn field with a planting density of at least 10,000 corn plants per acre (¶30). Barten et al also teach positioning the lower surface of the applicator is at least one centimeter higher than the average height of said corn plants (¶222). Barten et al teach hybrid semi-dwarf corn plants comprising a GA20 oxidase suppression construct (SUP_GA20 oxidase) expressed from the RTBV promoter (¶423), which is a vascular promoter (¶165). Barten et al teach that the sequence of the RTBV promoter is their SEQ ID NO:39, which has 100% identity to the instant SEQ ID NO:656: US-16-276-617-39 Filing date in PALM: 2019-02-15 Sequence 39, US/16276617 Publication No. US20190246619A1 GENERAL INFORMATION APPLICANT: MONSANTO TECHNOLOGY LLC TITLE OF INVENTION: IMPROVED MANAGEMENT OF CORN THROUGH SEMI-DWARF SYSTEMS FILE REFERENCE: P34578US00/0016518.00361 CURRENT APPLICATION NUMBER: US/16/276,617 CURRENT FILING DATE: 2019-02-15 PRIOR APPLICATION NUMBER: US 62/631,181 PRIOR FILING DATE: 2018-02-15 PRIOR APPLICATION NUMBER: US 62/775,346 PRIOR FILING DATE: 2018-12-0nfcdrt54y774 NUMBER OF SEQ ID NOS: 131 SEQ ID NO 39 LENGTH: 726 TYPE: DNA ORGANISM: Rice tungro bacilliform virus ALIGNMENT: Query Match 100.0%; Score 726; Length 726; Best Local Similarity 100.0%; Matches 726; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 TCCTACAAAAGGGAGTAGTAATATTTAATGAGCTTGAAGGAGGATATCAACTCTCTCCAA 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 TCCTACAAAAGGGAGTAGTAATATTTAATGAGCTTGAAGGAGGATATCAACTCTCTCCAA 60 Qy 61 GGTTTATTGGAGACCTTTATGCTCATGGTTTTATTAAACAAATAAACTTCACAACCAAGG 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 GGTTTATTGGAGACCTTTATGCTCATGGTTTTATTAAACAAATAAACTTCACAACCAAGG 120 Qy 121 TTCCTGAAGGGCTACCGCCAATCATAGCGGAAAAACTTCAAGACTATAAGTTCCCTGGAT 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 TTCCTGAAGGGCTACCGCCAATCATAGCGGAAAAACTTCAAGACTATAAGTTCCCTGGAT 180 Qy 181 CAAATACCGTCTTAATAGAACGAGAGATTCCTCGCTGGAACTTCAATGAAATGAAAAGAG 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 CAAATACCGTCTTAATAGAACGAGAGATTCCTCGCTGGAACTTCAATGAAATGAAAAGAG 240 Qy 241 AAACACAGATGAGGACCAACTTATATATCTTCAAGAATTATCGCTGTTTCTATGGCTATT 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 AAACACAGATGAGGACCAACTTATATATCTTCAAGAATTATCGCTGTTTCTATGGCTATT 300 Qy 301 CACCATTAAGGCCATACGAACCTATAACTCCTGAAGAATTTGGGTTTGATTACTACAGTT 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 CACCATTAAGGCCATACGAACCTATAACTCCTGAAGAATTTGGGTTTGATTACTACAGTT 360 Qy 361 GGGAAAATATGGTTGATGAAGACGAAGGAGAAGTTGTATACATCTCCAAGTATACTAAGA 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 GGGAAAATATGGTTGATGAAGACGAAGGAGAAGTTGTATACATCTCCAAGTATACTAAGA 420 Qy 421 TTATCAAAGTCACTAAAGAGCATGCATGGGCTTGGCCAGAACATGATGGAGACACAATGT 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 TTATCAAAGTCACTAAAGAGCATGCATGGGCTTGGCCAGAACATGATGGAGACACAATGT 480 Qy 481 CCTGCACCACATCAATAGAAGATGAATGGATCCATCGTATGGACAATGCTTAAAGAAGCT 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 481 CCTGCACCACATCAATAGAAGATGAATGGATCCATCGTATGGACAATGCTTAAAGAAGCT 540 Qy 541 TTATCAAAAGCAACTTTAAGTACGAATCAATAAAGAAGGACCAGAAGATATAAAGCGGGA 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 541 TTATCAAAAGCAACTTTAAGTACGAATCAATAAAGAAGGACCAGAAGATATAAAGCGGGA 600 Qy 601 ACATCTTCACATGCTACCACATGGCTAGCATCTTTACTTTAGCATCTCTATTATTGTAAG 660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 601 ACATCTTCACATGCTACCACATGGCTAGCATCTTTACTTTAGCATCTCTATTATTGTAAG 660 Qy 661 AGTGTATAATGACCAGTGTGCCCCTGGACTCCAGTATATAAGGAGCACCAGAGTAGTGTA 720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 661 AGTGTATAATGACCAGTGTGCCCCTGGACTCCAGTATATAAGGAGCACCAGAGTAGTGTA 720 Qy 721 ATAGAT 726 |||||| Db 721 ATAGAT 726 At V12 the plants had an average height of 1.53 feet (Table 3); based on statement that these plants at V11 had an average height of 5 feet or 1.52 meters (¶424) and at R1 ranged in height from 4.12 feet (1.26 meters) to 5.37 feet (1.64 meters) (¶428), the units in Table 3 are probably actually meters. At V8 the plants averaged 0.71 feet (again, probably meters, Table 3). Barten et al do not teach the method where the semi-dwarf corn plants are transformed with a construct encoding a GA2 oxidase. Chen et al teach inbred HiII maize plants transformed with a construct comprising the ubiquitin promoter operably linked to a DNA encoding the AtGA2ox1 GA2 oxidase (AT1g78440) (pg 591, left column, ¶3, to right column, ¶2). Chen et al isolated a cDNA encoding AtGA2ox1 from Arabidopsis ecotype Columbia using primers that match to the first and last codons of the coding region of the cDNA (pg 590, right column, ¶3, to pg 591, left column, ¶2). Chen et al’s plants have bioactive GA levels that are lower than those in unmodified plants (pg 593, right column). The plants in Table 1 are at what appears to be maturity, as the table also lists maturity traits like yield; at this stage, which is after R1, they are less than 1.8 meters tall, with many less than 1.6 meters tall (Table 1). The plants used to produce the data in Table 1 were F1 hybrid plants (Table 1 legend); thus, the transgene encoding the GA2 oxidase was dominant. These plants have increased yield (pg 597, left column, ¶1) and yield-effective traits, including increased chlorophyll content and a greater root/shoot ratio (pg 597, left column, ¶2). Chen et al teach that corn plants transformed with a construct comprising a nucleic acid encoding the AtGA2ox1 GA2 oxidase have an increased relative stem cell density, which is a trait aiding lodging resistance (pg 596, left column). Gou et al teach that popular plants transformed with a construct encoding a popular GA2 oxidase were shorter than those transformed with a construct encoding a bean GA2 oxidase (paragraph spanning the columns on pg 4). Inze et al teach two Zea mays GA2 oxidases, their SEQ ID NOs:8 and 10, which are encoded by their SEQ ID NOs:7 and 9, respectively (¶42). Inze et al’s SEQ ID NO:8 is a protein that is two amino acids shorter than the instant SEQ ID NO:325; it has 99.4% identity to SEQ ID NO:325: US-14-345-227-8 Filing date in PALM: 2014-07-09 Sequence 8, US/14345227 Publication No. US20140344996A1 GENERAL INFORMATION APPLICANT: VIB VZW APPLICANT: UNIVERSITEIT GENT TITLE OF INVENTION: Methods and means to produce abiotic stress tolerant plants FILE REFERENCE: DI/GIBB/387 CURRENT APPLICATION NUMBER: US/14/345,227 CURRENT FILING DATE: 2014-03-14 PRIOR APPLICATION NUMBER: US 61/627,033 PRIOR FILING DATE: 2011-09-16 PRIOR APPLICATION NUMBER: GB 1116129.6 PRIOR FILING DATE: 2011-09-19 NUMBER OF SEQ ID NOS: 10 SEQ ID NO 8 LENGTH: 366 TYPE: PRT ORGANISM: Zea mays Query Match 99.4%; Score 1448; Length 366; Best Local Similarity 100.0%; Matches 276; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MVVPSTTPVVRQETPPPSHDGIGIPTVDLSAPGGRGALSRQVARACAQHGFFRAVNHGVA 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MVVPSTTPVVRQETPPPSHDGIGIPTVDLSAPGGRGALSRQVARACAQHGFFRAVNHGVA 60 Qy 61 PGPAARLDAAARTFFALAPHNKQRAGPPSPLGYGCRSIGFNGDAGELEYLLLHANPAAVA 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 PGPAARLDAAARTFFALAPHNKQRAGPPSPLGYGCRSIGFNGDAGELEYLLLHANPAAVA 120 Qy 121 HRARSIDTDDPSRFSNVVNEYVGAMRQLACEILDLLGEGLGLKDPRSFSRLIADTDSDSL 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 HRARSIDTDDPSRFSNVVNEYVGAMRQLACEILDLLGEGLGLKDPRSFSRLIADTDSDSL 180 Qy 181 LRINHYPPPCAIHKLDHDSQCRMKNSFRIVAGNGANQSAGARIGFGEHSDPQILSLLRSN 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 LRINHYPPPCAIHKLDHDSQCRMKNSFRIVAGNGANQSAGARIGFGEHSDPQILSLLRSN 240 Qy 241 DVDGLQVLLNSDGREVWVQVPADPSAFFVNVGDLLQ 276 |||||||||||||||||||||||||||||||||||| Db 241 DVDGLQVLLNSDGREVWVQVPADPSAFFVNVGDLLQ 276 Inze et al’s SEQ ID NO:10 has 100% identity to SEQ ID NO:345: US-14-345-227-10 Sequence 10, US/14345227 Publication No. US20140344996A1 GENERAL INFORMATION APPLICANT: VIB VZW APPLICANT: UNIVERSITEIT GENT TITLE OF INVENTION: Methods and means to produce abiotic stress tolerant plants FILE REFERENCE: DI/GIBB/387 CURRENT APPLICATION NUMBER: US/14/345,227 CURRENT FILING DATE: 2014-03-14 PRIOR APPLICATION NUMBER: US 61/627,033 PRIOR FILING DATE: 2011-09-16 PRIOR APPLICATION NUMBER: GB 1116129.6 PRIOR FILING DATE: 2011-09-19 NUMBER OF SEQ ID NOS: 10 SEQ ID NO 10 LENGTH: 371 TYPE: PRT ORGANISM: Zea mays Query Match 100.0%; Score 1928; Length 371; Best Local Similarity 100.0%; Matches 371; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MVVPSTTPVVRQQTTPPQSSHAGGIPTVDLSAHGGRGALSRQVVRACAEHGFFRAVNHGV 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MVVPSTTPVVRQQTTPPQSSHAGGIPTVDLSAHGGRGALSRQVVRACAEHGFFRAVNHGV 60 Qy 61 PPGPAARLDAAARTFFALAPRDKQRAGPPSPLGYGCRSIGFNGDAGELEYLLLHANNPAA 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 PPGPAARLDAAARTFFALAPRDKQRAGPPSPLGYGCRSIGFNGDAGELEYLLLHANNPAA 120 Qy 121 VAHRARAIDAEEPSRFSNVVNEYVGAMRQLACEILDLLGEGLGLEDPRSFSKLITDTDSD 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 VAHRARAIDAEEPSRFSNVVNEYVGAMRQLACEILDLLGEGLGLEDPRSFSKLITDTDSD 180 Qy 181 SLLRINHYPTACNAHNLDHDSQCKMKSSVRTKTTSNGVKPSAGGRVGFGEHSDPQILSLL 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 SLLRINHYPTACNAHNLDHDSQCKMKSSVRTKTTSNGVKPSAGGRVGFGEHSDPQILSLL 240 Qy 241 RANDVDGLQVLLNADGKEVWVQVPADQSAFFVNVGDLLQALTNGKLVSVRHRVIASSSRA 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 RANDVDGLQVLLNADGKEVWVQVPADQSAFFVNVGDLLQALTNGKLVSVRHRVIASSSRA 300 Qy 301 RLSTIYFAAPPLHARILALAETITANAPSQYRPFTWAEYKKTMYSLRLSHSRLNLFHIDH 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 RLSTIYFAAPPLHARILALAETITANAPSQYRPFTWAEYKKTMYSLRLSHSRLNLFHIDH 360 Qy 361 DGHSNVGEGEE 371 ||||||||||| Db 361 DGHSNVGEGEE 371 Before the effective filing date of the claimed invention, it would have been obvious to one of ordinary skill in the art to substitute one of the Z. mays GA2 oxidases taught by Inze et al for the Arabidopsis GA2 oxidase in Chen et al’s the corn plants. One of ordinary skill in the art would have been motivated to do so because Gou et al teach that overexpressing a native GA2 oxidase in plants results in shorter plants than expressing a GA2 oxidase from a different plant species does (Gou et al, paragraph spanning the columns on pg 4). One of ordinary skill in the art would expect that corn plants transformed with a nucleic acid encoding a Z. mays GA2 oxidase to be even shorter semi-dwarf corn plants than corn plants transformed with nucleic acid encoding an Arabidopsis GA2 oxidase were. Before the effective filing date of the claimed invention, it would have been obvious to one of ordinary skill in the art to modify the methods of applying an agriculture composition taught in Barten et al to use the Z. mays GA2 oxidase-transformed semi-dwarf corn plants as the corn plants. One of ordinary skill in the art would have been motivated to do so because they would expect that these even shorter semi-dwarf corn plants to be even more suitable for use in Barton et al’s method, as their shorter height would make it easier to avoid damage during application of the agricultural composition. Further, as Chen et al’s plants have increased yield when they mature (pg 597, left column, ¶1), one of ordinary skill in the art would have expected the Z. mays GA2 oxidase-transformed semi-dwarf corn plants to also have increased yield, thus being attractive to farmers interested in selling that yield. It would have been obvious to one of ordinary skill in the art to use the vascular RTBV promoter, which has 100% identity to the instant SEQ ID NO:656 and which Barten et al used in their constructs (¶423), to express the Z. mays GA2 oxidase in corn plants because Chen et al teach the main effect of ectopic expression of the GA2 oxidase in corn plants was in stem tissues, especially the vascular xylem and phloem tissue (pg 594, left column, ¶2). One of ordinary skill in the art would have expected the same with Z. mays GA2 oxidase-transformed semi-dwarf corn plants and wanted overexpression of the GA2 oxidase to be in the tissues most affected. The RTBV promoter of SEQ ID NO:656 is one such promoter that targets expression to vascular tissues. It would have been obvious to one of ordinary skill in the art to select for transformants that that have a height that is reduced by least 30% compared to control plants. One of ordinary skill in the art would have been motivated to do so because Barten et al teach that it is desirable to use such plants in the method (¶212). Chen et al teach that the average height difference between their transgenic and control plant can vary by as much as about 20 cm (Table 1, transgenic line #4+ and control line #4-). Chen et al also teach that the variation in height reduction from one transgenic plant to another is the result of the genomic site into which the transgene was inserted (pg 596, right column, paragraph 2). One of ordinary skill in the art would have expected the same for the Z. mays GA2 oxidase-transformed semi-dwarf corn plants and have wanted to select for transformants that had a maximal reduction in height compared to control plants to be sure that environmental effects did not alter transformant growth such that the plants were too tall to be used in the method. Selecting for plants that have a 30% reduction compared to control plants under some conditions would ensure the plants would be short enough to not be damaged by the applicator when growing under conditions that result in the plants having a less than a 30% reduction compared to control plants. One of ordinary skill in the art would have wanted to plant seeds in which 95% or more of the plants had this growth reduction (and thus the transgene) relative to control plants to ensure that the maximum number of plants are not damaged by the machine applying the agricultural composition, i.e., that 95% or more of the plants are not damaged, as damage would reduce profits. As corn plants transformed with a construct comprising a nucleic acid encoding the GA2 oxidase of the instant SEQ ID NO:325 or 345 would have bioactive GA levels that are lower than those in unmodified plants, as Chen et al saw for their plants (pg 593, right column), corn plants transformed with a construct comprising the vascular RTBV promoter of the instant SEQ ID NO:656 operably linked to a nucleic acid encoding the GA2 oxidase of SEQ ID NO: 325 or 345 would have lower bioactive GA levels in at least one internode tissue of the stem or stalk of the modified corn plant is lower than the same internode tissue of an unmodified control plant. Response to Arguments Applicant urges that Barton teaches semi-dwarf maize plants generated by suppression of GA20 oxidase genes, not plants comprising a GA2 oxidase transgene; Chen teaches corn plants transformed with an Arabidopsis AtGA2ox1 expressed from the ubiquitin promoter, not the maize GA2 oxidase sequences recited in the claims; Inze does not teach or suggest corn plants transformed with these sequences having the specific phenotypic characteristic of an average height of 1.6 meters or less at V12-R1 stages; and Gou studied poplar plants not corn and provides no teaching of corn plant heights (response pg 14-15). This is not found persuasive because this is not an anticipation rejection or an obviousness rejection based on a single reference; this is a rejection based on a combination of references. Applicant urges that the reliance on Gou for motivation to use a native GA2 oxidase is misplaced because (1) Gou's findings in poplar cannot be extrapolated to corn without evidence, and (2) Gou does not teach or suggest the specific height limitation now recited in the amended claims (response pg 15). This is not found persuasive. Applicant has not explained why Gou's findings in poplar cannot be extrapolated to corn; an insistence on evidence amounts to requiring that the prior art anticipate plants used in the claimed method. One of ordinary skill in the art would have a reasonable expectation that Gou’s teaching that plants transformed with a native GA2 oxidase were shorter than plants transformed with a nonnative GA2 oxidase would apply to other plants, including corn. Applicant’s insistence that the rejection is not valid because Gou does not teach or suggest the recited height limitation also amounts to an insistence on requiring that the prior art anticipate plants used in the claimed method. This is not the standard of obviousness. Applicant urges that the prior art does not teach or suggest corn plants comprising a maize GA2 oxidase transgene with an average height of 1.6 meters or less at the recited stages; the amended claims require a specific combination of genetic modification (maize GA2 oxidase transgene) and phenotypic characteristics (average height meters at the recited stages) that is not disclosed, taught, or suggested by any of the cited documents (response pg 15). This is not found persuasive. Chen’s corn plants, which were transformed with a construct comprising a nucleic acid encoding the AtGA2ox1 GA2 oxidase, were less than 1.6 meters at maturity, which is later than the recited stages (Table 1). As maize plants do not shrink as they mature, at the instantly recited stages, Chen’s plants would have been even less than 1.6 meters tall. Maize plants comprising a GA2 oxidase transgene are made obvious by Chen, Guo and Inze. As Chen’s plants had the recited average height at later growth stages, one of ordinary skill in the art would expect that the GA2 oxidase transgene comprising maize plants comprising made obvious by Chen, Guo and Inze would also be less than 1.6 meters at the recited stages. One of ordinary skill in the art would even expect that they would be less than Chen’s plants, given Gou’s teach that plants transformed with a native GA2 oxidase were shorter than plants transformed with a nonnative GA2 oxidase. Applicant urges that the amended claims do not recite the limitation "at least 30% height reduction"; they instead require an absolute height measurement (<1.6 meters at the recited stages) that represents a specific combination of growth stage and height limitation that is not taught or suggested by the prior art (response pg 15). This is not found persuasive. First, claim 1 recites “wherein the at least 95% of said plurality of corn plants have a stature or height that is reduced by at least 30 % relative to control plants that do not comprise the recombinant DNA construct” in lines 14-15. Second, all of Chen’s corn plants, which were transformed with a construct comprising a nucleic acid encoding the AtGA2ox1 GA2 oxidase, were less than 1.6 meters at maturity, which is later than the recited stages (Table 1). Applicant urges that WO 2022/133460 (Exhibit 2) demonstrates unexpected results in that corn plants transformed with the claimed maize GA2 oxidase transgenes exhibit plant heights within the claimed range at late vegetative and reproductive stages because in ¶321-322 it discloses late vegetative modified corn plants with various heights between 1000 mm and 1600 mm; this level of height reduction at the growth stages using a maize GA2 oxidase transgene is not predictable from the prior art, which does not teach this specific combination of transgene and phenotype (response pg 15-16). This is not found persuasive. ¶321-322 of WO 2022/133460 are not data; they are recitations of embodiments. Applicant has not provided any evidence of unexpected results, as Chen et al already teaches that corn plants transformed with a construct encoding GA2 oxidase were less than 1.6 meters at even later growth stages than recited in the claims. In light of that, Applicant has not explained why the claimed height of corn plants transformed with a construct encoding a maize GA2 oxidase would be unexpected. Applicant is reminded that evidence submitted after final will not be considered unless Applicant provides a showing of good and sufficient reasons of why they were necessary and not earlier presented. Claims 1-5, 10, 17-23, 25-26, 33, 38, and 40-44 are rejected under 35 U.S.C. 103(a) as being unpatentable over Barten et al (US 2019/0246619, published 15 August 2019) in view of Chen et al (8 October 2019, Transgenic Res. 28:589-599), Ware (2017, GenBank ONM37784, https://www.ncbi.nlm.nih.gov/protein/ONM37784) and Gou et al (2011, New Phytologist doi: 10.1111/j.1469-8137.2011.03837). The claims are drawn to a method of providing an agricultural composition to a corn field comprising applying said agricultural composition on said corn field from above using a ground-based agricultural vehicle comprising an applicator for applying said agricultural composition, wherein the corn plants of said corn field comprise an average height less than 1.6 meters, wherein at least 95% of said corn plants are at V12, V13, V14, V15, V16, or R1 stage, wherein the corn plants have a height that is reduced by at least 30% relative to control plants that do not comprise the transgene, and wherein said corn plants comprise a dominant or semi-dominant transgene that encodes a GA2 oxidase encoded by SEQ ID NO:325 or 345 and causes a short stature phenotype in the one corn plants. The teachings of Barten et al are discussed above. Barten et al do not teach the method where the semi-dwarf corn plants are transformed with a construct encoding a maize GA2 oxidase of SEQ ID NO:329. The teachings of Chen et al are discussed above. The teachings of Gou et al are discussed above. Ware teaches a Zea mays GA2 oxidase with 100% identity to SEQ ID NO:329: A0A1D6NB68_MAIZE ID A0A1D6NB68_MAIZE Unreviewed; 331 AA. AC A0A1D6NB68; DT 30-NOV-2016, integrated into UniProtKB/TrEMBL. DT 30-NOV-2016, sequence version 1. DT 28-JAN-2026, entry version 48. DE RecName: Full=gibberellin 2beta-dioxygenase {ECO:0000256|ARBA:ARBA00066708}; DE EC=1.14.11.13 {ECO:0000256|ARBA:ARBA00066708}; GN Name=LOC103651195 {ECO:0000313|EnsemblPlants:Zm00001eb152710_P001}; GN ORFNames=ZEAMMB73_Zm00001d043411 {ECO:0000313|EMBL:ONM37784.1}; OS Zea mays (Maize). OC Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; OC Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; PACMAD clade; OC Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea. OX NCBI_TaxID=4577 {ECO:0000313|EMBL:ONM37784.1}; RN [1] {ECO:0000313|EMBL:ONM37784.1, ECO:0000313|Proteomes:UP000007305} RP NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. RC STRAIN=cv. B73 {ECO:0000313|Proteomes:UP000007305}; RC TISSUE=Seedling {ECO:0000313|EMBL:ONM37784.1}; RG Maize Genome Sequencing Project; RA Ware D.; RT "Update maize B73 reference genome by single molecule sequencing RT technologies."; RL Submitted (DEC-2015) to the EMBL/GenBank/DDBJ databases. RN [2] {ECO:0000313|EnsemblPlants:Zm00001eb152710_P001} RP NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. RC STRAIN=cv. B73 {ECO:0000313|EnsemblPlants:Zm00001eb152710_P001}; RA Seetharam A., Woodhouse M., Cannon E.; RL Submitted (JUL-2019) to the EMBL/GenBank/DDBJ databases. RN [3] {ECO:0000313|EnsemblPlants:Zm00001eb152710_P001} RP IDENTIFICATION. RC STRAIN=cv. B73 {ECO:0000313|EnsemblPlants:Zm00001eb152710_P001}; RG EnsemblPlants; RL Submitted (MAY-2021) to UniProtKB. CC -!- CATALYTIC ACTIVITY: CC Reaction=gibberellin A1 + 2-oxoglutarate + O2 = gibberellin A8 + CC succinate + CO2; Xref=Rhea:RHEA:15005, ChEBI:CHEBI:15379, CC ChEBI:CHEBI:16526, ChEBI:CHEBI:16810, ChEBI:CHEBI:30031, CC ChEBI:CHEBI:58524, ChEBI:CHEBI:58594; EC=1.14.11.13; CC Evidence={ECO:0000256|ARBA:ARBA00052204}; CC -!- COFACTOR: CC Name=L-ascorbate; Xref=ChEBI:CHEBI:38290; CC Evidence={ECO:0000256|ARBA:ARBA00001961}; CC -!- SIMILARITY: Belongs to the iron/ascorbate-dependent oxidoreductase CC family. GA2OX subfamily. {ECO:0000256|ARBA:ARBA00061282}. CC --------------------------------------------------------------------------- CC Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms CC Distributed under the Creative Commons Attribution (CC BY 4.0) License CC --------------------------------------------------------------------------- DR EMBL; CM007649; ONM37784.1; -; Genomic_DNA. DR RefSeq; NP_001348171.1; NM_001361242.1. DR AlphaFoldDB; A0A1D6NB68; -. DR SMR; A0A1D6NB68; -. DR FunCoup; A0A1D6NB68; 274. DR IntAct; A0A1D6NB68; 1. DR STRING; 4577.A0A1D6NB68; -. DR PaxDb; 4577-GRMZM2G022679_P01; -. DR EnsemblPlants; Zm00001eb152710_T001; Zm00001eb152710_P001; Zm00001eb152710. DR GeneID; 103651195; -. DR Gramene; Zm00001eb152710_T001; Zm00001eb152710_P001; Zm00001eb152710. DR KEGG; zma:103651195; -. DR eggNOG; KOG0143; Eukaryota. DR OMA; KQIGQSG; -. DR OrthoDB; 288590at2759; -. DR Proteomes; UP000007305; Chromosome 3. DR ExpressionAtlas; A0A1D6NB68; baseline and differential. DR GO; GO:0045543; F:gibberellin 2-beta-dioxygenase activity; IBA:GO_Central. DR GO; GO:0046872; F:metal ion binding; IEA:UniProtKB-KW. DR GO; GO:0045487; P:gibberellin catabolic process; IBA:GO_Central. DR GO; GO:0009416; P:response to light stimulus; IBA:GO_Central. DR FunFam; 2.60.120.330:FF:000014; Gibberellin 2-beta-dioxygenase 1; 1. DR Gene3D; 2.60.120.330; B-lactam Antibiotic, Isopenicillin N Synthase, Chain; 1. DR InterPro; IPR026992; DIOX_N. DR InterPro; IPR044861; IPNS-like_FE2OG_OXY. DR InterPro; IPR027443; IPNS-like_sf. DR InterPro; IPR050231; Iron_ascorbate_oxido_reductase. DR InterPro; IPR005123; Oxoglu/Fe-dep_dioxygenase_dom. DR PANTHER; PTHR47990; 2-OXOGLUTARATE (2OG) AND FE(II)-DEPENDENT OXYGENASE SUPERFAMILY PROTEIN-RELATED; 1. DR Pfam; PF03171; 2OG-FeII_Oxy; 1. DR Pfam; PF14226; DIOX_N; 1. DR PRINTS; PR00682; IPNSYNTHASE. DR SUPFAM; SSF51197; Clavaminate synthase-like; 1. DR PROSITE; PS51471; FE2OG_OXY; 1. PE 3: Inferred from homology; KW Dioxygenase {ECO:0000256|ARBA:ARBA00022964}; KW Iron {ECO:0000256|ARBA:ARBA00023004, ECO:0000256|RuleBase:RU003682}; KW Metal-binding {ECO:0000256|ARBA:ARBA00022723, KW ECO:0000256|RuleBase:RU003682}; KW Oxidoreductase {ECO:0000256|ARBA:ARBA00023002, KW ECO:0000256|RuleBase:RU003682}; KW Reference proteome {ECO:0000313|Proteomes:UP000007305}. FT DOMAIN 173..279 FT /note="Fe2OG dioxygenase" FT /evidence="ECO:0000259|PROSITE:PS51471" SQ SEQUENCE 331 AA; 35497 MW; AE9EBC33C12FCF1C CRC64; Query Match 100.0%; Score 1694; Length 331; Best Local Similarity 100.0%; Matches 331; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MVVLAKPPVVDQIPLLRSPGPRDSFSGVPVVDLSSHGAARAIVDACERFGFFKVVNHGVA 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MVVLAKPPVVDQIPLLRSPGPRDSFSGVPVVDLSSHGAARAIVDACERFGFFKVVNHGVA 60 Qy 61 AATMDRAESEAVRFFAQAQADKDRAGPAYPFGYGSKRIGLNGDMGWLEYLLLAVDAASLS 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 AATMDRAESEAVRFFAQAQADKDRAGPAYPFGYGSKRIGLNGDMGWLEYLLLAVDAASLS 120 Qy 121 DACPVPSSAAFRSALNEYVAAVRKVAARVLEAMAEGLGIADADALSSMVSGAGSDQVFRV 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 DACPVPSSAAFRSALNEYVAAVRKVAARVLEAMAEGLGIADADALSSMVSGAGSDQVFRV 180 Qy 181 NHYPPCPALQGLGCSTTGFGEHTDPQIISVLRSNGTSGLQIALRDGAQWVSVPSDRDAFF 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 NHYPPCPALQGLGCSTTGFGEHTDPQIISVLRSNGTSGLQIALRDGAQWVSVPSDRDAFF 240 Qy 241 VNVGDSLQVLTNGRFRSVKHRVVTNSLKSRVSFIYFAGPPLGQRIAPLPQVLAEGEESLY 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 VNVGDSLQVLTNGRFRSVKHRVVTNSLKSRVSFIYFAGPPLGQRIAPLPQVLAEGEESLY 300 Qy 301 KEFTWGEYKKAAYKTRLGDNRLAQFEKRSNI 331 ||||||||||||||||||||||||||||||| Db 301 KEFTWGEYKKAAYKTRLGDNRLAQFEKRSNI 331 Before the effective filing date of the claimed invention, it would have been obvious to one of ordinary skill in the art to substitute the Z. mays GA2 oxidase taught by Ware for the Arabidopsis GA2 oxidase in Chen et al’s the corn plants. One of ordinary skill in the art would have been motivated to do so because Gou et al teach that overexpressing a native GA2 oxidase in plants results in shorter plants than expressing a GA2 oxidase from a different plant species does (Gou et al, paragraph spanning the columns on pg 4). One of ordinary skill in the art would thus expect that corn plants transformed with a nucleic acid encoding a Z. mays GA2 oxidase to be even shorter semi-dwarf corn plants than corn plants transformed with nucleic acid encoding an Arabidopsis GA2 oxidase were. Before the effective filing date of the claimed invention, it would have been obvious to one of ordinary skill in the art to modify the methods of applying an agriculture composition taught in Barten et al to use the Z. mays GA2 oxidase-transformed semi-dwarf corn plants as the corn plants. One of ordinary skill in the art would have been motivated to do so because they would expect that these even shorter semi-dwarf corn plants to be even more suitable for use in Barton et al’s method, as their shorter height would make it easier to avoid damage during application of the agricultural composition. Further, as Chen et al’s plants have increased yield when they mature (pg 597, left column, ¶1), one of ordinary skill in the art would have expected the Z. mays GA2 oxidase-transformed semi-dwarf corn plants to also have increased yield, thus being attractive to farmers interested in selling that yield. It would have been obvious to one of ordinary skill in the art to use the vascular RTBV promoter, which has 100% identity to the instant SEQ ID NO:656 and which Barten et al used in their constructs (¶423), to express the Z. mays GA2 oxidase in corn plants because Chen et al teach the main effect of ectopic expression of the GA2 oxidase in corn plants was in stem tissues, especially the vascular xylem and phloem tissue (pg 594, left column, ¶2). One of ordinary skill in the art would have expected the same with Z. mays GA2 oxidase-transformed semi-dwarf corn plants and wanted overexpression of the GA2 oxidase to be in the tissues most affected. The RTBV promoter of SEQ ID NO:656 is one such promoter that targets expression to vascular tissues. It would have been obvious to one of ordinary skill in the art to select for transformants that that have a height that is reduced by least 30% compared to control plants. One of ordinary skill in the art would have been motivated to do so because Barten et al teach that it is desirable to use such plants in the method (¶212). Chen et al teach that the average height difference between their transgenic and control plant can vary by as much as about 20 cm (Table 1, transgenic line #4+ and control line #4-). Chen et al also teach that the variation in height reduction from one transgenic plant to another is the result of the genomic site into which the transgene was inserted (pg 596, right column, paragraph 2). One of ordinary skill in the art would have expected the same for the Z. mays GA2 oxidase-transformed semi-dwarf corn plants and have wanted to select for transformants that had a maximal reduction in height compared to control plants to be sure that environmental effects did not alter transformant growth such that the plants were too tall to be used in the method. Selecting for plants that have a 30% reduction compared to control plants under some conditions would ensure the plants would be short enough to not be damaged by the applicator when growing under conditions that result in the plants having a less than a 30% reduction compared to control plants. One of ordinary skill in the art would have wanted to plant seeds in which 95% or more of the plants had this growth reduction (and thus the transgene) relative to control plants to ensure that the maximum number of plants are not damaged by the machine applying the agricultural composition, i.e., that 95% or more of the plants are not damaged, as damage would reduce profits. As corn plants transformed with a construct comprising a nucleic acid encoding the GA2 oxidase of the instant SEQ ID NO:329 would have bioactive GA levels that are lower than those in unmodified plants, as Chen et al saw for their plants (pg 593, right column), corn plants transformed with a construct comprising the vascular RTBV promoter of the instant SEQ ID NO:656 operably linked to a nucleic acid encoding the GA2 oxidase of SEQ ID NO: 329 would have lower bioactive GA levels in at least one internode tissue of the stem or stalk of the modified corn plant is lower than the same internode tissue of an unmodified control plant. Conclusion No claim is allowed. Any inquiry concerning this communication or earlier communications from the examiner should be directed to Anne R. Kubelik, Ph.D., whose telephone number is (571) 272-0801. The examiner can normally be reached Monday through Friday, 9:00 am - 5:00 pm Eastern. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Amjad Abraham, can be reached at (571) 270-7058. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /Anne Kubelik/Primary Examiner, Art Unit 1663
Read full office action

Prosecution Timeline

Show 15 earlier events
Sep 08, 2025
Response Filed
Oct 24, 2025
Final Rejection mailed — §103, §112
Dec 08, 2025
Response after Non-Final Action
Jan 12, 2026
Request for Continued Examination
Jan 14, 2026
Response after Non-Final Action
Feb 13, 2026
Non-Final Rejection mailed — §103, §112
Apr 10, 2026
Response Filed
Jul 02, 2026
Final Rejection mailed — §103, §112 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12672625
PLANTS AND SEEDS OF CORN VARIETY CV988211
2y 6m to grant Granted Jul 07, 2026
Patent 12662682
METHOD FOR PRODUCING BIOLUMINESCENT PLANTS
3y 11m to grant Granted Jun 23, 2026
Patent 12642227
SOYBEAN VARIETY '21850087'
3y 5m to grant Granted Jun 02, 2026
Patent 12642221
WHEAT VARIETY 6PPNK56B
2y 5m to grant Granted Jun 02, 2026
Patent 12622403
Garden Bean Variety Black Diamond
4y 1m to grant Granted May 12, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

Strategy Recommendation AI-generated — please review before filing

Get a prosecution strategy drawn from examiner precedents, rejection analysis, and claim mapping.
Typically takes 5-10 seconds — AI-generated, attorney review required before filing

Prosecution Projections

9-10
Expected OA Rounds
76%
Grant Probability
75%
With Interview (-0.6%)
2y 8m (~0m remaining)
Median Time to Grant
High
PTA Risk
Based on 1326 resolved cases by this examiner. Grant probability derived from career allowance rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month