Prosecution Insights
Last updated: July 17, 2026
Application No. 17/817,777

Composition and Methods for Selective Degradation of Engineered Proteins

Non-Final OA §112
Filed
Aug 05, 2022
Priority
Aug 06, 2021 — provisional 63/230,225
Examiner
BOWLES, DAVID PAUL
Art Unit
1654
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Celgene Corporation
OA Round
3 (Non-Final)
71%
Grant Probability
Favorable
3-4
OA Rounds
0m
Est. Remaining
93%
With Interview

Examiner Intelligence

Grants 71% — above average
71%
Career Allowance Rate
22 granted / 31 resolved
+11.0% vs TC avg
Strong +22% interview lift
Without
With
+22.3%
Interview Lift
resolved cases with interview
Typical timeline
3y 5m
Avg Prosecution
36 currently pending
Career history
80
Total Applications
across all art units

Statute-Specific Performance

§103
34.4%
-5.6% vs TC avg
§102
9.2%
-30.8% vs TC avg
§112
27.0%
-13.0% vs TC avg
Black line = Tech Center average estimate • Based on career data from 31 resolved cases

Office Action

§112
DETAILED ACTION Continued Examination Under 37 CFR 1.114 A request for continued examination under 37 CFR 1.114, including the fee set forth in 37 CFR 1.17(e), was filed in this application after final rejection. Since this application is eligible for continued examination under 37 CFR 1.114, and the fee set forth in 37 CFR 1.17(e) has been timely paid, the finality of the previous Office action has been withdrawn pursuant to 37 CFR 1.114. Applicant's submission filed on 5/21/2026 has been entered. Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Priority Priority to US 63/230,225, filed 8/6/2021, is acknowledged. Information Disclosure Statement The information disclosure statements (IDS) were submitted on 10/12/2022, 7/18/2024, and 1/3/2025, before the mailing of a first office action. The submissions are in compliance with the provisions of 37 CFR 1.97. Accordingly, the information disclosure statement is being considered by the examiner. Claim Status Claims 1, 14, 19, 22, 24, 27, 29, 32, 36, 38, 39, 41, 44, 45, 48, 50, 53, 54, 56, 57, 62, 63, and 97-101 are pending in the application. Claims 2, 3, 5, 12, 15, 16, 65-67, 69-73, 75-77, 81, 82, 85-88, 91, and 94-96 are canceled. Claims 1, 14, 19, 22, 24, 27, 29, 32, 36, 38, 39, 41, 44, 45, 48, 50, 53, 54, 56, 57, 62, 63, and 97-101 are currently under examination. Claim 100 and 101 are new. Claim Rejections - 35 USC § 112 The following is a quotation of 35 U.S.C. 112(b): (b) CONCLUSION.—The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the inventor or a joint inventor regards as the invention. The following is a quotation of 35 U.S.C. 112 (pre-AIA ), second paragraph: The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the applicant regards as his invention. Claims 1, 14, 19 are rejected under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter which the inventor or a joint inventor (or for applications subject to pre-AIA 35 U.S.C. 112, the applicant), regards as the invention. Regarding claim 1, claim 1 recites: “An engineered polypeptide comprising a degradation domain, wherein the degradation domain comprises a zinc finger domain comprising the amino acid sequence FCNQCGAS (SEQ ID NO: 3), and wherein the zinc finger domain sequence is at least 85% identical to an amino acid sequence selected from SEQ ID NOs: 15, 21, 27, 32, 38, 60, 61, and 62. The specification recites at para. [00046]: “In some embodiments, the degradation domain comprises an amino acid sequence that is at least 85%, at least 90%, or at least 95% identical to amino acids 141-168 of human Ikaros (GERPFQCNQCGASFTQKGNLLRHIKLHS; SEQ ID NO: 15).” Therefore it is not clear if SEQ ID NO: 15 is degradation domain or a zinc finger domain. According to the specification, SEQ ID NO: 15 is more closely associated with the descriptor “degradation domain”: “In some embodiments, the degradation domain comprises an amino acid sequence that is at least 85%, at least 90%, or at least 95% identical to amino acids 141-168 of human Ikaros (GERPFQCNQCGASFTQKGNLLRHIKLHS; SEQ ID NO: 15).” (Specification, para. [00046]). Similarly, the specification at para. [00041] recites: “In some embodiments, the degradation domain of the engineered polypeptide comprises the amino acid sequence FCNQCGAS (SEQ ID NO: 3).” SEQ ID NO: 3 is not identified as a zinc finger domain. Consequently, it is not clear what exactly constitutes the degradation domain, what constitutes a zinc finger domain, and what the functional difference is between the two and why these identifiers are used in claim 1. Regarding claims 14, 19, 24, 27, 29, 32, 36, 38, 39, 41, 44, 45, 48, 50, 53, 54, 56, 57, 62, 63, 97, 100, and 101, claim 1 is rejected as described above. These claims do not resolve the indefiniteness described for claim 1. Consequently, claims 14, 19, 24, 27, 29, 32, 36, 38, 39, 41, 44, 45, 48, 50, 53, 54, 56, 57, 62, 63, 97, 100, and 101 are rejected. Regarding claim 22, amended claim 22 recites “An engineered polypeptide comprising a degradation domain, wherein the degradation domain comprises a zinc finger domain comprising the amino acid sequence FCNQCGAS (SEQ ID NO: 3), and a second zinc finger domain; wherein the two zinc finger domains comprise an amino acid sequence selected from: GERPFFCNQCGASFTQKGNLLRHIKLHSGEKPFKCHLCNYACRRRDALTGHLRTHS (SEQ ID NO: 7); GERPFFCNQCGASFTQKGNLLRHIKLHSGEKPFKCPFCSYACRRRDALTGHLRTHS (SEQ ID NO: 69); GERPFFCNQCGASFTQKGNLLRHIKLHTGEKPFKCHLCNYACQRRDALTGHLRTHS (SEQ ID NO: 70); and GERPFFCNQCGASFTQKGNLLRHIKLHSGEKPFKCPFCNYACRRRDALTGHLRTHS (SEQ ID NO: 71).” As noted above, the specification at para. [00041] recites: “In some embodiments, the degradation domain of the engineered polypeptide comprises the amino acid sequence FCNQCGAS (SEQ ID NO: 3).” SEQ ID NO: 3 is not identified as a zinc finger domain. Consequently, it is not clear what exactly constitutes the degradation domain, what constitutes a zinc finger domain, and what the functional difference is between the two and why these identifiers are used in claim 22. Furthermore, it is not clear what the metes and bounds of the second claimed zinc finger are. The recited sequences are the result of a combination of two zinc finger domains, but with the transitional phrase “comprising” additional residues may be present. Consequently, claim 22 is rejected. Regarding claim 98, claim 98 recites: An engineered polypeptide comprising a degradation domain, wherein the degradation domain comprises a zinc finger domain comprising the amino acid sequence FCNQCGAS (SEQ ID NO: 3) and a second zinc finger domain; wherein the two zinc finger domains comprise an amino acid sequence that is at least 90% identical to an amino acid sequence selected from SEQ ID NOs: 7, 69, 70, and 71. As noted above, the specification at para. [00041] recites: “In some embodiments, the degradation domain of the engineered polypeptide comprises the amino acid sequence FCNQCGAS (SEQ ID NO: 3).” SEQ ID NO: 3 is not identified as a zinc finger domain. Consequently, it is not clear what exactly constitutes the degradation domain, what constitutes a zinc finger domain, and what the functional difference is between the two and why these identifiers are used in claim 98. Furthermore, it is not clear what the metes and bounds of the second claimed zinc finger are. The recited sequences are the result of a combination of two zinc finger domains, but with the transitional phrase “comprising” additional residues may be present. Consequently, claim 98 is rejected. Regarding claim 99, claim 98 is rejected as described above. Claim 99 does not resolve the indefiniteness of claim 98. Consequently, claim 99 is rejected. The following is a quotation of the first paragraph of 35 U.S.C. 112(a): (a) IN GENERAL.—The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor or joint inventor of carrying out the invention. The following is a quotation of the first paragraph of pre-AIA 35 U.S.C. 112: The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor of carrying out his invention. Maintained Previous Rejections Claims 1, 14, 19, 24, 27, 29, 32, 36, 38, 39, 41, 44, 45, 48, 50, 53, 54, 56, 57, 62, 63, and 97 are rejected under 35 U.S.C. 112(a) or 35 U.S.C. 112 (pre-AIA ), first paragraph, as failing to comply with the written description requirement. The claim(s) contains subject matter which was not described in the specification in such a way as to reasonably convey to one skilled in the relevant art that the inventor or a joint inventor, or for applications subject to pre-AIA 35 U.S.C. 112, the inventor(s), at the time the application was filed, had possession of the claimed invention. Regarding claim 1, amended claim 1 now recites: “An engineered polypeptide comprising a degradation domain, wherein the degradation domain comprises a zinc finger domain comprising the amino acid sequence FCNQCGAS (SEQ ID NO: 3), and wherein the zinc finger domain sequence is at least 85% identical to an amino acid sequence selected from SEQ ID NOs: 15, 21, 27, 32, 38, 60, 61, and 62.” Paragraph [0041] provides support for the degradation domain comprising SEQ ID NO: 3. Paragraphs [0044]-[0047] provide support for the case wherein the zinc finger domain is at least 85% identical to an amino acid sequence selected from SEQ ID NOs: 15, 21, 27, 32, 38, 60, 61, and 62. However, no direct textual support is present for a combination of these two limitations. Examining the claimed sequences, SEQ ID NOs: 7, 69, 70, and 71 possess the required FCNQCGAS motif; but as shown in the alignment below, these sequences only support an identity of approximately 92.5%. Therefore, no sequence-based support exists for this claim either. Consequently, this combination of limitations is new matter and therefore rejected. Regarding claims 14, 19, 24, 27, 29, 32, 36, 38, 39, 41, 44, 45, 48, 50, 53, 54, 56, 57, 62, 63, 97 these claims are all ultimately dependent upon claim 1 and therefore they all contain the same new matter and are rejected. PNG media_image1.png 750 505 media_image1.png Greyscale Response to Arguments Applicant's arguments filed 4/23/2026 have been fully considered but they are not persuasive. Applicant Reply, filed 4/23/2026, page 7, para. 6 asserts: “First, to satisfy the written description requirement, there is no requirement for exact, literal support within the specification. Specifically, courts have emphasized that "the invention claimed does not have to be described in ipsis verbis in order to satisfy the description requirement of § 112." In re Wertheim 541 F.2d 257, 265 (CCPA 1976). Rather, the disclosure need only reasonably convey to persons skilled in the art that the Applicants had possession of the subject matter in question. See In re Edwards, 568 F.2d 1349, 1351-52 (CCPA 1978). For example, the MPEP points out that claims can be supported inherently or implicitly from the disclosure as well as literally, and that support may be provided in numerous ways, such as by figures, structures, diagrams, and the like as well as by words. See, e.g., MPEP § 2163(I)(B) and (II)(A)(3)(a).” MPEP 2163(II)(A) states: “For example, in Hyatt v. Dudas, 492 F.3d 1365, 1371, 83 USPQ2d 1373, 1376-1377 (Fed. Cir. 2007), the examiner made a prima facie case by clearly and specifically explaining why applicant’s specification did not support the particular claimed combination of elements, even though applicant’s specification listed each and every element in the claimed combination. The court found the "examiner was explicit that while each element may be individually described in the specification, the deficiency was lack of adequate description of their combination" and, thus, "[t]he burden was then properly shifted to [inventor] to cite to the examiner where adequate written description could be found or to make an amendment to address the deficiency." Id” (Applicant Reply, page 7, para. 6). The rejected claims are analogous to this situation described by the MPEP above. Support certainly exists for these embodiments separately, but no support exists for a combination of these embodiments. Essentially, two supported embodiments cannot be combined to create a third, unsupported embodiment. Claims 1, 14, 19, 24, 27, 29, 32, 36, 38, 39, 41, 44, 45, 48, 50, 53, 54, 56, 57, 62, 63, and 98 are rejected under 35 U.S.C. 112(a) or 35 U.S.C. 112 (pre-AIA ), first paragraph, as failing to comply with the written description requirement. The claim(s) contains subject matter which was not described in the specification in such a way as to reasonably convey to one skilled in the relevant art that the inventor or a joint inventor, or for applications subject to pre-AIA 35 U.S.C. 112, the inventor(s), at the time the application was filed, had possession of the claimed invention. Regarding claim 1, claim 1 recites: “…wherein the zinc finger domain is at least 85% identical to an amino acid sequence selected from SEQ ID NOs: 15, 21, 27, 32, 38, 60, 61, and 62.” SEQ ID NO: 15 has 28 residues, and 85% identity to this amino acid means that 0.15*28= 4 residues may be substituted. However, one of these substitutions is known, namely the phenylalanine substitution. This yields a genus size of at least 20^3 = 8,000 members. In this case, the written description requirement for a claimed genus may be satisfied through sufficient description of a representative number of species by actual reduction to practice, reduction to drawings, or by disclosure of relevant, identifying characteristics, i.e., structure or other physical and/or chemical properties, by functional characteristics coupled with a known or disclosed correlation between function and structure, or by a combination of such identifying characteristics, sufficient to show the inventor was in possession of the claimed genus. See Eli Lilly, 119 F.3d at 1568, 43 USPQ2d at 1406. (MPEP § 2163 (II.A.3.a.ii.)) According to MPEP § 2163 (II.A.3.a.ii.), a "representative number of species" means that the species which are adequately described are representative of the entire genus. Thus, when there is substantial variation within the genus, one must describe a sufficient variety of species to reflect the variation within the genus. See AbbVie Deutschland GmbH & Co., KG v. Janssen Biotech, Inc., 759 F.3d 1285, 1300, 111 USPQ2d 1780, 1790 (Fed. Cir. 2014). The sequence space covered by this claim is substantial. Specifically, claim 1 encompasses 20^3 = 8,000 sequences at a minimum. Applicant discloses an example of this degradation domain, but these examples are limited to primarily exploring the case of IKZF1-based constructs in the context of CD28 transmembrane domains, 4-1BB costimulatory domains, and CD3z signaling domains. Specifically, the example is SEQ ID NO: 19. However, SEQ ID NO: 19 does not exemplify the claimed sequence identity as shown below: PNG media_image2.png 747 548 media_image2.png Greyscale SEQ ID NO: 19 is 96% identical to SEQ ID NO: 7 and therefore not representative of identities as low as 85%. MPEP § 2163 (II.A.3.a.ii.) states that “for inventions in an unpredictable art, adequate written description of a genus which embraces widely variant species cannot be achieved by disclosing only one species within the genus. See, e.g., Eli Lilly, 119 F.3d at 1568, 43 USPQ2d at 1406. Instead, the disclosure must adequately reflect the structural diversity of the claimed genus, either through the disclosure of sufficient species that are ‘representative of the full variety or scope of the genus,’ or by the establishment of ‘a reasonable structure-function correlation.’” Even when several species are disclosed, these are not necessarily representative of the entire genus. AbbVie Deutschland GMBH v. Janssen Biotech, 111 USPQ2d 1780, 1790 (Fed. Cir. 2014) (“The ’128 and ’485 patents, however, only describe species of structurally similar antibodies that were derived from Joe-9. Although the number of the described species appears high quantitatively, the described species are all of the similar type and do not qualitatively represent other types of antibodies encompassed by the genus.”). Thus, when there is substantial variation within the genus, as here, one must describe a sufficient variety of species to reflect the variation within the genus to provide a "representative number” of species. Since each genus recited in the instant claims is large, it would be very challenging to describe sufficient species to cover the structures of the entire genus. At the time the invention was made, the level of skill for preparing and screening polypeptides with desired functional properties was high. However, even if a synthesis and selection procedure was, at the time of the invention, sufficient to enable the skilled artisan to identify polypeptides with the recited properties, the written description provision of 35 U.S.C § 112 is severable from its enablement provision. Ariad Pharm., Inc. v. Eli Lilly & Co., 598 F.3d 1336 (Fed. Cir. 2010); see also Centocor Ortho Biotech Inc. v. Abbott Labs., 97 USPQ2d 1870, 1876 (Fed. Cir. 2011) (“The fact that a fully-human antibody could be made does not suffice to show that the inventors of the '775 patent possessed such an antibody.”) Absent the conserved structure provided by the provided species, the skilled artisan generally would not be able to visualize or otherwise predict, a priori, what polypeptide with a particular set of properties would look like structurally. The provided example only represents a limited structural diversity. Since few species of polypeptides is taught within the claimed genus above and these polypeptides are not fully representative of the claimed genus, the instant claims above fail the written description requirement. A representative number of species has not been taught to describe this genus. A single point mutation can change the biophysical properties of a peptide: “In summary, we have shown that the structural changes in the fibrillar state of the Aβ42 peptide that are observed to occur upon introduction of single point mutations can be accompanied by changes in the dominance of the microscopic processes by which these aggregates are themselves formed.” (Bolognesi et al. ACS Chem Bio 9:2 (2013) page 381 col. 2 para. 3) and “In summary, while ovispirin-1 and novispirin G-10 both had solution structures that were helical and amphipathic in the presence of TFE, a relatively simple change in their primary structure (a single glycine–isoleucine exchange) had profound effects on their respective toxicities for human erythrocytes and epithelial cells.” (Sawai et al. Protein Eng. 15:3 (2002) page 232 col. 1 para. 3). Given this unpredictability of protein design, the skilled artisan would not have been in possession of the substantial repertoire of polypeptide species encompassed by the claimed invention; one of skill in the art would conclude that applicant was not in possession of the structural attributes of a representative number of species possessed by the members of the genus of every polypeptide molecule recited by claim 1. One of skill in the art would conclude that the specification fails to disclose a representative number of species to describe the claimed genus. Therefore, claim 1 is rejected. Regarding claim 14, claim 1 is rejected as described above. Claim 14 has at least as much sequence space as claim 1, and no additional examples. Claim 14 is rejected. Regarding claim 19, claim 19 recites a degradation domain wherein the degradation domain comprises an amino acid sequence that is at least 85% identical to an amino acid sequence selected from SEQ ID NOs: 7, 69, 70, and 71. Because these sequences are longer than exemplary sequences of claim 1, the genus of 19 has at least as much sequence space as claim 1, and no additional examples. Claim 19 is rejected. Regarding claims 24, 27, 29, 32, 36, 38, 39, 41, 44, 45, 48, 50, 53, 54, 56, and 57, claim 1 is rejected as described above. These claims encompass the same sequence space as claim 1 with no additional examples. Consequently, claims 24, 27, 29, 32, 36, 38, 39, 41, 44, 45, 48, 50, 53, 54, 56, and 57 are rejected. Regarding claim 62, claim 1 is rejected as described above. Claim 62 recites a nucleic acid encoding the engineered polypeptide of claim 1. Such a nucleic acid would cover at least as much sequence space as the amino acids of claim 1. No additional examples are provided, and therefore claim 62 is rejected. Regarding claim 63, claim 62 is rejected as described above. Claim 63 recites a vector that comprises the nucleic acid of claim 62. Claim 62 encompasses at least the sequence space of claim 1. No additional examples are provided, and therefore claim 63 is rejected. Regarding claim 98, claim 98 recites the case wherein the two zinc finger domains comprise an amino acid sequence that is at least 90% identical to an amino acid sequence selected from SEQ ID NOs: 7, 69, 70, and 71. SEQ ID NO: 7 is 56 residues and therefore 90% identity allows for at least 20^5 sequences, or 20^4 after taking the phenylalanine into account. Similar to claim 1, this genus is very large compared to the examples provided in the specification. Consequently, claim 98 is rejected. Response to Arguments Applicant's arguments filed 4/23/2026 have been fully considered but they are not persuasive. Applicant’s arguments, see Applicant Reply, filed 4/23/2026, page 9, para. 2, with respect to claim 97 have been fully considered and are persuasive. The rejection of claim 97 has been withdrawn. Regarding the remaining rejections, Applicant asserts: “As the Examiner pointed out, "[a]bsent the conserved structure provided by the provided species, the skilled artisan generally would not be able to visualize or otherwise predict, a priori, what polypeptide with a particular set of properties would look like structurally." In other words, the Examiner agrees that such conserved structural information as provided in Fig. 8 would allow an ordinarily skilled artisan to visualize or otherwise predict exemplary polypeptides consistent with the pending claims. Accordingly, a skilled artisan looking at claim 1 would be able to conclude that the specification discloses sufficient guidance to visualize species falling within its scope, based on the alignments of various human IKZF family members, as shown, for instance, in Fig. 8. Therefore, claim 1, and its dependent claims 14, 19, 24, 27, 29, 32, 36, 38, 41, 44, 45, 48, 50, 53, 54, 56, 57, 62, 63, and 98, are adequately described in the specification as filed. Thus, Applicant requests the withdrawal of this rejection.” (Applicant Reply, page 4, para. 2). In response, Examiner has two main points: First, SEQ ID NOs: 15, 60, and 61 are not covered by this consensus analysis. Second, the Examiner agrees that the consensus analysis provides a subset of the genus claimed in claim 1. However, the residues indicated by the consensus analysis are not all claimed by claim 1. Therefore, the consensus analysis is not commensurate in scope with the claimed subject matter of claim 1. If claim 1 were amended to reflect the results of the consensus sequence, that would eliminate this particular rejection. New Claim Rejections - 35 USC § 112 The following is a quotation of the first paragraph of 35 U.S.C. 112(a): (a) IN GENERAL.—The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor or joint inventor of carrying out the invention. The following is a quotation of the first paragraph of pre-AIA 35 U.S.C. 112: The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor of carrying out his invention. Claim 100 is rejected under 35 U.S.C. 112(a) or 35 U.S.C. 112 (pre-AIA ), first paragraph, as failing to comply with the written description requirement. The claim(s) contains subject matter which was not described in the specification in such a way as to reasonably convey to one skilled in the relevant art that the inventor or a joint inventor, or for applications subject to pre-AIA 35 U.S.C. 112, the inventor(s), at the time the application was filed, had possession of the claimed invention. Regarding claim 100, claim 1 is rejected as described above. Claim 100 further recites the case wherein the zinc finger domain sequence is at least 90% identical to an amino acid sequence selected from SEQ ID NOs: 15, 21, 27, 32, 38, 60, 61, and 62. Examining the claimed sequences, SEQ ID NOs: 7, 69, 70, and 71 possess the required FCNQCGAS motif; but as shown in the alignment below, these sequences only support an identity of approximately 92.5%. Therefore, no sequence-based support exists for this claim either. Consequently, this combination of limitations is new matter and therefore rejected. Claim 100 is rejected. Examiner Note: For clarity, claim 101 is not rejected because claim 101 recites the wherein the zinc finger domain sequence is at least 95% identical to an amino acid sequence selected from SEQ ID NOs: 15, 21, 27, 32, 38, 60, 61, and 62. As described above, the sequences provided in the specification support an identity of 92.5%, and therefore, written description support for this embodiment exists. Closest Prior Art Claims 1, 14, 19, 22, 24, 27, 29, 32, 36, 38, 39, 41, 44, 45, 48, 50, 53, 54, 56, 57, 62, 63, and 97-101 are free of the prior art because they all require the sequence FCNQCGAS which is non-obvious as described below: Brayshaw et al. (WO 20190002578, published 01/03/2019) discloses an Ikaros 1 protein SEQ ID NO: 27 from claim 6, aligned below with Applicant SEQ ID NO: 15. SQ Sequence 28 AA; Query Match 100.0%; Score 156; Length 28; Best Local Similarity 100.0%; Matches 28; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 GERPFQCNQCGASFTQKGNLLRHIKLHS 28 |||||||||||||||||||||||||||| Db 1 GERPFQCNQCGASFTQKGNLLRHIKLHS 28 However, the sequences disclosed by Brayshaw at a minimum lack the Q6F mutation introduced by the present disclosure at position 6 as exemplified by Applicant SEQ ID NO: 7: GERPFFCNQCGASFTQKGNLLRHIKLHSGEKPFKCHLCNYACRRRDALTGHLRTHS. This Q to F substitution is novel because it is not found in the prior art. Also, the prior art does not provide a teaching, suggestion, or motivation to make this particular non-conservative substitution in this particular position. Therefore, this substitution is non-obvious. Conclusion No claim is allowed. Claims 1, 14, 19, 22, 24, 27, 29, 32, 36, 38, 39, 41, 44, 45, 48, 50, 53, 54, 56, 57, 62, 63, and 97-101 are rejected. Any inquiry concerning this communication or earlier communications from the examiner should be directed to David Paul Bowles whose telephone number is (571)272-0919. The examiner can normally be reached Monday-Friday 8:30-5:00. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Lianko Garyu can be reached on (571) 270-7367. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /DAVID PAUL BOWLES/ Examiner, Art Unit 1654 /LIANKO G GARYU/ Supervisory Patent Examiner, Art Unit 1654
Read full office action

Prosecution Timeline

Show 1 earlier event
Jul 18, 2024
Response after Non-Final Action
May 06, 2025
Non-Final Rejection mailed — §112
Oct 20, 2025
Response Filed
Jan 23, 2026
Final Rejection mailed — §112
Apr 23, 2026
Response after Non-Final Action
May 21, 2026
Request for Continued Examination
May 26, 2026
Response after Non-Final Action
Jun 22, 2026
Non-Final Rejection mailed — §112 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12648942
METHOD FOR TREATING ACUTE ISCHEMIC STROKE
2y 8m to grant Granted Jun 09, 2026
Patent 12629405
EZRIN PEPTIDE 1 FOR USE IN A METHOD OF TREATING COVID-19
3y 7m to grant Granted May 19, 2026
Patent 12594326
COMPOSITIONS OF GLP-1 PEPTIDES AND PREPARATION THEREOF
1y 1m to grant Granted Apr 07, 2026
Patent 12590134
GLP-1 AGONIST POLYPEPTIDE COMPOUND AND SALT THEREOF, SYNTHESIS METHOD THEREFOR AND USE THEREOF
3y 7m to grant Granted Mar 31, 2026
Patent 12576025
PHARMACEUTICAL PARENTERAL COMPOSITION OF DUAL GLP1/2 AGONIST
4y 3m to grant Granted Mar 17, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

Strategy Recommendation AI-generated — please review before filing

Get a prosecution strategy drawn from examiner precedents, rejection analysis, and claim mapping.
Typically takes 5-10 seconds — AI-generated, attorney review required before filing

Prosecution Projections

3-4
Expected OA Rounds
71%
Grant Probability
93%
With Interview (+22.3%)
3y 5m (~0m remaining)
Median Time to Grant
High
PTA Risk
Based on 31 resolved cases by this examiner. Grant probability derived from career allowance rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month