Prosecution Insights
Last updated: April 19, 2026
Application No. 18/063,459

ANTIBODIES BINDING TO CD3 AND PLAP

Non-Final OA §103§112§DP
Filed
Dec 08, 2022
Examiner
GUSTILO, ESTELLA M
Art Unit
1646
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Hoffmann-La Roche, Inc.
OA Round
1 (Non-Final)
53%
Grant Probability
Moderate
1-2
OA Rounds
3y 4m
To Grant
87%
With Interview

Examiner Intelligence

Grants 53% of resolved cases
53%
Career Allow Rate
28 granted / 53 resolved
-7.2% vs TC avg
Strong +34% interview lift
Without
With
+34.4%
Interview Lift
resolved cases with interview
Typical timeline
3y 4m
Avg Prosecution
41 currently pending
Career history
94
Total Applications
across all art units

Statute-Specific Performance

§101
2.1%
-37.9% vs TC avg
§103
32.2%
-7.8% vs TC avg
§102
13.4%
-26.6% vs TC avg
§112
26.2%
-13.8% vs TC avg
Black line = Tech Center average estimate • Based on career data from 53 resolved cases

Office Action

§103 §112 §DP
Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Status of the Claims Claims 1 – 4, 6, 8 – 12, 16 – 22, 29, and 32 – 34 are currently pending and are the subject of this Office Action. This is the first Office Action on the merits of the claims. Claim Rejections - 35 USC § 112 The following is a quotation of 35 U.S.C. 112(b): (b) CONCLUSION.—The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the inventor or a joint inventor regards as the invention. The following is a quotation of 35 U.S.C. 112 (pre-AIA ), second paragraph: The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the applicant regards as his invention. Claim 6 and 32 – 33 are rejected under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter which the inventor or a joint inventor (or for applications subject to pre-AIA 35 U.S.C. 112, the applicant), regards as the invention. Claim 6 recites that the “VL and VH or the constant domains CL and CH of the Fab light chain and the Fab heavy chain are replaced by each other”. However, it is not clear which domain(s) is replaced and with what it/they are replaced with. Claim 32, part (b), recites “(b) the first antigen binding domain is a Fab molecule wherein the variable domains VL and VH of the Fab light chain and the Fab heavy chain are replaced by each other”. However, it is not clear what domain(s) is/are replaced and with what and how the domains were arranged before the replacement(s). Claim 33 depends from claim 32 and thus inherits the deficiencies of claim 32. Claim Rejections - 35 USC § 103 In the event the determination of the status of the application as subject to AIA 35 U.S.C. 102 and 103 (or as subject to pre-AIA 35 U.S.C. 102 and 103) is incorrect, any correction of the statutory basis (i.e., changing from AIA to pre-AIA ) for the rejection will not be considered a new ground of rejection if the prior art relied upon, and the rationale supporting the rejection, would be the same under either status. The following is a quotation of 35 U.S.C. 103 which forms the basis for all obviousness rejections set forth in this Office action: A patent for a claimed invention may not be obtained, notwithstanding that the claimed invention is not identically disclosed as set forth in section 102, if the differences between the claimed invention and the prior art are such that the claimed invention as a whole would have been obvious before the effective filing date of the claimed invention to a person having ordinary skill in the art to which the claimed invention pertains. Patentability shall not be negated by the manner in which the invention was made. The factual inquiries for establishing a background for determining obviousness under 35 U.S.C. 103 are summarized as follows: 1. Determining the scope and contents of the prior art. 2. Ascertaining the differences between the prior art and the claims at issue. 3. Resolving the level of ordinary skill in the pertinent art. 4. Considering objective evidence present in the application indicating obviousness or nonobviousness. This application currently names joint inventors. In considering patentability of the claims the examiner presumes that the subject matter of the various claims was commonly owned as of the effective filing date of the claimed invention(s) absent any evidence to the contrary. Applicant is advised of the obligation under 37 CFR 1.56 to point out the inventor and effective filing dates of each claim that was not commonly owned as of the effective filing date of the later invention in order for the examiner to consider the applicability of 35 U.S.C. 102(b)(2)(C) for any potential 35 U.S.C. 102(a)(2) prior art against the later invention. Claims 1 – 4, 6, 8 – 12, 16 – 22, 29, and 32 – 34 are rejected under 35 U.S.C. 103 as being unpatentable over WU (WO 2021/154534 A1, published 08/05/2021; see PTO-892: Notice of References Cited) in view of BRUENKER (WO 2021/255137 A1, filed 06/17/2021; see PTO-892). The present application is directed to antibody that binds to CD3 and PLAP, wherein the antibody comprises (a) a first antigen binding domain that binds to CD3, comprising a heavy chain variable region (VH) comprising a heavy chain complementary determining region (HCDR) 1 comprising the amino acid sequence of SEQ ID NO: 2, an HCDR 2 comprising the amino acid sequence of SEQ ID NO: 3, and an HCDR 3 comprising the amino acid sequence of SEQ ID NO: 6, and a light chain variable region (VL) comprising a light chain complementarity determining region (LCDR) 1 comprising the amino acid sequence of SEQ ID NO: 10, an LCDR 2 comprising the amino acid sequence of SEQ ID NO: 111 and an LCDR 3 comprising the amino acid sequence of SEQ ID NO: 12; and (b) a second antigen binding domain that binds to PLAP, comprising a VH comprising (i) an HCDR 1 comprising the amino acid sequence of SEQ ID NO: 28, an HCDR 2 comprising the amino acid sequence of SEQ ID NO: 29, and an HCDR 3 comprising the amino acid sequence of SEQ ID NO: 30, (ii) an HCDR 1 comprising the amino acid sequence of SEQ ID NO: 32, an HCDR 2 comprising the amino acid sequence of SEQ ID NO: 33, and an HCDR 3 comprising the amino acid sequence of SEQ ID NO: 34, (iii) an HCDR 1 comprising the amino acid sequence of SEQ ID NO: 36, an HCDR 2 comprising the amino acid sequence of SEQ ID NO: 37, and an HCDR 3 comprising the amino acid sequence of SEQ ID NO: 38, (iv) an HCDR 1 comprising the amino acid sequence of SEQ ID NO: 40, an HCDR 2 comprising the amino acid sequence of SEQ ID NO: 41, and an HCDR 3 comprising the amino acid sequence of SEQ ID NO: 42, or (v) an HCDR 1 comprising the amino acid sequence of SEQ ID NO: 44, an HCDR 2 comprising the amino acid sequence of SEQ ID NO: 45, and an HCDR 3 comprising the amino acid sequence of SEQ ID NO: 46, and a VL comprising an LCDR 1 comprising the amino acid sequence of SEQ ID NO: 48, an LCDR 2 comprising the amino acid sequence of SEQ ID NO: 49 and an LCDR 3 comprising the amino acid sequence of SEQ ID NO:50. WU is directed to bispecific humanized PLAP (placental alkaline phosphatase)-CD3 epsilon chain (CD3e) antibodies, and a method for treating PLAP-positive cancer cells by administering the bispecific PLAP-CD3e antibody to the patients. See abstract. WU teaches that using bispecific antibodies binding T cells (such as via CD3) and tumor associated antigen (such as PLAP) is the most common approach to design bispecific antibody by bringing cytotoxic T cells to kill cancer cells. See p. 1, lines 21 – 22. WU discloses the PLAP-binding HCDRs of SEQ ID NOs: 28 – 30 and LCDRs of SEQ ID NOs: 48 – 50 of present claims 1, 16, and 32 with 100% identity. WU also discloses the anti-PLAP VH of SEQ ID NOs: 35 and anti-PLAP VL of SEQ ID NO: 51 of present claims 2, 3, 17, and 33 each with 100% identity. See Appendix. BRUENKER is directed to a protease-activatable T cell activating bispecific molecule comprising a first antigen binding moiety capable of binding to CD3 for the treatment of cancer. See claims 1 and 47. BRUENKER discloses the CD3-binding HCDRs of SEQ ID NOs: 2, 3, and 6 and LCDRs of SEQ ID NOs: 10 – 12 with 100% identity. BRUENKER also discloses the anti-CD3 VH of SEQ ID NO: 9 and VL of SEQ ID NO: 13 of present claims 2, 3, and 33 each with 100% identity. See Appendix. Because WU teaches a bispecific antibody targeting CD3 and PLAP (with the same anti-PLAP CDRs, VH, and VL of the present claims) for the treatment of cancer, and because BRUENKER discloses an antibody targeting CD3 (with the same anti-CD3 CDRs, VH, and VL of the present claims) for the treatment of cancer, it would have been obvious to one having ordinary skill in the art to modify WU’s bispecific antibody with BRUENKER’s anti-CD3 CDRs to arrive to the inventions of claims 1 – 3, 16 – 17, and 32 – 33. There would have been a reasonable expectation of success considering that using bispecific antibodies binding T cells (such as via CD3) and tumor associated antigen (such as PLAP) is the most common approach to design bispecific antibody by bringing cytotoxic T cells to kill cancer cells, as evidenced by applied prior art. Regarding claims 4, 9, and 32, each appears to recite a structure of FIG. 1 of the drawings of the present specifications. For example, FIG. 1B, C, E, or F. However, WU teaches a similar structure. See WU’s FIG 1A (and p. 5, last paragraph) below: PNG media_image1.png 200 400 media_image1.png Greyscale WU teaches a structure with a first and a second antigen-binding moiety each of which is a humanized Fab molecule, a human IgG Fc domain comprising a first subunit and a second subunit capable of stable association, with the CD3 binding domain (first antigen binding domain) and PLAP binding domain (second binding domain) are fused together, with the antibody further comprising a third antigen binding domain that binds to PLAP. See FIG 1A and p. 5, last paragraph. In addition to the figure description, WU also describes a structure with a linker between the PLAP-binding domain and CD3-binding domain. See Construct #3, p. 15. Regarding claims 6 and 32, WU teaches the use of CROSSFAB approach, which crossovers the constant domain and variable domain and switches the CHI domain and CL domain in the CD3e Fab molecule, which reduces undesired mis-paring. See p. 6, lines 19 – 21. WU also teaches a second antigen binding domain that is a conventional Fab molecule. See FIG 1A and p. 5, last paragraph. Regarding claim 8 and 32, BRUENKER teaches that to improve correct pairing of the light chains with the corresponding heavy chains, mutations were introduced in the human CL (E123R, Q124K) and the human CHI (K147E, K213E) of the TYRP1 binding Fab molecule. See p. 119, lines 3 – 5. Regarding claims 9 and 32, according to the specification, WU teaches a structure LAP h4 VH-CH1- Fc (knob) P329GLA-LA-CD3VH-linker-VL Amino acids of PLAP h4 VH-CH1, see Example 3, part of Construct 3. Regarding claims 10 and 11, WU discloses a structure with (from N-to-C terminus) with PLAP Fab connected to CD3 Fab. See p. 15, Construct #3. Regarding claims 12 and 32, WU discloses mutations of S354C and T366W on one Fc, and the corresponding “hole” is made by mutations of Y349C, T366S, L368A and Y407V on the partner Fc. See p. 7, lines 28 – 30. Regarding claims 18 – 21, WU teaches that the nucleic acid encoding the disclosed bispecific antibody can be inserted into a vector and expressed in mammalian 293 S or CHO cells using serum-free medium and can be purified with protein A or protein G column and used for the study. See p. 9, lines 7 – 10 and p. 10, lines 10 – 32. Regarding claim 29, WU teaches a pharmaceutical composition comprising the bispecific antigen-binding molecule and a pharmaceutically acceptable carrier. See p. 9, lines 5 – 6. Regarding claim 34, BRUENKER teaches a method of treating or delaying progression of an immune related disease, or enhancing or stimulating an immune response or function in an individual (see p. 10, lines 4 – 6) and thus renders the treatment of an autoimmune disease obvious. Double Patenting The nonstatutory double patenting rejection is based on a judicially created doctrine grounded in public policy (a policy reflected in the statute) so as to prevent the unjustified or improper timewise extension of the “right to exclude” granted by a patent and to prevent possible harassment by multiple assignees. A nonstatutory double patenting rejection is appropriate where the conflicting claims are not identical, but at least one examined application claim is not patentably distinct from the reference claim(s) because the examined application claim is either anticipated by, or would have been obvious over, the reference claim(s). See, e.g., In re Berg, 140 F.3d 1428, 46 USPQ2d 1226 (Fed. Cir. 1998); In re Goodman, 11 F.3d 1046, 29 USPQ2d 2010 (Fed. Cir. 1993); In re Longi, 759 F.2d 887, 225 USPQ 645 (Fed. Cir. 1985); In re Van Ornum, 686 F.2d 937, 214 USPQ 761 (CCPA 1982); In re Vogel, 422 F.2d 438, 164 USPQ 619 (CCPA 1970); In re Thorington, 418 F.2d 528, 163 USPQ 644 (CCPA 1969). A timely filed terminal disclaimer in compliance with 37 CFR 1.321(c) or 1.321(d) may be used to overcome an actual or provisional rejection based on nonstatutory double patenting provided the reference application or patent either is shown to be commonly owned with the examined application, or claims an invention made as a result of activities undertaken within the scope of a joint research agreement. See MPEP § 717.02 for applications subject to examination under the first inventor to file provisions of the AIA as explained in MPEP § 2159. See MPEP § 2146 et seq. for applications not subject to examination under the first inventor to file provisions of the AIA . A terminal disclaimer must be signed in compliance with 37 CFR 1.321(b). The filing of a terminal disclaimer by itself is not a complete reply to a nonstatutory double patenting (NSDP) rejection. A complete reply requires that the terminal disclaimer be accompanied by a reply requesting reconsideration of the prior Office action. Even where the NSDP rejection is provisional the reply must be complete. See MPEP § 804, subsection I.B.1. For a reply to a non-final Office action, see 37 CFR 1.111(a). For a reply to final Office action, see 37 CFR 1.113(c). A request for reconsideration while not provided for in 37 CFR 1.113(c) may be filed after final for consideration. See MPEP §§ 706.07(e) and 714.13. The USPTO Internet website contains terminal disclaimer forms which may be used. Please visit www.uspto.gov/patent/patents-forms. The actual filing date of the application in which the form is filed determines what form (e.g., PTO/SB/25, PTO/SB/26, PTO/AIA /25, or PTO/AIA /26) should be used. A web-based eTerminal Disclaimer may be filled out completely online using web-screens. An eTerminal Disclaimer that meets all requirements is auto-processed and approved immediately upon submission. For more information about eTerminal Disclaimers, refer to www.uspto.gov/patents/apply/applying-online/eterminal-disclaimer. Claims 1 – 4, 6, 8 – 12, 16 – 22, 29, and 32 – 34 are rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1 – 91 of U.S. Patent No. 12,466,889 in view of WU and BRUENKER. Patented claim 1 recites a bispecific antibody that binds to human HLA-G and human CD3. Patented claim 22 recites that the bispecific comprises a polypeptide comprising an amino acid sequence that is at least 98% identical to the sequence of SEQ ID NO: 79. Patented claim 40 recites a polypeptide comprising an amino acid sequence that is at least 98% identical to the sequence of SEQ ID NO: 76, wherein the polypeptide comprises, in an N- to C-terminal direction, the VH domain comprising the amino acid sequence of SEQ ID NO: 58. Patented SEQ ID NOs: 79 discloses the CDRs of present SEQ ID NOs: 10 – 12 with 100% identity. Patented SEQ ID NOs: 76 and 58 each discloses the CDRs of present SEQ ID NOs: 2, 3, and 6 with 100% identity. See Appendix. The main difference between the present claims and the patented claims is that the present claims recite that the bispecific antibody binds PLAP instead of HLA-G. However, WU discloses this difference. The teachings of WU and BRUENKER, and how they relate to the claims, are set forth in the rejections under 35 U.S.C. 103 above. Because the patented claims recite a bispecific antibody that binds to human HLA-G and human CD3 (including the CD3-binding CDRs of the present claims) for the treatment of cancer and WU teaches a bispecific antibody that binds to human PLAP and human CD3, it would have been obvious to one having ordinary skill in the art to use the patented claims’ CD3 domain in WU’s bispecific antibody that binds to PLAP and CD3, thereby arriving to the bispecific antibody of the present claims. There would have been a reasonable expectation of success considering that using bispecific antibodies binding T cells and tumor associated antigen is a common approach to bringing cytotoxic T cells to kill cancer cells, as evidenced by the prior art. Claims 1 – 4, 6, 8 – 12, 16 – 22, 29, and 32 – 34 are provisionally rejected on the ground of nonstatutory double patenting as being unpatentable over claims 3, 6, 61 – 114, 116 – 128, and 130 – 131 of copending Application No. 17/448,729 in view of WU and BRUENKER. Copending claim 3 recites a method for treatment of a cancer or an autoimmune disease in an individual, wherein said method comprises;(a) the administration of a T cell bispecific antibody to the individual, wherein the T cell bispecific antibody comprises an Fc domain composed of a first and a second subunit, and (b) the administration of a tyrosine kinase inhibitor (TKI) to the individual for the prevention or mitigation of an adverse effect related to the administration of the T cell bispecific antibodyl wherein the TKI is first administered prior to administration of the T cell bispecific antibody. Copending claim 85 recites that the T cell bispecific antibody comprises an antigen binding moiety that binds to CD3 and an antigen binding moiety that binds to a target cell antigen. Copending claim 90 recites a light chain variable region sequence that is at least about 95% identical to the amino acid sequence of SEQ ID NO: 35. Copending claim 111 recites heavy chain variable region sequence that is at least about 95% identical to the amino acid sequence of SEQ ID NO: 66. Copending SEQ ID NO: 35 discloses the CDRs of present SEQ ID NO: 10 – 12, and copending SEQ ID NO: 66 discloses the CDRs of present SEQ ID NOs: 2, 3, and 6 with 100% identity. See Appendix. The main difference between the present claims and the copending claims is that the present claims recite that the bispecific antibody binds PLAP. However, WU discloses this difference. The teachings of WU and BRUENKER, and how they relate to the claims, are set forth in the rejections under 35 U.S.C. 103 above. Because the copending claims recite a bispecific antibody that binds CD3 (including the CD3-binding CDRs) for the treatment of cancer and WU teaches a bispecific antibody that binds to human PLAP and human CD3, it would have been obvious to one having ordinary skill in the art to use the copending claims’ CD3 domain in WU’s anti-PLAP x anti-CD3 bispecific antibody, thereby arriving to the bispecific antibody of the present claims. There would have been a reasonable expectation of success considering that using bispecific antibodies binding T cells (such as via CD3) and tumor associated antigen (such as PLAP) is the most common approach to design bispecific antibody by bringing cytotoxic T cells to kill cancer cells, as evidenced by applied prior art. This is a provisional nonstatutory double patenting rejection. Claims 1 – 4, 6, 8 – 12, 16 – 22, 29, and 32 – 34 are provisionally rejected on the ground of nonstatutory double patenting as being unpatentable over claims 59 – 60, 63 – 71, and 74 – 103 of copending Application No. 17/454,193 in view of WU and BRUENKER. Copending claim 59 recites a method for preventing or mitigating an adverse effect related to the administration of a T cell bispecific antibody to an individual, comprising administering (a) a T cell bispecific antibody and (b) an inhibitor that inhibits mTOR signaling to the individual, wherein the adverse effect is prevented or mitigated, wherein the T cell bispecific antibody binds to CD3 and a target cell antigen, and wherein the method does not comprise administering a CAR-T cell, and wherein administering the inhibitor that inhibits mTOR signaling causes inhibition of an adverse effect related to administering the T cell bispecific antibody. Copending claim 78 recites that the light chain variable region sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to an amino acid sequence of SEQ ID NO: 11. Copending claim 95 recites that the first antigen binding moiety comprises a heavy chain variable region sequence that is at least about 95%, 96%, 97%, 98%, 99% or 100% identical to an amino acid sequence of SEQ ID NO: 63or SEQ ID NO: 66. Copending SEQ ID NO: 11 discloses the CDRs of present SEQ ID NOs: 10 – 12, and copending SEQ ID NO: 66 discloses the CDRs of present SEQ ID NOs: 2, 3, and 6 with 100% identity. See Appendix. The main difference between the present claims and the copending claims is that the present claims recite that the bispecific antibody binds PLAP. However, WU discloses this difference. The teachings of WU and BRUENKER, and how they relate to the claims, are set forth in the rejections under 35 U.S.C. 103 above. Because the copending claims recite a bispecific antibody that binds CD3 (including the CD3-binding CDRs) for the treatment of cancer and WU teaches a bispecific antibody that binds to human PLAP and human CD3, it would have been obvious to one having ordinary skill in the art to use the copending claims’ CD3 domain in WU’s anti-PLAP x anti-CD3 bispecific antibody, thereby arriving to the bispecific antibody of the present claims. There would have been a reasonable expectation of success considering that using bispecific antibodies binding T cells (such as via CD3) and tumor associated antigen (such as PLAP) is the most common approach to design bispecific antibody by bringing cytotoxic T cells to kill cancer cells, as evidenced by applied prior art. This is a provisional nonstatutory double patenting rejection. Claims 1 – 4, 6, 8 – 12, 16 – 22, 29, and 32 – 34 are provisionally rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1 – 51 of copending Application No. 18/066,529 in view of WU and BRUENKER. Copending claim 1 recites a protease-activatable T cell activating bispecific molecule comprising (a) a first antigen binding moiety capable of binding to CD3. Copending claim 2 recites that the protease-activatable T cell activating bispecific molecule of claim 1, wherein the VH comprises an amino acid sequence that is at least about 95%, 96%, 97%,98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 16, , and/or the VL comprises an amino acid sequence that is at least about 95% 96%, 97%,98%, 99% or 100% identical to the amino acid sequence of SEQ ID NO: 23. Copending SEQ ID NO: 16 discloses the CDRs of present SEQ ID NOs: SEQ ID NOs: 2, 3, and 6, and copending SEQ ID NO: 23 discloses the CDRs of present 10 – 12 with 100% identity. See Appendix. The main difference between the present claims and the copending claims is that the present claims recite that the bispecific antibody binds PLAP. However, WU discloses this difference. The teachings of WU and BRUENKER, and how they relate to the claims, are set forth in the rejections under 35 U.S.C. 103 above. Because the copending claims recite a bispecific antibody that binds CD3 (including the CD3-binding CDRs) for the treatment of cancer and WU teaches a bispecific antibody that binds to human PLAP and human CD3, it would have been obvious to one having ordinary skill in the art to use the copending claims’ CD3 domain in WU’s anti-PLAP x anti-CD3 bispecific antibody, thereby arriving to the bispecific antibody of the present claims. There would have been a reasonable expectation of success considering that using bispecific antibodies binding T cells (such as via CD3) and tumor associated antigen (such as PLAP) is the most common approach to design bispecific antibody by bringing cytotoxic T cells to kill cancer cells, as evidenced by applied prior art. This is a provisional nonstatutory double patenting rejection. Claims 1 – 4, 6, 8 – 12, 16 – 22, 29, and 32 – 34 are provisionally rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1, 9 – 10, 12 – 15, 17, 21 – 22, 24 – 25, 27 – 28, 32 – 33, 38 , 41, 46 – 48, 53 – 55, 57, 62 – 63, 68, 70 – 74, 76, 84 – 86, and 90 of copending Application No. 18/067,330 in view of WU and BRUENKER. Copending claim 1 recites an immune activating fragment crystallizable (Fc) domain binding molecule comprising (a) an Fc domain binding moiety that specifically binds to a target Fc domain comprising a first set of at least one amino acid substitution that reduces binding affinity to an Fc receptor and/or effector function, wherein the first set of at least one amino acid substitution comprises the amino acid substitution P329G (numberings according to Kabat EU index) (b) an immune activating moiety, and(c) a half-life extending Fc domain, wherein the half-life extending Fc domain comprises a second set of at least one amino acid substitution that reduces binding affinity to an Fc receptor and/or effector function, wherein the second set of at least one amino acid substitution comprises a substitution at position P329 by an amino acid other than glycine (G) (numbering according to Kabat EU index), and wherein the Fc domain binding moiety does not specifically bind to the half-life extending Fc domain. Copending claim 38 a second heavy chain comprising the amino acid sequence having at least identity to SEQ ID NO:179. Copending claim 53 recites a heavy chain variable region comprising an amino acid sequence having at least identity to the amino acid sequence of SEQ ID NO: 49. Copending SEQ ID NO: 179 discloses the CDRs of present 10 – 12, and copending SEQ ID NO: 49 discloses the CDRs of present SEQ ID NOs: SEQ ID NOs: 2, 3, and 6, and copending with 100% identity. See Appendix. The main difference between the present claims and the copending claims is that the present claims recite that the bispecific antibody binds PLAP. However, WU discloses this difference. The teachings of WU and BRUENKER, and how they relate to the claims, are set forth in the rejections under 35 U.S.C. 103 above. Because the copending claims recite a bispecific antibody that binds CD3 (including the CD3-binding CDRs) for the treatment of cancer and WU teaches a bispecific antibody that binds to human PLAP and human CD3, it would have been obvious to one having ordinary skill in the art to use the copending claims’ CD3 domain in WU’s anti-PLAP x anti-CD3 bispecific antibody, thereby arriving to the bispecific antibody of the present claims. There would have been a reasonable expectation of success considering that using bispecific antibodies binding T cells (such as via CD3) and tumor associated antigen (such as PLAP) is the most common approach to design bispecific antibody by bringing cytotoxic T cells to kill cancer cells, as evidenced by applied prior art. This is a provisional nonstatutory double patenting rejection. Claims 1 – 4, 6, 8 – 12, 16 – 22, 29, and 32 – 34 are provisionally rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1, 3, 5 – 12, 18, 21 – 25, 30 – 33, and 42 of copending Application No. 18/069,847 in view of WU and BRUENKER. Copending claim 1 recites a bispecific agonistic CD28 antigen binding molecule characterized by monovalent binding to CD28, comprising (a) a first antigen binding domain capable of specific binding to CD28, (b) a second antigen binding domain capable of specific binding to CD3. Copending claim 9 recites that the bispecific agonistic CD28 antigen binding molecule of claim 1, wherein the antigen binding domain capable of specific binding to CD3 comprises the CDRs of the heavy chain variable region (VHCD3) comprising the amino acid sequence of SEQ ID NO:16 and the CDRs of the light chain variable region (VLCD3) comprising the amino acid sequence of SEQ ID NO:17. Copending claim 10 recites that the bispecific agonistic CD28 antigen binding molecule of claim 1,wherein the antigen binding domain capable of specific binding to CD3 comprises a heavy chain variable region (VHCD3) comprising the amino acid sequence of SEQ ID NO:16, and a light chain variable region (VLCD3) comprising the amino acid sequence of SEQ ID NO:17. The main difference between the present claims and the copending claims is that the present claims recite that the bispecific antibody binds PLAP. However, WU discloses this difference. The teachings of WU and BRUENKER, and how they relate to the claims, are set forth in the rejections under 35 U.S.C. 103 above. Because the copending claims recite a bispecific antibody that binds CD3 (including the CD3-binding CDRs) for the treatment of cancer and WU teaches a bispecific antibody that binds to human PLAP and human CD3, it would have been obvious to one having ordinary skill in the art to use the copending claims’ CD3 domain in WU’s anti-PLAP x anti-CD3 bispecific antibody, thereby arriving to the bispecific antibody of the present claims. There would have been a reasonable expectation of success considering that using bispecific antibodies binding T cells (such as via CD3) and tumor associated antigen (such as PLAP) is the most common approach to design bispecific antibody by bringing cytotoxic T cells to kill cancer cells, as evidenced by applied prior art. This is a provisional nonstatutory double patenting rejection. Conclusion No claim is allowed. Any inquiry concerning this communication or earlier communications from the examiner should be directed to ESTELLA M. GUSTILO whose telephone number is (703)756-1706. The examiner can normally be reached Monday - Friday 9:00 AM - 5:00 PM. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, JANET L. EPPS-SMITH can be reached at 571-272-0757. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /ESTELLA M. GUSTILO/Examiner, Art Unit 1646 /PETER J REDDIG/Primary Examiner, Art Unit 1646 APPENDIX Alignment with SEQ ID NOs: 2, 3, and 6 RESULT 1 BKL74815 (NOTE: this sequence has 18 duplicates in the database searched. See complete list at the end of this report) ID BKL74815 standard; protein; 125 AA. XX AC BKL74815; XX DT 16-JUN-2022 (revised) DT 10-FEB-2022 (first entry) XX DE Anti-CD3 antibody CD3opt (P035.093) VH region, SEQ ID 16. XX KW CD3; antibody; antibody production; antibody therapy; cancer; cytostatic; KW heavy chain variable region; immune disorder; immunomodulator; KW therapeutic. XX OS Unidentified. OS Synthetic. XX CC PN WO2021255137-A1. XX CC PD 23-DEC-2021. XX CC PF 17-JUN-2021; 2021WO-EP066335. XX PR 19-JUN-2020; 2020EP-00181072. XX CC PA (HOFF ) HOFFMANN LA ROCHE & CO AG F. CC PA (HOFF ) HOFFMANN LA ROCHE INC. XX CC PI Bruenker P, Carpy Gutierrez Cirlos A, Freimoser-Grundschober A; CC PI Geiger M, Hofer T, Klein C, Moessner E, Neumann C; XX DR WPI; 2021-E8034L/007. XX CC PT Protease-activatable T cell activating bispecific molecule for treating CC PT disease such as cancer, comprises first and second antigen binding CC PT moiety, masking moiety covalently attached to T cell bispecific binding CC PT molecule. XX CC PS Claim 2; SEQ ID NO 16; 181pp; English. XX CC The present invention relates to a novel protease-activatable T cell CC activating bispecific molecule useful for treating disease such as CC cancer. The protease-activatable T cell activating bispecific molecule CC comprises a first antigen binding moiety capable of binding to CD3, a CC second antigen binding moiety capable of binding to a target cell CC antigen, and a masking moiety. The invention further provides: an CC idiotype-specific polypeptide capable of reversibly concealing an anti- CC CD3 antigen binding site of a molecule; a pharmaceutical composition CC comprising the protease-activatable T cell activating bispecific molecule CC or the idiotype-specific polypeptide and a pharmaceutically acceptable CC carrier; an isolated polynucleotide encoding the protease-activatable T CC cell activating bispecific antigen binding molecule or idiotype-specific CC polypeptide; a vector comprising the polynucleotide; a host cell CC comprising the polynucleotide or the vector; a method for producing the CC protease-activatable T cell activating bispecific molecule; the use of CC the protease-activatable T cell activating bispecific molecule or the CC idiotype-specific polypeptide for manufacturing a medicament for treating CC diseases such as cancer, immune related disease or immune response or CC function related disease; and a method for treating diseases in an CC individual by administering a therapeutically effective amount of the CC pharmaceutical composition comprising the protease-activatable T cell CC activating bispecific molecule. CC CC Revised record issued on 16-JUN-2022 : Addition of DWPI-enhanced title CC (PT field). XX SQ Sequence 125 AA; Query Match 87.8%; Score 176.4; Length 125; Best Local Similarity 45.2%; Matches 38; Conservative 0; Mismatches 0; Indels 46; Gaps 2; Qy 1 SYAMN--------------RIRSKYNNYATYYADSVKG---------------------- 24 ||||| ||||||||||||||||||| Db 31 SYAMNWVRQAPGKGLEWVSRIRSKYNNYATYYADSVKGRFTISRDDSKNTLYLQMNSLRA 90 Qy 25 ----------ASNFPASYVSYFAY 38 |||||||||||||| Db 91 EDTAVYYCVRASNFPASYVSYFAY 114 US-18-047-605-58 Filing date in PALM: 2022-10-18 Sequence 58, US/18047605 Publication No. US20230159642A1 GENERAL INFORMATION APPLICANT: Hoffmann-La Roche Inc. (en) TITLE OF INVENTION: Anti-HLA-G antibodies and use thereof (en) FILE REFERENCE: 50474-285002 CURRENT APPLICATION NUMBER: US/18/047,605 CURRENT FILING DATE: 2022-10-18 NUMBER OF SEQ ID NOS: 96 SEQ ID NO 58 LENGTH: 125 TYPE: PRT FEATURE: NAME/KEY: source LOCATION: 1..125 QUALIFIERS: mol_type = protein note = heavy chain variable domain VH, P035-093 organism = synthetic construct ALIGNMENT: Query Match 87.8%; Score 176.4; Length 125; Best Local Similarity 45.2%; Matches 38; Conservative 0; Mismatches 0; Indels 46; Gaps 2; Qy 1 SYAMN--------------RIRSKYNNYATYYADSVKG---------------------- 24 ||||| ||||||||||||||||||| Db 31 SYAMNWVRQAPGKGLEWVSRIRSKYNNYATYYADSVKGRFTISRDDSKNTLYLQMNSLRA 90 Qy 25 ----------ASNFPASYVSYFAY 38 |||||||||||||| Db 91 EDTAVYYCVRASNFPASYVSYFAY 114 US-17-448-729-66 Filing date in PALM: 2021-09-24 Sequence 66, US/17448729 Publication No. US20220088195A1 GENERAL INFORMATION APPLICANT: Hoffmann-La Roche Inc. TITLE OF INVENTION: Prevention or mitigation of T-cell bispecific antibody-related TITLE OF INVENTION: adverse effects FILE REFERENCE: P36412-US CURRENT APPLICATION NUMBER: US/17/448,729 CURRENT FILING DATE: 2021-09-24 PRIOR APPLICATION NUMBER: EP20198050.5 PRIOR FILING DATE: 2020-09-24 PRIOR APPLICATION NUMBER: EP20201583.0 PRIOR FILING DATE: 2020-10-13 PRIOR APPLICATION NUMBER: EP21172627.8 PRIOR FILING DATE: 2021-05-07 NUMBER OF SEQ ID NOS: 81 SEQ ID NO 66 LENGTH: 125 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: Synthetic construct ALIGNMENT: Query Match 87.8%; Score 176.4; Length 125; Best Local Similarity 45.2%; Matches 38; Conservative 0; Mismatches 0; Indels 46; Gaps 2; Qy 1 SYAMN--------------RIRSKYNNYATYYADSVKG---------------------- 24 ||||| ||||||||||||||||||| Db 31 SYAMNWVRQAPGKGLEWVSRIRSKYNNYATYYADSVKGRFTISRDDSKNTLYLQMNSLRA 90 Qy 25 ----------ASNFPASYVSYFAY 38 |||||||||||||| Db 91 EDTAVYYCVRASNFPASYVSYFAY 114 US-17-454-193-66 Filing date in PALM: 2021-11-09 Sequence 66, US/17454193 Publication No. US20220168418A1 GENERAL INFORMATION APPLICANT: Hoffmann-La Roche Inc. TITLE OF INVENTION: Prevention or mitigation of T-cell engaging agent-related adverse TITLE OF INVENTION: effects FILE REFERENCE: P36507-US CURRENT APPLICATION NUMBER: US/17/454,193 CURRENT FILING DATE: 2021-11-09 PRIOR APPLICATION NUMBER: EP20206567.8 PRIOR FILING DATE: 2020-11-10 PRIOR APPLICATION NUMBER: EP21155823.4 PRIOR FILING DATE: 2021-02-08 PRIOR APPLICATION NUMBER: EP21172623.7 PRIOR FILING DATE: 2021-05-07 PRIOR APPLICATION NUMBER: EP21187472.2 PRIOR FILING DATE: 2021-07-23 NUMBER OF SEQ ID NOS: 80 SEQ ID NO 66 LENGTH: 125 TYPE: PRT ORGANISM: Artificial Sequence FEATURE: OTHER INFORMATION: Synthetic construct ALIGNMENT: Query Match 87.8%; Score 176.4; Length 125; Best Local Similarity 45.2%; Matches 38; Conservative 0; Mismatches 0; Indels 46; Gaps 2; Qy 1 SYAMN--------------RIRSKYNNYATYYADSVKG---------------------- 24 ||||| ||||||||||||||||||| Db 31 SYAMNWVRQAPGKGLEWVSRIRSKYNNYATYYADSVKGRFTISRDDSKNTLYLQMNSLRA 90 Qy 25 ----------ASNFPASYVSYFAY 38 |||||||||||||| Db 91 EDTAVYYCVRASNFPASYVSYFAY 114 US-18-047-605-58 Filing date in PALM: 2022-10-18 Sequence 58, US/18047605 Publication No. US20230159642A1 GENERAL INFORMATION APPLICANT: Hoffmann-La Roche Inc. (en) TITLE OF INVENTION: Anti-HLA-G antibodies and use thereof (en) FILE REFERENCE: 50474-285002 CURRENT APPLICATION NUMBER: US/18/047,605 CURRENT FILING DATE: 2022-10-18 NUMBER OF SEQ ID NOS: 96 SEQ ID NO 58 LENGTH: 125 TYPE: PRT FEATURE: NAME/KEY: source LOCATION: 1..125 QUALIFIERS: mol_type = protein note = heavy chain variable domain VH, P035-093 organism = synthetic construct ALIGNMENT: Query Match 87.8%; Score 176.4; Length 125; Best Local Similarity 45.2%; Matches 38; Conservative 0; Mismatches 0; Indels 46; Gaps 2; Qy 1 SYAMN--------------RIRSKYNNYATYYADSVKG---------------------- 24 ||||| ||||||||||||||||||| Db 31 SYAMNWVRQAPGKGLEWVSRIRSKYNNYATYYADSVKGRFTISRDDSKNTLYLQMNSLRA 90 Qy 25 ----------ASNFPASYVSYFAY 38 |||||||||||||| Db 91 EDTAVYYCVRASNFPASYVSYFAY 114 US-18-047-605-76 Filing date in PALM: 2022-10-18 Sequence 76, US/18047605 Publication No. US20230159642A1 GENERAL INFORMATION APPLICANT: Hoffmann-La Roche Inc. (en) TITLE OF INVENTION: Anti-HLA-G antibodies and use thereof (en) FILE REFERENCE: 50474-285002 CURRENT APPLICATION NUMBER: US/18/047,605 CURRENT FILING DATE: 2022-10-18 NUMBER OF SEQ ID NOS: 96 SEQ ID NO 76 LENGTH: 232 TYPE: PRT FEATURE: NAME/KEY: source LOCATION: 1..232 QUALIFIERS: mol_type = protein note = light chain 1 P1AF7977 organism = synthetic construct ALIGNMENT: Query Match 87.8%; Score 176.4; Length 232; Best Local Similarity 45.2%; Matches 38; Conservative 0; Mismatches 0; Indels 46; Gaps 2; Qy 1 SYAMN--------------RIRSKYNNYATYYADSVKG---------------------- 24 ||||| ||||||||||||||||||| Db 31 SYAMNWVRQAPGKGLEWVSRIRSKYNNYATYYADSVKGRFTISRDDSKNTLYLQMNSLRA 90 Qy 25 ----------ASNFPASYVSYFAY 38 |||||||||||||| Db 91 EDTAVYYCVRASNFPASYVSYFAY 114 US-18-066-529-16 Filing date in PALM: 2022-12-15 Sequence 16, US/18066529 Publication No. US20230287145A1 GENERAL INFORMATION APPLICANT: Hoffmann-La Roche Inc. (en) TITLE OF INVENTION: Protease-activated T cell bispecific antibodies (en) FILE REFERENCE: P36114-US CURRENT APPLICATION NUMBER: US/18/066,529 CURRENT FILING DATE: 2022-12-15 NUMBER OF SEQ ID NOS: 127 SEQ ID NO 16 LENGTH: 125 TYPE: PRT FEATURE: NAME/KEY: REGION LOCATION: 1..125 QUALIFIERS: note = CD3opt VH (P035.093) ALIGNMENT: Query Match 87.8%; Score 176.4; Length 125; Best Local Similarity 45.2%; Matches 38; Conservative 0; Mismatches 0; Indels 46; Gaps 2; Qy 1 SYAMN--------------RIRSKYNNYATYYADSVKG---------------------- 24 ||||| ||||||||||||||||||| Db 31 SYAMNWVRQAPGKGLEWVSRIRSKYNNYATYYADSVKGRFTISRDDSKNTLYLQMNSLRA 90 Qy 25 ----------ASNFPASYVSYFAY 38 |||||||||||||| Db 91 EDTAVYYCVRASNFPASYVSYFAY 114 US-18-067-330-49 Filing date in PALM: 2022-12-16 Sequence 49, US/18067330 Publication No. US20240043535A1 GENERAL INFORMATION APPLICANT: Hoffmann-La Roche Inc. (en) TITLE OF INVENTION: Immune activating Fc domain binding molecules (en) FILE REFERENCE: P36106-US CURRENT APPLICATION NUMBER: US/18/067,330 CURRENT FILING DATE: 2022-12-16 NUMBER OF SEQ ID NOS: 180 SEQ ID NO 49 LENGTH: 125 TYPE: PRT FEATURE: NAME/KEY: REGION LOCATION: 1..125 QUALIFIERS: note = Synthetic construct FEATURE: NAME/KEY: source LOCATION: 1..125 QUALIFIERS: mol_type = protein organism = synthetic construct ALIGNMENT: Query Match 87.8%; Score 176.4; Length 125; Best Local Similarity 45.2%; Matches 38; Conservative 0; Mismatches 0; Indels 46; Gaps 2; Qy 1 SYAMN--------------RIRSKYNNYATYYADSVKG---------------------- 24 ||||| ||||||||||||||||||| Db 31 SYAMNWVRQAPGKGLEWVSRIRSKYNNYATYYADSVKGRFTISRDDSKNTLYLQMNSLRA 90 Qy 25 ----------ASNFPASYVSYFAY 38 |||||||||||||| Db 91 EDTAVYYCVRASNFPASYVSYFAY 114 US-18-067-330-70 Filing date in PALM: 2022-12-16 Sequence 70, US/18067330 Publication No. US20240043535A1 GENERAL INFORMATION APPLICANT: Hoffmann-La Roche Inc. (en) TITLE OF INVENTION: Immune activating Fc domain binding molecules (en) FILE REFERENCE: P36106-US CURRENT APPLICATION NUMBER: US/18/067,330 CURRENT FILING DATE: 2022-12-16 NUMBER OF SEQ ID NOS: 180 SEQ ID NO 70 LENGTH: 232 TYPE: PRT FEATURE: NAME/KEY: REGION LOCATION: 1..232 QUALIFIERS: note = Synthetic construct ALIGNMENT: Query Match 87.8%; Score 176.4; Length 232; Best Local Similarity 45.2%; Matches 38; Conservative 0; Mismatches 0; Indels 46; Gaps 2; Qy 1 SYAMN--------------RIRSKYNNYATYYADSVKG---------------------- 24 ||||| ||||||||||||||||||| Db 31 SYAMNWVRQAPGKGLEWVSRIRSKYNNYATYYADSVKGRFTISRDDSKNTLYLQMNSLRA 90 Qy 25 ----------ASNFPASYVSYFAY 38 |||||||||||||| Db 91 EDTAVYYCVRASNFPASYVSYFAY 114 US-18-069-847-16 Filing date in PALM: 2022-12-21 Sequence 16, US/18069847 Publication No. US20230416366A1 GENERAL INFORMATION APPLICANT: Hoffmann-La Roche Inc. (en) TITLE OF INVENTION: Anti-CD3/anti-CD28 bispecific antigen binding molecules (en) FILE REFERENCE: P36198-US CURRENT APPLICATION NUMBER: US/18/069,847 CURRENT FILING DATE: 2022-12-21 NUMBER OF SEQ ID NOS: 212 SEQ ID NO 16 LENGTH: 125 TYPE: PRT FEATURE: NAME/KEY: REGION LOCATION: 1..125 QUALIFIERS: note = heavy chain variable domain VH, CD3 (P035.093) FEATURE: NAME/KEY: source LOCATION: 1..125 QUALIFIERS: mol_type = protein organism = synthetic construct ALIGNMENT: Query Match 87.8%; Score 176.4; Length 125; Best Local Similarity 45.2%; Matches 38; Conservative 0; Mismatches 0; Indels 46; Gaps 2; Qy 1 SYAMN--------------RIRSKYNNYATYYADSVKG---------------------- 24 ||||| ||||||||||||||||||| Db 31 SYAMNWVRQAPGKGLEWVSRIRSKYNNYATYYADSVKGRFTISRDDSKNTLYLQMNSLRA 90 Qy 25 ----------ASNFPASYVSYFAY 38 |||||||||||||| Db 91 EDTAVYYCVRASNFPASYVSYFAY 114 Alignment with SEQ ID NOs: 10 – 12 BKL74822 ID BKL74822 standard; protein; 109 AA. XX AC BKL74822; XX DT 16-JUN-2022 (revised) DT 10-FEB-2022 (first entry) XX DE Anti-CD3 antibody CD3orig/CD3opt VL region, SEQ ID 23. XX KW CD3; antibody; antibody production; antibody therapy; cancer; cytostatic; KW immune disorder; immunomodulator; light chain variable region; KW therapeutic. XX OS Unidentified. OS Synthetic. XX CC PN WO2021255137-A1. XX CC PD 23-DEC-2021. XX CC PF 17-JUN-2021; 2021WO-EP066335. XX PR 19-JUN-2020; 2020EP-00181072. XX CC PA (HOFF ) HOFFMANN LA ROCHE & CO AG F. CC PA (HOFF ) HOFFMANN LA ROCHE INC. XX CC PI Bruenker P, Carpy Gutierrez Cirlos A, Freimoser-Grundschober A; CC PI Geiger M, Hofer T, Klein C, Moessner E, Neumann C; XX DR WPI; 2021-E8034L/007. XX CC PT Protease-activatable T cell activating bispecific molecule for treating CC PT disease such as cancer, comprises first and second antigen binding CC PT moiety, masking moiety covalently attached to T cell bispecific binding CC PT molecule. XX CC PS Claim 2; SEQ ID NO 23; 181pp; English. XX CC The present invention relates to a novel protease-activatable T cell CC activating bispecific molecule useful for treating disease such as CC cancer. The protease-activatable T cell activating bispecific molecule CC comprises a first antigen binding moiety capable of binding to CD3, a CC second antigen binding moiety capable of binding to a target cell CC antigen, and a masking moiety. The invention further provides: an CC idiotype-specific polypeptide capable of reversibly concealing an anti- CC CD3 antigen binding site of a molecule; a pharmaceutical composition CC comprising the protease-activatable T cell activating bispecific molecule CC or the idiotype-specific polypeptide and a pharmaceutically acceptable CC carrier; an isolated polynucleotide encoding the protease-activatable T CC cell activating bispecific antigen binding molecule or idiotype-specific CC polypeptide; a vector comprising the polynucleotide; a host cell CC comprising the polynucleotide or the vector; a method for producing the CC protease-activatable T cell activating bispecific molecule; the use of CC the protease-activatable T cell activating bispecific molecule or the CC idiotype-specific polypeptide for manufacturing a medicament for treating CC diseases such as cancer, immune related disease or immune response or CC function related disease; and a method for treating diseases in an CC individual by administering a therapeutically effective amount of the CC pharmaceutical composition comprising the protease-activatable T cell CC activating bispecific molecule. CC CC Revised record issued on 16-JUN-2022 : Addition of DWPI-enhanced title CC (PT field). XX SQ Sequence 109 AA; ALIGNMENT: Query Match 84.8%; Score 138.3; Length 109; Best Local Similarity 39.0%; Matches 30; Conservative 0; Mismatches 0; Indels 47; Gaps 2; Qy 1 GSSTGAVTTSNYAN---------------GTNKRAP------------------------ 21 |||||||||||||| ||||||| Db 23 GSSTGAVTTSNYANWVQEKPGQAFRGLIGGTNKRAPGTPARFSGSLLGGKAALTLSGAQP 82 Qy 22 --------ALWYSNLWV 30 ||||||||| Db 83 EDEAEYYCALWYSNLWV 99 US-18-047-605-79 Filing date in PALM: 2022-10-18 Sequence 79, US/18047605 Publication No. US20230159642A1 GENERAL INFORMATION APPLICANT: Hoffmann-La Roche Inc. (en) TITLE OF INVENTION: Anti-HLA-G antibodies and use thereof (en) FILE REFERENCE: 50474-285002 CURRENT APPLICATION NUMBER: US/18/047,605 CURRENT FILING DATE: 2022-10-18 NUMBER OF SEQ ID NOS: 96 SEQ ID NO 79 LENGTH: 674 TYPE: PRT FEATURE: NAME/KEY: source LOCATION: 1..674 QUALIFIERS: mol_type = protein note = heavy chain 2 P1AF7977 organism = synthetic construct ALIGNMENT: Query Match 84.8%; Score 138.3; Length 674; Best Local Similarity 39.0%; Matches 30; Conservative 0; Mismatches 0; Indels 47; Gaps 2; Qy 1 GSSTGAVTTSNYAN---------------GTNKRAP------------------------
Read full office action

Prosecution Timeline

Dec 08, 2022
Application Filed
Dec 10, 2025
Non-Final Rejection — §103, §112, §DP (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12595306
TREM2 STABILIZING ANTIBODIES
2y 5m to grant Granted Apr 07, 2026
Patent 12583925
BISPECIFIC ANTIBODIES TARGETING PD1 AND VEGF
2y 5m to grant Granted Mar 24, 2026
Patent 12576133
ANTIGEN-BINDING AGENTS THAT SPECIFICALLY BIND EPIDERMAL GROWTH FACTOR RECEPTOR VARIANT III
2y 5m to grant Granted Mar 17, 2026
Patent 12559544
ANTIBODIES THAT BIND HUMAN METAPNEUMOVIRUS FUSION PROTEIN AND THEIR USE
2y 5m to grant Granted Feb 24, 2026
Patent 12558406
ANTI-TIGIT ANTIBODIES AND USE THEREOF
2y 5m to grant Granted Feb 24, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

AI Strategy Recommendation

Get an AI-powered prosecution strategy using examiner precedents, rejection analysis, and claim mapping.
Powered by AI — typically takes 5-10 seconds

Prosecution Projections

1-2
Expected OA Rounds
53%
Grant Probability
87%
With Interview (+34.4%)
3y 4m
Median Time to Grant
Low
PTA Risk
Based on 53 resolved cases by this examiner. Grant probability derived from career allow rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month