DETAILED ACTION
Notice of Pre-AIA or AIA Status
The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA .
In the event the determination of the status of the application as subject to AIA 35 U.S.C. 102 and 103 (or as subject to pre-AIA 35 U.S.C. 102 and 103) is incorrect, any correction of the statutory basis for the rejection will not be considered a new ground of rejection if the prior art relied upon, and the rationale supporting the rejection, would be the same under either status.
Priority
The instant application, filed 03/14/2023, is a 371 filing of PCT/US2021/041608, filed 09/27/2021, and claims domestic benefit to US provisional application 63/085,931, filed 09/30/2020.
Status of Application, Amendments, and/or Claims
Applicant’s amendment in the response of 04/28/2026 is acknowledged. Claims 540, 542-546, 549, and 557-558 are amended and claims 1-539 and 541 are cancelled. Claims 540 and 542-559 are currently pending and are examined on the merits herein.
Withdrawn Objections and Rejections
In the office action of 10/29/2025,
The drawings were objected to. Applicant’s submission of replacement drawings has overcome the objection and the objection is withdrawn.
Claim 545 was objected to for informalities. The amendment to the claim to add a period at the end has overcome the objection and the objection is withdrawn.
Claim 557 was objected to for informalities. Applicant’s amendment to the claim has overcome the objection and the objection is withdrawn.
Claims 542, 544-546, and 557-559 were rejected under 35 USC 112(b). Applicant’s amendment to the claims to either remove “or a fragment thereof” or to clarify that the percent identity is either to the whole sequence or the fragment of the sequence has overcome the rejections and the rejections are withdrawn.
Claim 543 was rejected under 35 USC 112(b). Applicant’s amendment to the claim to recite that the first CAR further comprises one or more extracellular spacers has overcome the rejection and the rejection is withdrawn.
Claim 545 was rejected under 35 USC 112(b). Applicant’s amendment to the claim to include the conjunction “or” between the limitations, to remove the “or” at the end of the claim and to clarify that the CD3 zeta signaling domain recited is of the first and/or second CAR polypeptide has overcome the rejection and the rejection is withdrawn.
Claim 549 was rejected under 35 USC 112(b). Applicant’s amendment to change “an immune effector cells” to “the immune effector cells” has overcome the rejection and the rejection is withdrawn.
Claims 544, 546, and 557-559 were rejected under 35 USC 112(a). Applicant’s amendment to the claims to recite that the CAR or that the variable heavy and light chain amino acid sequences comprise the native anti-MUC18 antibody CDR sequences or to remove the percent identity has overcome the rejection sand the rejections are withdrawn.
Claims 540-541, 543-544, and 547-549 were rejected under 35 USC 103 over US’108. Applicant’s amendment to independent claim 540 to limit the first CAR as binding MUC18 has overcome the rejections and the rejections are withdrawn.
Claim 541 was rejected under 35 USC 103 over US’190 in view of US’108 and US’804. The cancellation of the claim has rendered the rejection moot and the rejection is withdrawn.
Claims 557-559 were rejected under 35 USC 103. Applicant’s amendment to independent claim 557 to further require a second CAR polypeptide comprising an NKG2D receptor or fragment of an NKG2D receptor has overcome the rejections and the rejections are withdrawn.
The following grounds of rejections are either maintained, modified, or new as necessitated by applicant’s amendment to the claims.
Claim Rejections - 35 USC § 112(a)
The following is a quotation of the first paragraph of 35 U.S.C. 112(a):
(a) IN GENERAL.—The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor or joint inventor of carrying out the invention.
The following is a quotation of the first paragraph of pre-AIA 35 U.S.C. 112:
The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor of carrying out his invention.
Claim 542 is rejected under 35 U.S.C. 112(a) or 35 U.S.C. 112 (pre-AIA ), first paragraph, as failing to comply with the written description requirement. The claim(s) contains subject matter which was not described in the specification in such a way as to reasonably convey to one skilled in the relevant art that the inventor or a joint inventor, or for applications subject to pre-AIA 35 U.S.C. 112, the inventor(s), at the time the application was filed, had possession of the claimed invention.
Claim 542 depends on claim 540 and, as amended, limits the variable heavy chain and variable light chain amino acid sequences as having “at least about 95% sequence identity” to SEQ ID NOs: 2 and 4, respectively or “at least 95% sequence identity” to a fragment of SEQ ID NOs: 2 and 4. The claim has also been amended to recite “wherein SEQ ID NO: 2 or the fragment of SEQ ID NO: 2 comprises native anti-MUC18 antibody CDR sequences” and the same for SEQ ID NO: 4.
In the broadest reasonable interpretation of the claim, the claim still encompasses a genus of antibodies, or fragments thereof, in which modifications can be made within the CDRs of the antibody. Specifically, the claim limits SEQ ID NOs: 2 and 4 as requiring the native anti-MUC18 CDRs, but also encompasses antibodies and binding fragments with at least 95% identity to these sequences.
The instant disclosure, however, does not describe a representative number of species of the claimed genus performing the claimed functions, nor does the disclosure identify a structure-function relationship that could be used to predictably identify which of the claimed amino acid sequences could modified or fragmented in what way while maintaining the claimed functions. This is particularly the case as the claims do not require a full complement of 6 CDRs, specifically 3 from the heavy chain variable region and 3 from the light chain variable region, which are the art recognized binding region of antibodies and antibody fragments.
The examples of the instant disclosure studied the effects of NK cells modified with a retroviral vector to express a chimeric NKG2D receptor (NKG2D.ζ), which comprises the extracellular domain of the native NKG2D molecule fused to the intracellular cytotoxic ζ-chain of the T cell receptor (page 126, [0495]). The examples further studied the use of the NKG2D.ζ receptor in combination with GD2.CAR-T cells. In the study, NKG2D.ζ NK cells were infused followed by GD2.CAR T cells (page 131, [0504]). Further studied is the combination of NKG2D.ζ with a MUC18-targeting CAR (page 136, Example 2, [0515]).
The examples of the instant disclosure demonstrate the application of a single species of the claimed antibody/CAR binding to a cancer associated antigen and/or MUC18. As such, the disclosure does not provide a representative number of species of the antibody/CAR where the heavy and light chain variable regions have up to 20% modification or comprise only a fragment of the claimed sequences while maintaining binding function.
The state of the art around the effective filing date of the claimed invention also does not provide a representative number of species or a predictable structure-function relationship to support the full scope of the claimed genus.
For example, Chiu, M.L., et al (2019) Antibody structure and function: The basis for engineering therapeutics Antibodies 8(55); 1-80 teaches that, the antigen-binding site of immunoglobulins is formed by the pairing of the variable domains (VH and VL) of the Fab region. Chiu teaches that each domain contributes three complementarity determining regions (CDRs), specifically, three from the VL and three from the VH, and that the six CDR loops are in proximity to each other resulting from the orientation of the VL and VH regions. Chiu teaches that the configuration of the VL and VH brings the three CDRs of the VL and VH domains together to form the antigen-binding site (page 4, paragraph 2). These teachings of Chiu demonstrate that the interaction between the heavy and light chain variable domains effect the conformation of the binding region of the antibody and therefore the antibody’s ability to bind to its target. Furthermore, the teachings of Chiu point out that the binding site is formed by the combination of the heavy and light chain CDRs (six regions) together. Based on these teachings, an ordinarily skilled artisan would not have been able to predictably identify which species of the instantly claimed genus would be capable of performing the claimed functions. This is particularly the case in the absence of a full complement of heavy and light chain CDRs.
Rabia, L., et al (2018) Understanding and overcoming trade-offs between antibody affinity, specificity, stability, and solubility Biochem Eng. J. 15(137); 365-374 discusses similar challenges faced during antibody optimization. Rabia discusses the challenges with optimizing antibody properties and states that “natural antibody affinity maturation relies on the introduction of somatic mutations followed by clonal selection of antibody variants with improved affinity. However, not all somatic mutations contribute to antibody affinity… antibodies accumulate some somatic mutations to increase affinity and others to compensate for the destabilizing effects of affinity-enhancing mutations” (page 2, paragraph 4). Rabia further provides an example of researchers who introduced mutations throughout variable frameworks and CDRs and created libraries to sort antibody variants with high antigen binding. In this case an antibody was identified that displayed increased affinity but had a significant reduction in stability (page 3, paragraph 2). Rabia concludes by stating that “a final key area of future work is the development of improved computational methods for predicting mutations in antibody CDRs and frameworks that co-optimize multiple antibody properties” and that “future efforts will also need to improve structural predictions of antibody CDRs – especially the long and highly variable heavy chain CDR3 – to accurately predict CDR mutations that are beneficial to different antibody properties” (page 9, paragraph 4 – page 10 paragraph 2).
Based on the teachings of Rabia, introducing mutations in the antibody structure, particularly in the CDR regions, is not a predictable task and requires experimentation following mutation to ensure that the binding affinity is maintained and a specific, stable antibody is created. Rabia further spoke to the use of libraries and computational methods for predicting and co-optimizing antibody properties and teaches that these methods are not robust enough yet to yield predictable results. These teachings demonstrate that a modification to even one amino acid of an antibody, particularly in the CDRs, would likely result in an antibody/CAR that is not suitable for binding to MUC18 or a cancer-associated antigen, as recited in the instant claims.
Rojas, G. (2022) Understanding and Modulating Antibody Fine Specificity: Lessons from Combinatorial Biology Antibodies 11(48); 1-22, which was published two years after the effective filing date of the claimed invention, demonstrates that antibody structure and function were still not predictable years after the effective filing date. For instance, Rojas teaches that epitope mapping results using mutagenesis scanning challenge our notions of conservative and nonconservative amino acid replacements. Several measures have been proposed to evaluate the difference between amino acids, based on physico-chemical distance between them, mutational distance, or evolutionary exchangeability. Tolerability profile to mutations within functional epitopes does not adjust strictly to any of these rules. The critical attributes of each amino acid that should be kept to maintain recognition depend on the particular antibody. For instance, sometimes only tyrosine and phenylalanine residues can be exchanged without effecting antigenicity, pointing to the relevance of their almost-identical aromatic rings, whereas in other epitopes, tyrosine and histidine are exchangeable, reflecting that two different rings can fulfill a similar functional role (page 11, paragraph 1). Teachings which demonstrate that even years after the effective filing date of the claimed invention even modifications using conservative substitution were not predictable.
It is not evident from the disclosure, or the prior art, that applicant was in possession of a representative number of species supporting the entire genus of antibodies/CDRs that are encompassed by the instant the claims. Additionally, there is no disclosed or art recognized structure-function relationship between antibody structure and functionality which would allow for the predictable modification or fragmentation of the claimed sequences while maintaining the claimed binding functions. Therefore, the instant claims were found to not meet the written description requirement.
Response to Arguments
Applicant’s arguments in the response filed 04/28/2026 regarding the rejection of claim 542 under 35 USC 112(a) written description have been fully considered, but are not persuasive.
Applicant argues that the claim has been amended to specify that SEQ ID NO: [], presumably referring to SEQ ID NOs: 2 and 4 or the fragment of SEQ ID NO: [] comprises native anti-MUC18 antibody CDR sequences. Applicant also argues that a POSITA would reasonably expect a CAR that comprises at least the native CDRs of the antibody to bind MUC18.
As discussed in the modified rejection above, the amended claim limits the heavy and light chain variable regions of SEQ ID NOs: 2 and 4 to having the native CDRs of the antibody, but encompasses embodiments in which the anti-MUC18 antibody can have 95% identity to SEQ ID NOs: 2 and 4. The claim does not necessarily limit the VH or VL to comprising the native anti-MUC18 CDR sequences. In the broadest reasonable interpretation of the claim the claim still encompasses heavy and light chain variable regions in which the CDRs can be modified.
However, it is agreed that, if the heavy and light chain variable region CDRs were limited to the native MUC18 antibody CDRs, for instance as claim 557 has been amended to recite, an ordinarily skilled artisan would reasonably expect that the binding domain would bind to MUC18 and such amendment would overcome the rejection.
Claim Rejections - 35 USC § 103
The following is a quotation of 35 U.S.C. 103 which forms the basis for all obviousness rejections set forth in this Office action:
A patent for a claimed invention may not be obtained, notwithstanding that the claimed invention is not identically disclosed as set forth in section 102, if the differences between the claimed invention and the prior art are such that the claimed invention as a whole would have been obvious before the effective filing date of the claimed invention to a person having ordinary skill in the art to which the claimed invention pertains. Patentability shall not be negated by the manner in which the invention was made.
The factual inquiries for establishing a background for determining obviousness under 35 U.S.C. 103 are summarized as follows:
1. Determining the scope and contents of the prior art.
2. Ascertaining the differences between the prior art and the claims at issue.
3. Resolving the level of ordinary skill in the pertinent art.
4. Considering objective evidence present in the application indicating obviousness or nonobviousness.
This application currently names joint inventors. In considering patentability of the claims the examiner presumes that the subject matter of the various claims was commonly owned as of the effective filing date of the claimed invention(s) absent any evidence to the contrary. Applicant is advised of the obligation under 37 CFR 1.56 to point out the inventor and effective filing dates of each claim that was not commonly owned as of the effective filing date of the later invention in order for the examiner to consider the applicability of 35 U.S.C. 102(b)(2)(C) for any potential 35 U.S.C. 102(a)(2) prior art against the later invention.
Claims 540, 543-545, 547-550, and 552-556 are rejected under 35 U.S.C. 103 as being unpatentable over WO 2020/132190 A1 (Hou, B., et al) 25 JUN 2020 in view of US 2019/0255108 A1 (Yupo, M. et al) 22 Aug 2019 and US 10,336,804 B2 (Zhang, T. and C.L. Sentman) 2 Jul 2019.
WO’190 teaches antibodies that bind to MUC18, also known as CD146 or melanoma cell adhesion molecule (MCAM). MUC18 is a transmembrane glycoprotein that functions primarily in cell adhesion (page 1, lines 4-5).
WO’190 further teaches chimeric antigen receptors (CAR) targeting MUC18 and immune cells expressing the CARs. The CARs are artificial cell-surface receptors that redirect binding specificity of immune cells to MUC18+ expressing cells, such as epithelium-derived cancer cells, thereby eliminating the target disease cells via, e.g., the effector activity of the immune cell. A CAR construct often comprises an extracellular antigen binding domain fused to at least an intracellular signaling domain. The extracellular antigen binding domain, which can be a single-chain antibody fragment (scFv), is specific to a MUC18 antigen and the intracellular signaling domain can mediate a cell signal that leads to activation of the immune cells. As such, immune cells expressing a car construct specific to MUC18 can bind to diseased cells, such as tumor cells, expressing MUC18, leading to activation of the immune cells and elimination of the diseased cells (page 27, lines 7-18).
WO’190 teaches that the disclosed anti-MUC18 antibodies can be used to produce the CAR constructs. For example, the VH and VL domains of the antibody can be fused to the intracellular signaling domain(s) to produce a CAR construct using conventional recombinant technology. In some examples, the VH and VL domains are connected via a peptide linker to form an scFv fragment (page 27, lines 19-23).
The CAR constructs may comprise one or more intracellular signaling domains. In some examples, the CAR comprises an intracellular signaling domain that includes an immunoreceptor tyrosine-based activation motif (ITAM). Such an intracellular signaling domain may be from Cd3ζ. In addition, the CAR may further comprise one or more co-stimulatory domains, which may be from a co-stimulatory receptor, for example, from 4-1BB (CD137), CD7, CD27, CD28, CD40, OX40, ICOS, GITR, HVEM, TIM1, or LFA-1 (page 27, lines 24-30).
The CAR may further comprise a transmembrane-hinge domain, which can be obtained from a suitable cell surface receptor, for example CD28 or CD8 (page 28, lines 1-3).
Also provided are isolated nucleic acid molecules and vectors encoding any of the anti-MUC18 CARs and host cells, such as host immune cells, e.g., T cells and natural killer cells, comprising the nucleic acid molecules or vectors. Immune cells expressing anti-MUC18 CARs, can be used for the treatment of cancers that express MUC18. Thus, also provided are methods of treating a subject with MUC18+ cancer, by selecting a subject with a cancer that expresses MUC18 and administering to the subject a therapeutically effective amount of the immune cells expressing the MUC18-targeted CAR (page 28, lines 4-11).
WO’190 further teaches pharmaceutical compositions comprising the immune cells expressing MUC18-targeting CARs mixed with a pharmaceutically acceptable carrier/excipient to form compositions for use in treating a target disease (page 28, lines 13-18).
WO’190 teaches that the immune cells, e.g., T cells and NK cells, expressing the anti-MUC18 targeting CARs are useful for inhibiting and/or eliminating MUC18+ disease cells, such as MUC18+ cancer cells, thereby benefiting treatment of a disease or disorder associated with the MUC18+ disease cells (page 32, lines 1-8). To practice the method, an effective amount of the pharmaceutical composition is administered to a subject in need of treatment via a suitable route (page 32, lines 9-14). A human subject who needs the treatment may be a human patient having, at risk for, or suspected of having a target disease/disorder associated with MUC18+ disease cells. In some embodiments, the MUC18+ disease cells are cancer cells, for example, epithelial cancer cells, i.e., derived from epithelial cells. Examples include, but are not limited to, ovarian cancer cells, breast cancer cells, renal cancer cells, lung cancer cells, colorectal cancer cells, and brain cancer cells (page 32, lines 19-27). WO’190 further teaches the treatment of melanoma (page 46, Example 3; page 1, lines 1-10). It is noted that the instant specification states “wherein the carcinoma comprises melanoma” (page 10, [0027]), indicating that melanoma meets the limitations of the cancer being a carcinoma. Additionally, carcinomas are cancer cells derived from epithelial cells indicating that the cancers taught by WO’190 also meet the limitation of the cancer being a carcinoma.
WO’190 further teaches that, when immune cells expressing a MUC18-targeting CAR are used for disease treatment, patients can be treated by infusing therapeutically effective doses of such immune cells, such as T cells or NK cells, in the range of about 105 to 1010 or more cells per kilogram of body weight (cells/Kg). This infusion can be repeated as often and as many times as the patient can tolerate until a desired response is achieved. The appropriate infusion dose and schedule will vary from patient to patient, but can be determined by the treating physician for a particular patient. Typically, initial doses of approximately 106 cells/Kg will be infused, escalating to 108 or more cells/Kg (page 38, lines 17-26). The dosages taught by WO’190 overlap with (105 to 1010 cells/kg of body weight) or lie inside of (106 cells/kg and 108 cells/Kg) the range claimed in instant claim 553 rendering the claimed range obvious per MPEP 2144.05 (I).
WO’190 exemplifies preparation and in vitro evaluation of anti-MUC18 CAR+ T cells in Example 2, starting on page 45. In the example, humanized CL070325 anti-MUC18 antibodies (VH and VL) were inserted into a chimeric antigen receptor vector in frame with a CD8 hinge region, a CD8 transmembrane region, an intracellular domain of the co-stimulatory 4-1BB, and an intracellular domain of CD3ζ. The vector further comprises an EF1α promotor. Nucleic acids encoding the anti-MUC18 CAR+ were transfected using lentiviral packaging into 293T cells. Human CD3+ T cells were then activated and transduced with lentivirus to produce anti-MUC18 CAR+ T cells (page 45, lines 16-23). The ability of the CAR T cells to induce antigen dependent cytotoxicity and IFNγ secretion in MUC18+ melanoma cell lines was studied. Specific lysis/cytotoxicity was also assessed. In all MUC18+ cell lines, the addition of the CAR T cells induced antigen dependent cytotoxicity compared to control experiments that led to no significant induction of specific toxicity (page 45, line 16 – page 46, line 18). WO’190 further performed in vivo evaluation of the anti-MUC18+ CAR T cells (page 46, starting on line 20). Mice treated with the anti-MUC18 CAR+ T cells had a reduction in tumor growth relative to controls. Sustained reduction in melanoma cells were observed through day 21 of the experiment (page 46, line 20 – page 47, line 10).
WO’190 differs from the instantly claimed invention in that WO’190 does not disclose that the anti-MUC18 CAR is in a composition with a second CAR polypeptide comprising an NKG2D receptor or fragment thereof and a CD3 zeta signaling domain.
US’108 teaches compositions and methods relating to chimeric antigen (CAR) polypeptides and engineered cells having CAR polypeptides directed to at least two targets (abstract). US’108 teaches compound CARs (cCAR) having at least two complete and distinct chimeric antigen receptor polypeptides. As used in the disclosure, “distinct chimeric antigen receptor polypeptides” has a unique antigen recognition domain, a signal peptide, a hinge region, a transmembrane domain, at least one costimulatory domain, and a signaling domain (page 19, [0291]).
US’108 teaches a CD123-NKG2D cCAR, a CLL-1- NKG2D cCAR, a CD33-NKG2D cCAR, and a BCMA-NKG2D cCAR (page 25, [0382]-[0388]).
US’108 teaches that NKG2D, the NKG2D receptor, is a transmembrane protein belonging to the CD94/NKG2 family of C-type lectin-like receptors. NKG2D can bind to at least 8 different ligands that are naturally expressed in AML, multiple myeloma, or other leukemias. NKG2D ligands are induced-self proteins which are virtually absent or present only at very low levels on the surface of normal cells, but are overexpressed in cancer cells. Therefore, they are good candidates for CAR targeting (page 25, [0382]).
A cCAR contains two units of CARs, for instance a CD123 CAR and NKG2D CAR that targets tumor cells expressing CD123 and NKG2D ligands, respectively (page 25, [0383]). US’108 teaches that the addition of NKG2D as a target to CD123, CLL-1, or CD33 CARs enhances the antitumor response and reduces the risk of antigen escape associated with disease relapse because NKG2D is widely expressed in AML, MDS, CML, and MPN. BCMA and NKG2D ligands are both widely expressed on multiple myeloma cells and this high expression allows the BCMA-NKG2D cCAR to have a comprehensive coverage of all potentially cancerous cells. This allows for a more complete elimination of cancerous cells to reduce antigen escape by hitting hard with multiple targets simultaneously before resistance develops (page 25, [0384]-[0388]).
US’108 further teaches that the CAR polypeptides have a signaling peptide, an antigen recognition domain, a hinge region, a transmembrane domain, at least one co-stimulatory domain, and a signaling domain (page 14, [0215]).
US’108 teaches that the target specific antigen recognition domain includes an antigen binding domain derived from an antibody against an antigen of the target or a domain derived from a receptor binding to a peptide or protein ligand on the target (page 14, [0221]). The antigen recognition domain can also include an antigen binding fragment including an scFv, which is a fusion protein of the variable regions of the heavy (VH) and light (VL) chains of immunoglobulins connected with a short peptide linker (page 14, [0223]).
US’108 further teaches that the CARs can comprise a hinge region, including those selected from an immunoglobulin including IgG1 and IgG4 (page 15, [0228]-[0230]).
US’108 teaches that the intracellular signaling domain includes the polypeptide of a functional signaling domain, such as that of CD3 zeta (page 15, [0238]).
US’108 teaches that the costimulatory domain is a functional signaling domain selected from a protein including Cd28, 4-1BB, ICOS, OX40, CD30, CD40, 2B4, CD2, or LIGHT (page 15, [0238]).
US’108 further teaches polynucleotide sequences encoding the CARs and teaches that the polynucleotide can be easily prepared from an amino acid sequence of the specified CAR by any conventional method (page 15, [0239]). US’108 teaches that the polynucleotide can be cloned into a vector, which is a composition of matter including an isolated polynucleotide and can be used to deliver the isolated polynucleotide into the interior of a cell (page 16, [0242]). The vectors include expression vectors (page 16, [0243], [0247], and [0249]).
US’108 further teaches engineered cells having multiple CAR units allowing a single engineered cell to target multiple antigens. Targeting multiple surface markers or antigen simultaneously with a multiple CAR unit prevents selection of resistant clones and reduces tumor occurrence (page 19, [0297]). US’108 further teaches that engineered cells are cells that are modified, transformed, or manipulated by the addition or modification of a gene, a DNA or RNA sequence, or protein or polypeptide. Isolated cells, host cells, and genetically engineered cells include isolated immune cells, such as NK cells and T cells that contain the DNA or RNA sequences encoding the CARs on the cell surface. Isolated host cells and engineered cells may be used, for example, for enhancing the NK cell activity or a T lymphocyte activity, treatment of cancer, and treatment of infectious diseases (page 18, [0261]).
In a preferred embodiment, the engineered cell having at least two distinct chimeric antigen receptor polypeptides is a primary NK cell isolated from the peripheral blood or cord blood and NK-92 cells, such that it is administered “off-the-shelf” to an mammal with a disease or cancer (page 20, [0302]). US’108 further teaches that NK cells do not need pre-activation and constitutively exhibit cytolytic functions. Further expression of cCARs in NK cells allows NK cells to effectively kill cancers. Further, NK cells are known to mediate anti-cancer effects without the risk of inducing GVHD (page 37, [0614]-[0615]).
US’108 teaches that it was found that the compound CAR in T cells or NK cells targeting different or the same tumor populations combat tumor factors that cause cancer cell resistant to CAR killing activity, such as downregulation of the target antigen from the cancer cell surface. It was also found that this downregulation enables the cancer cells to “hide” from the CAR therapy, referred to as “antigen escape”. The cCARs have significant advantages over single-CAR therapies due to its multi-targeting ability. While loss of a single antigen under antigen-specific selection pressure is possible, loss of two major antigens simultaneously is much less likely (page 20, [0313]). US’108 further teaches that compound CARs exhibit less toxicity compare to a single CAR. A compound CAR increases the affinity or trafficking to the tumor cell expressing two target antigens rather than off-target cells that only express one target antigen. In this way, the compound CAR may elicit selectivity and prefer to target cells expressing both target antigens rather than cells expressing only one antigen (pages 24-25, [0375]).
US’804 teaches a chimeric receptor molecule composed of a natural killer cell receptor and an immune signaling receptor expressed on the surface of a T cell to activate killing of a tumor cell. Nucleic acid sequences encoding the chimeric receptor molecule are introduced into T cells ex vivo and T cells that express the chimeric receptor molecule are subsequently injected into a subject in need of treatment. In this manner, the chimeric receptor molecules provide a means for the subject’s own immune cells to recognize and activate anti-tumor immunity and establish long-term, specific, anti-tumor responses for treating tumors or preventing regrowth of dormant or residual tumor cells (col. 4, lines 13-32).
By way of illustration, murine chimeric receptor molecules composed of NKG2D or Dap 10 in combination with a N-terminally attached CD3ζ were generated and expressed in murine T-cells. NKG2D is a type II protein, in which the N-terminus is located intracellularly, whereas the CD3ζ chain is a type I protein with the C-terminus in the cytoplasm. To generate a chimeric NKG2D- CD3ζ fusion protein, an initiation codon, ATG, was placed ahead of the coding sequence for the cytoplasmic region of the CD3ζ chain (without a stop codon TAA) followed by a wild-type NKG2D gene. Upon expression, the orientation of the CD3ζ portion is reversed inside of the cells. The extracellular and transmembrane domains are derived from NKG2D (col. 4, lines 33-51).
US’804 further teaches that, in humans, two families of ligands for NKG2D have been described. NKG2D binds to the polymorphic MHC class I chain-related molecules (MIC)-A and MICB. These are expressed on many human tumor cell lines, on several freshly isolated tumor specimens, and at low concentrations on gut epithelium. NKG2D also binds to another family of ligands designated as the UL binding proteins (ULBP)-1, -2, and -3 molecules (col. 3, lines 26-36). US’804 further demonstrates lysis of cells transduced with MIC-A with the NKG2D-transduced immune cells (col. 8, lines 43-55) further demonstrating binding of the ligands.
US’804 teaches that, to test whether murine chimeric NKG2D-transduced T cells were capable of recognizing NKG2D ligands, NKG2D ligand-positive tumor cells were used as targets for chimeric NKG2D bearing T cells. The chimeric NKG2D transduced T cells produces high amounts of IFNγ after co-culture with RMA/Rae-1β, RMA/H60, or YAC-1 cells, compared to RMA cells with no ligands, indicating that the chimeric NKG2D modified T cells could functionally recognize NKG2D bearing tumor cells. Similarly, chimeric human NKG2D-bearing CD8+ T cells secrete IFNγ when brought into contact with human tumor cells from breast cancer, prostate cancer, pancreatic cancer, and melanoma cancer (col. 5, line 32 – col. 6, line 20). In vitro cytotoxicity was also evaluated where NKG2D transduced T cells were able to lyse NKG2D ligand expressing target cells. US’804 teaches that the killing of tumor cells demonstrates that chimeric NK receptors provide the T cells with a means to kill tumor cells that express endogenous NKG2D ligands (col. 5, lines 20-52).
US’804 further teaches that, although specific immunity may be obtained against tumors, local immunosuppressive mechanisms, such as regulatory T cells, prevents the function of tumor-specific T cells. The ability to remove these cells and enhance local anti-tumor immune function would be of great benefit for the treatment of cancer. In addition to activating host immunity, it has also now been found that adoptive transfer of chimeric NK cell receptor bearing T cells can also eliminate host regulatory T cells. It was observed that treatment of mice with advanced tumors with chimeric receptor bearing T cells results in a rapid loss of FoxP3+ T regulatory cells from within the tumor microenvironment and a destruction of advanced tumor cells (col. 10, lines 4-19).
It would have been prima facie obvious to one of ordinary skill in the art prior to the effective filing date of the claimed invention to modify the MUC18 targeting CAR immune cells of WO’190 to further include a second CAR forming a compound CAR expressing immune cell as taught by US’108 and to have used the NKG2D chimeric receptor disclosed by US’804 as the second CAR which is further supported by US’108. An ordinarily skilled artisan would have been motivated to form a cCAR expressing immune cell in order to target multiple antigens simultaneously with a multiple CAR units preventing selection of resistant clones and reducing tumor occurrence as taught by US’108. US’108 also teaches that using cCARs can overcome antigen escape while also increasing specificity, affinity, and tracking to the tumor cells expressing both antigens, thereby reducing off-target toxicity compared to cells expressing only one CAR. An ordinarily skilled artisan would have further been motivated to use the NKG2D chimeric receptor as the second CAR in the cCAR as US’804 teaches that, when expressed in immune cells, the NKG2D chimeric receptors activate host immunity while also reducing immunosuppressive cells, such as Treg cells in the tumor microenvironment leading to destruction of advanced tumor cells. An ordinarily skilled artisan would have had a reasonable expectation of success as US’108 demonstrates the production of compound CARs and their expression in immune cells, including cCARs that target a tumor antigen as well as NKG2D. Additionally, WO’190 and US’804 teach that the MUC18 CAR and the NKG2D chimeric receptor are active in overlapping cancers including melanoma and breast cancer.
Regarding claim 544, in the CAR constructs taught by US’108, the linker peptide used to connect the VH and VL regions into an scFv is GGGGSGGGGSGGGGS and the CD8 leader has the sequence MALPVTALLLPLALLLHAARP, for instance see the CARs of SEQ ID NOs: 3, 18, 30, 36, and 42, both of which are identical to those used in the CARs of SEQ ID NOs: 12-15.
It would have been prima facie obvious to one of ordinary skill in the art prior to the effective filing date of the claimed invention to use the linker and CD8 leader sequences disclosed by US’108 in the construction of the CAR disclosed by the combination of WO’190, US’108, and US’804. An ordinarily skilled artisan would have been motivated to use these sequences as US’108 demonstrates them as functional sequences in the generation of cCAR domains. Thus one of ordinary skill in the art would have had a reasonable expectation of success. The sequences of the CD8 leader and linker are fragments of instant SEQ ID NOs: 12-15 with 100% identity to the fragment and, therefore, meet the instant claim limitations of the first CAR comprising SEQ ID NOs: 12-15, or a fragment thereof, respectively. It is noted that the disclosure defines “polypeptide fragment” or “fragment” on page 59, [0080] and states that fragments are typically “at least 5, 6, 8, or 10 amino acids long” indicating that each of the above sequences meet the limitation of a fragment of SEQ ID NOs: 12-15.
Claim 542 is rejected under 35 U.S.C. 103 as being unpatentable over WO 2020/132190 A1 (Hou, B., et al) 25 JUN 2020 in view of US 2019/0255108 A1 (Yupo, M. et al) 22 Aug 2019 and US 10,336,804 B2 (Zhang, T. and C.L. Sentman) 2 Jul 2019, as applied to claims 540 and 541 above, and in further view of US 6,924,360 B2 (Green, L.L, an dM. Bar-Eli) 2 AUG 2005.
The combination of WO’190, US’108, and US’804 teach the composition of claim 541 as discussed in detail above.
As discussed above, WO’190 teaches that anti-MUC18 antibodies can be used to produce the CAR constructs. For example, the VH and VL domains are connected via a peptide linker to form an scFv fragment (page 27, lines 19-23).
US’108 also teaches that the antigen recognition domain of the CAR can include a single chain variable fragment (scFv) which is a fusion protein of the variable regions of the heavy (VH) and light chains (VL) of immunoglobulins, connected with a short linker peptide (page 14, [0223]).
In the CAR constructs taught by US’108, the linker peptide used to connect the VH and VL regions comprises GGGGSGGGGSGGGGS. For instance, see the CARs of SEQ ID NOs: 3, 18, 30, 36, and 42 all of which use the (G4S)3 linker to combine VH and VL regions to form scFvs. The linker used in US’108 to form scFvs is identical to instant SEQ ID NO: 3 as shown in the alignment below:
PNG
media_image1.png
111
601
media_image1.png
Greyscale
The combination of applied references, however, does not disclose that the anti-MUC18 antibody comprises the heavy and light chain variable regions claimed.
US’360 teaches anti-MUC18 monoclonal antibodies and their use in the treatment of disorders associated with increased activity of MUC18 (abstract). US’360 teaches that MUC18 is expressed on a variety of malignant neoplasms including smooth muscle neoplasms, such as Leiomyomas and leiomyosarcomas; tumors of vascular origin, such as angiosarcomas and kaposi’s sarcomas; placental site trophoblastic tumors, choriocarcinomas, and melanomas (col. 1, lines 47-56).
US’360 teaches the anti-MUC18 antibody c3.19.1, also referred to as ABX-MA1 (col. 3, lines 40-42) which is disclosed as having a heavy and light chain variable region of SEQ ID NOs: 1 and 2, respectively (col. 4, lines 55-59).
The variable regions of c.3.19.1 are identical to those of instant SEQ ID NOs: 2 and 4 as shown in the alignments below:
US’360, SEQ ID NO: 1 aligned with instant SEQ ID NO: 2
PNG
media_image2.png
236
597
media_image2.png
Greyscale
US’360, SEQ ID NO: 2 aligned with instant SEQ ID NO: 4
PNG
media_image3.png
169
580
media_image3.png
Greyscale
It would have been prima facie obvious to one of ordinary skill in the art prior to the effective filing date of the claimed invention to substitute the VH and VL antibody domains in the MUC18 CAR taught by the combination of WO’190, US’108, and US’804 with the VH and VL anti-MUC18 antibody domains taught by US’360 and to form a scFv with the VH and VL domains using the linker taught by US’108. It would have been obvious to substitute the VH/VL antibody domains with those taught by US’360 as the antibody disclosed by US’360 also binds MUC18, which is the same binding target as the MUC18 CAR. An ordinarily skilled artisan would have had a reasonable expectation of success as the use of either antibody VH/VL regions would target and bind to MUC18. It would have further been obvious to use the peptide linker used by US’108 to form a scFv by linking the VH and VL domains as US’108 demonstrates the use of the peptide linker to fuse VH and VL domains for the formation of scFvs for use in CARs, which is the same general method taught by WO’190 for construction of MUC18 CARs.
Claim 544 is rejected under 35 U.S.C. 103 as being unpatentable over WO 2020/132190 A1 (Hou, B., et al) 25 JUN 2020 in view of US 2019/0255108 A1 (Yupo, M. et al) 22 Aug 2019 and US 10,336,804 B2 (Zhang, T. and C.L. Sentman) 2 Jul 2019, as applied to claims 540 above, and in further view of US 6,924,360 B2 (Green, L.L, an dM. Bar-Eli) 2 AUG 2005 and WO 2018/161017 (Suri, V. et al) 07 Sept 2018.
The combination of WO’190, US’108, and US’804 teach the composition of claim 540 as discussed in detail above.
As discussed in detail above, WO’190 exemplifies a MUC18 targeting CAR comprising anti-MUC18 antibody variable regions (VH and VL) inserted into a chimeric antigen receptor vector in frame with a CD8 hinge region, a CD8 transmembrane region, an intracellular domain of the co-stimulatory 4-1BB, and an intracellular domain of CD3ζ (page 45, lines 16-23). WO’190 also teaches that anti-MUC18 antibodies can be used to produce the CAR constructs. For example, the VH and VL domains are connected via a peptide linker to form an scFv fragment (page 27, lines 19-23). WO’190 further teaches that the transmembrane can be obtained from a suitable cell-surface receptor, for example CD28 or CD8 (page 28, lines 1-3).
US’108 further teaches that the antigen recognition domain of the CAR can include a single chain variable fragment (scFv) which is a fusion protein of the variable regions of the heavy (VH) and light chains (VL) of immunoglobulins, connected with a short linker peptide (page 14, [0223]). US’108 teaches that the level of the surface CAR expression on the T cells or NK cells is affected by an appropriate leader sequence (page 1, [0010]) and teaches CAR constructs comprising a CD8 leader sequence (page 2, [0027]).
In the CAR constructs taught by US’108, the linker peptide used to connect the VH and VL regions into an scFv is GGGGSGGGGSGGGGS and the CD8 leader has the sequence MALPVTALLLPLALLLHAARP. For instance, see the CARs of SEQ ID NOs: 3, 18, 30, 36, and 42.
The CD8 leader sequence disclosed in the CAR constructs of US’108 is identical to instant SEQ ID NO: 13 AA 1-21 as shown in the alignment below:
PNG
media_image4.png
111
592
media_image4.png
Greyscale
As discussed above, US’108 also teaches inclusion of a hinge region between the antigen recognition domain and the transmembrane domain (page 14, [0215]) and teaches that the hinge region includes one selected from, but not limited to, immunoglobulin IgG1, IgG2, IgG3, IgG4, and IgGD (page 15, [0228]-[0231]). US’108 also teaches costimulatory domains for use in the CARs including 4-1BB and 2B4 (page 15, [0238])
The combination of WO’190, US’108, and US’804, however, do not disclose that the first CAR comprises an amino acid sequence recited in instant claim 544.
The teachings of US’360 are as discussed above.
As discussed above, US’360 teaches anti-MUC18 VH and VL regions. The VH/VL disclosed by US’360 are identical to those used in the CARs of the instant claim and, when used in combination with the linker disclosed by US’108 to form an scFv, results in an scFv region that is identical to that of instant SEQ ID NO: 13 AA 22-269, as shown in the alignment below:
PNG
media_image5.png
354
588
media_image5.png
Greyscale
WO’017 teaches that, in a standard CAR receptor, the components include an extracellular targeting domain, transmembrane domain and intracellular signaling/activation domains linearly constructed as a single fusion protein. WO’017 further teaches the inclusion of a hinge that connects the extracellular targeting domain to the transmembrane domain (pages 48-49, [00196]-[00199]). WO’017 further provides various sequences for use in CAR design.
For instance, WO’017 teaches a CH3 hinge comprising the following sequence: ESKYGPPCPPCPGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK (page 69, SEQ ID NO: 461), which differs from the hinge of the instantly claimed invention in the CH3 region following the “ESKYGPPCPPCP” portion of the hinge. WO’017, however, also teaches an alternative IgG1 hinge comprising the sequence GQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK (page 70, SEQ ID NO: 476). Using this CH3 sequence in place of the CH3 sequence in WO’017, SEQ ID NO: 461 provides a hinge that is identical to that of the instantly claimed sequences as shown in the ABSS alignment below with instant SEQ ID NO: 13, AA 270-388:
PNG
media_image6.png
172
591
media_image6.png
Greyscale
WO’017 teaches that the following sequence as a CD28 transmembrane domain that can be used in CAR T cells: FWVLVVVGGVLACYSLLVTVAFIIFWVR (page 98, SEQ ID NO: 898). The sequence of the CD28 transmembrane domain differs from that used in the instantly claimed CARs by the inclusion of a serine (S) at the end of the sequence in the claimed CARs. This addition; however, would have been obvious in view of the teachings of WO’017 which further teaches that the CD28 signaling chain as a whole is FWVIVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLIISDYMNMTPRRPGPTRKII
YQPYAPPRDFAAYRS (SEQ ID NO: 296), which demonstrates that the amino acid following what is identified as the CD28 TM is a Ser (S). WO’017 also considers various lengths of the CD28 signaling chain as potential transmembrane domains (pages 64-68, CD28 transmembrane domain), demonstrating that the extension of the CD28 transmembrane domain to include the additional S amino acid would have been obvious and predictable and results in a CD28 TM that is identical to instant SEQ ID NO: 13, AA 389-417, as shown in the alignment below:
PNG
media_image7.png
109
587
media_image7.png
Greyscale
WO’017 further teaches the following sequence as a 4-1BB intracellular signaling domain:
KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL, which is identical to the costimulatory domain of instantly claimed SEQ ID NO: 13, AA 418-459, as shown in the alignment below:
PNG
media_image8.png
107
582
media_image8.png
Greyscale
Together, the above sequences taught by the combination of WO’190, US’108, US’804, US’360, and WO’017 provide a CAR that is identical to instant SEQ ID NO: 13 as shown in the alignment below:
PNG
media_image9.png
528
577
media_image9.png
Greyscale
WO’017 further teaches 2B4 as an alternative co stimulatory domain for use in CAR constructs (page 5, [0022]) and teaches the amino acid sequence of the 2B4 costimulatory region as
WRRKRKEKQSETSPKEFLTIYEDVKDLKTRRNHEQEQTFPGGGSTIYSMIQSQSSAPTSQEPAYTLYSLIQPSRKSGSRKRNHSPSFNSTIYEVIGKSQPKAQNPARLSRKELENFDVYS (page 57, SEQ ID NO: 268), which is identical to the costimulatory domain of instantly claimed SEQ ID NO: 12, AA 418-537, as shown in the alignment below:
PNG
media_image10.png
175
583
media_image10.png
Greyscale
Substituting this alternative costimulatory domain in place of the 4-1BB costimulatory domain in the sequence taught by the combination of WO’190, US’108, US’804, US’360, and WO’017 above, provides a sequence that is identical to instant SEQ ID NO: 12 as shown in the alignment below:
PNG
media_image11.png
585
575
media_image11.png
Greyscale
It would have been prima facie obvious to one of ordinary skill in the art prior to the effective filing date of the claimed invention to substitute the VH/VL domains in the MUC18 CAR taught by the combination of WO’190, US’108, and US’804 with the VH and VL anti-MUC18 antibody domains taught by US’360 and to form a scFv with the VH and VL domains using the linker taught by US’108. It would have further been obvious to add a leader, such as the CD8 leader sequence taught by US’108, to the CAR and to have substituted the CD8 hinge with an IgG1 hinge as taught by US’108 and to substitute the CD8 transmembrane domain with a CD28 transmembrane domain as taught by WO’190. It would have further been obvious to use the sequences disclosed by WO’017 for the hinge, transmembrane, and co-stimulatory regions.
It would have been obvious to substitute the VH/VL antibody domains with those taught by US’360 as the antibody disclosed by US’360 also binds MUC18, which is the same binding target as the MUC18 CAR. An ordinarily skilled artisan would have had a reasonable expectation of success as the use of either antibody VH/VL regions would target and bind to MUC18. It would have further been obvious to use the peptide linker used by US’108 to form a scFv by linking the VH and VL domains as US’108 demonstrates the use of the peptide linker to fuse VH and VL domains for the formation of scFvs for use in CARs, which is the same general method taught by WO’190 for construction of MUC18 CARs.
Similarly, it would have been obvious to use the leader disclosed by US’108 as US’108 teaches the leader sequence in the construction of cCARs and also teaches an appropriate leader sequence for surface expression of the CARs is needed. An ordinarily skilled artisan would have had a reasonable expectation of success as US’108 demonstrates the use of the CD8 leader sequence in construction and expression of cCARs.
It would have been obvious to substitute the hinge and the transmembrane domain as US’108, WO’190, and WO’017 all demonstrate the use of IgG1 hinges as an alternative to CD8 hinges in CAR design and also demonstrate CD28 transmembrane domains as an alternative to a CD8 transmembrane domain. An ordinarily skilled artisan would have had a reasonable expectation of success as the domains are taught as alternatives to one another suggesting that they have analogous properties.
It would have further been obvious to use the sequences disclosed by WO’017 for the hinge, transmembrane, and co-stimulatory regions as WO’017 is teaching known amino acid sequences for domains that are typically used in the generation of CARs. Thus, an ordinarily skilled artisan would have had a reasonable expectation of success that the alternative domains would have analogous properties.
Claim 546 is rejected under 35 U.S.C. 103 as being unpatentable over WO 2020/132190 A1 (Hou, B., et al) 25 JUN 2020 in view of US 2019/0255108 A1 (Yupo, M. et al) 22 Aug 2019 and US 10,336,804 B2 (Zhang, T. and C.L. Sentman) 2 Jul 2019, as applied to claims 540 above, and in further view of WO 2018/161017 (Suri, V. et al) 07 Sept 2018, GenBank: AF461811.1 Homo sapiens NKG2D mRNA, complete ds, 17-JAN-2002, and WO 2019/222579 A1 (Gottschalk, S., et al) 21 Nov 2019.
The combination of WO’190, US’108, and US’804 teach the composition of claim 540 as discussed above.
As discussed above, US’804 teaches a chimeric receptor comprising NKG2D in combination with a N-terminally attached CD3ζ. To generate a chimeric NKG2D-CD3ζ fusion protein, an initiation codon ATG was place ahead of the coding sequence for the cytoplasmic region of the CD3ζ. Upon expression, the orientation of the CD3ζ portion is reversed inside of the cells (col. 4, lines 33-51).
The combination of WO’190, US’108, and US’804, however, do not disclose that the NKG2D chimeric receptor comprises the amino acid sequence of SEQ ID NO: 20.
WO’017 teaches components that can be used in the construction of chimeric antigen receptors, including a CD3 zeta intracellular signaling domain (page 60, SEQ ID NO: 325) that is identical to that of instant SEQ ID NO: 20, AA 2-113 as shown in the alignment below:
PNG
media_image12.png
178
587
media_image12.png
Greyscale
GenBank AF461811.1 teaches a NGK2D receptor with an amino acid sequence that is identical to instant SEQ ID NO: 20, AA 114-328 (page 1, translation) as shown in the alignment below:
PNG
media_image13.png
294
601
media_image13.png
Greyscale
WO’579 teaches CARs and teaches that, in some embodiments, the polynucleotides sequences encode a transduced host cell selection marker, an in vivo tracking marker, a cytokine, or a suicide gene. In some embodiments, the transduced host cell selection marker is a truncated CD19 (tCD19) polypeptide (page 5). WO’579 teaches hat the constructs comprise a CAR, a 2A sequence, and the accessory gene for truncated CD19 (tCD19). In certain embodiments, tCD19t can be used as a tag. For example, expression of tCD19 can help determine transduction efficiency (page 40, [00120]).
WO’579 teaches that the tCD19 comprises the amino acid sequence of SEQ ID NO: 23 (page 5; page 74, claim 46) which is identical to instant SEQ ID NO: 20, AA 515-847, as shown in the alignment below:
PNG
media_image14.png
414
583
media_image14.png
Greyscale
It would have been prima facie obvious to one of ordinary skill in the art prior to the effective filing date of the claimed invention to modify the NKG2D-CD3ζ fusion protein in the composition taught by the combination of WO’190, US’108, and US’804 to use the CD3ζ signaling domain sequence disclosed by WO’017 and the NKG2D receptor sequence disclosed by GenBank AF461811.1 to produce the NKG2D-CD3ζ fusion protein. It would have further been obvious to further include a tCD19 amino acid sequence, such as that disclosed by WO’579. It would have been obvious to use the sequences disclosed by WO’017 and GenBank AF461811 as the sequences are for a CD3ζ signaling domain and an NKG2D receptor, which are the same components disclosed by the combination of WO’190, US’108, and US’804 for use in the NKG2D-CD3ζ. Therefore, an ordinarily skilled artisan would have had a reasonable expectation of success as they would be expected to have analogous properties. An ordinarily skilled artisan would have been motivated to include a tCD19 domain in order to determine expression and transduction efficiency of the chimeric receptor as taught by WO’579. An ordinarily skilled artisan would have had a reasonable expectation of success as WO’579 is teaching the use of such constructs in the design of CAR vectors. These sequences are fragments of instant SEQ ID NO: 20 as shown in the alignments above and, therefore, meet the instant claim limitations of the second CAR comprising SEQ ID NO: 20, or a fragment thereof. It is noted that the disclosure defines “polypeptide fragment” or “fragment” on page 59, [0080] and states that fragments are typically “at least 5, 6, 8, or 10 amino acids long” indicating that each of the above sequences meet the limitation of a fragment of SEQ ID NO: 20.
Claim 551 is rejected under 35 U.S.C. 103 as being unpatentable over WO 2020/132190 A1 (Hou, B., et al) 25 JUN 2020 in view of US 2019/0255108 A1 (Yupo, M. et al) 22 Aug 2019, US 10,336,804 B2 (Zhang, T. and C.L. Sentman) 2 Jul 2019, Gschweng, E., et al (2014) Hematopoietic stem cells for cancer immunotherapy Immunol Rev. 257(1); 237-249 and Liu, H.Y., et al (2019) 801. Gene therapy and transfer, Dissecting the immune cell progeny of CAR-expressing hematopoietic stem cells in a humanized mouse model Blood 134(Supplemental_1); 4640; 1-2.
The teachings of WO’190 are as discussed above.
As discussed in detail above, WO’190 teaches methods of treatment in which a subject is administered a therapeutically effective amount of immune cells expressing a MUC18 targeted Car (page 28, lines 4-11). WO’190 further teaches that the subject to be treated is a mammal (page 32, lines 19-21).
The teachings of WO’190 differ from the instantly claimed invention in that WO’190 does not disclose that the MUC18 CAR immune effector cells used in the methods of treatment further comprise a second CAR polypeptide comprising an NKG2D receptor or fragment thereof and a CD3 zeta signaling domain. WO’190 also does not disclose that the administration of the immune effector cells generates a persisting population of genetically engineered immune cells in the mammal wherein the persisting population persists for at least about one month to at least about one year and/or produces a population of progeny immune cells in the mammal.
The teachings of US’108 and US’804 are as discussed in detail above.
The teachings of WO’190 in combination with US’108 and US’804 render obvious the immune effector cells of claim 548 as discussed in detail in the rejection of claim 548 above.
US’108 further teaches that the engineered immune cells may be obtained from peripheral blood, cord blood, bone marrow, tumor infiltrating lymphocytes, lymph node tissue, or thymus tissue. The host cells may include placental cells, embryonic stem cells, induced pluripotent stem cells, or hematopoietic stem cells (page 18, [0269]).
Gschweng teaches that approaching T cell immunotherapy by engineering of autologous hematopoietic stem cells (HSCs) with a prearranged anti-cancer antigen CAR may solve the problem of effector cell persistence. HSCs are the most primitive blood linage cells and reside predominantly in the bone marrow where they produce all mature blood cells by proliferation and differentiation through series of increasingly lineage-restricted progenitors. HSC transplantation has been a clinical practice for more than four decades (page 3, paragraph 3). Gene transfer and expression in HSCs has been under study for more than three decades. Vectors derived from viruses of the Retroviridae family have been most effective for permanent gene insertion into the chromosomes of HSCs. This results in stable transmission to all progeny progenitors and mature blood cells (page 3, paragraph 4).
Gschweng teaches that the approach of using HSCs as the targets for CARs is attractive because, as with approaches that use Tcm or Tscm as targets for gene modification, the regenerative nature of HSCs may provide long lasting, potentially life-long, supply of effector T cells engineered against the antigen of interest. CAR-modified HSCs will continuously produce T-lymphocyte progenitors that will undergo normal thymopoiesis and development, increasing the potential for development of immunological memory. This is in contrast to mature T cells massively expanded ex vivo before infusion, with most having a finite life-span (page 4, paragraph 3). Stable retroviral or lentiviral introduction of pre-arranged cancer antigen specific CAR to HSCs can provide an ongoing source of targeted T cells and, perhaps, other effectors. While infusions of CAR-modified mature T cells have an anti-neoplastic impact within days to weeks, production of anti-tumor effectors from transplanted HSCs may take longer, with myeloid and NK cells emerging within 1-3 weeks after transplantation and de novo t lymphopoiesis occurring after several months. Though delayed, it is hypothesized that the stable engraftment of CAR modified HSCs will lead to sustained production of target effector cells, potentially providing sustained anti-tumor immunity (page 4, paragraph 5).
Fig. 1 of Gschweng is a theoretical time course of anti-tumor activity and suggests that T cells, myeloid cells, and NK cells expressing CARs from transduced HSC could be expressed and have anti-tumor activity for years.
Liu teaches that therapy with autologous T cells expressing CARs have led to complete remissions in B lineage leukemias and lymphomas, but effector cells may not persist, limiting clinical efficacy. Liu hypothesized that modification of HSC with anti-CD19 CARs would lead to persistent generation of multilineage target specific immune cells, enhancing graft-versus-cancer activity, and leading to development of immunological memory (page 1, background).
Liu generated second-generation CD28 and 4-1BB costimulated CAR constructs using third-generation lentiviral vectors for modification of human HSC for assessment in vivo in NSG mice engrafted neonatally with human CD34 positive cells (page 1, design/methods).
Liu reports that gene modification of HSC with the CARs did not impair differentiation or proliferation in humanized mice, leading to CAR-expressing cell progeny in myeloid, NK, and T-cells. Multilineage CAR-expressing cells were present in all tissues with stable levels up to 44 weeks post-transplant. CAR modified HSCs led to development of T cell effector memory and T cell central memory phenotypes, confirming the development of long-lasting phenotypes due to directed antigen specificity. Mice engrafted with the CAR-modified HSC successfully presented tumor growth inhibition and survival advantage at tumor challenge (pages 1-2, results).
Liu concludes that CAR modification of human HSC for cancer immunotherapy is feasible and continuously generates CAR-bearing cells in multiple lineages of immune cells. Targeting of different malignances can be achieved by adjusting target specificity (page 2, conclusions).
It would have been prima facie obvious to one of ordinary skill in the art prior to the effective filing date of the claimed invention to modify the methods taught by the combination of WO’190, US’108, and US’804 by introducing the cCARs into hematopoietic stem cells for administration as taught by Gschweng and further supported by Liu. One of ordinary skill in the art would have been motivated to use HSCs as the cells in which the cCARs are introduced as Gschweng teaches that the regenerative nature of HSCs can provide a long lasting, even potentially life long, supply of effector cells engineered against the antigen of interest and also increase the potential to develop immunological memory. This is further supported by Liu, which demonstrates in mouse models that CAR modification of HSCs for cancer immunotherapy is feasible and continuously generates CAR-bearing cells in multiple lineages of immune cells. An ordinarily skilled artisan would have a reasonable expectation of success as, like WO’190, US’108, and US’804, Gschweng and Liu both are also teaching CAR expressing cells for the treatment of cancer. Additionally, US’108 teaches that the cCAR engineered host cells can be stem cells including hematopoietic stem cells.
An ordinarily skilled artisan would have reasonably expected that the administration of cCAR expressing HSCs would result in immune cell persistence for at least about one month up to at least one year and produce a progeny of immune cells in the mammal based on the teachings of Gschweng and Liu. Specifically, Gschweng teaches that the administration of CAR modified HSCs can provide long lasting, even potentially life long, supplies of effector cells engineered against the antigen of interest and Liu demonstrates the use of CAR modified HSCs for generating multiple linages of immune cells which were detected at stable levels up to 44 weeks in mice post-transplant. Both Gschweng and Liu teach that the CAR-expressing HSCs produce populations of cell progeny immune cells.
Claims 557-558 are rejected under 35 U.S.C. 103 as being unpatentable over WO 2020/132190 A1 (Hou, B., et al) 25 JUN 2020 in view of US 6,924,360 B2 (Green, L.L, an dM. Bar-Eli) 2 AUG 2005, US 2019/0255108 A1 (Yupo, M. et al) 22 Aug 2019, and US 10,336,804 B2 (Zhang, T. and C.L. Sentman) 2 Jul 2019.
The teachings of WO’190 are as discussed in detail above.
As discussed in detail above, WO’190 exemplifies and studies a MUC18 targeting CAR comprising anti-MUC18 antibodies (VH and VL) were inserted into a chimeric antigen receptor vector in frame with a CD8 hinge region, a CD8 transmembrane region, an intracellular domain of the co-stimulatory 4-1BB, and an intracellular domain of CD3ζ (page 45, lines 16-23).
Based on these teachings, the CAR comprises MUC18 antibody VH and VL regions, an extracellular spacer (hinge), a transmembrane domain, and a costimulatory signaling region in combination with an intracellular signaling domain.
As discussed above, WO’190 also teaches the use of an scFv as the extracellular antigen binding domain which is formed by the linking of VH and VL domains via a peptide linker (page 27, lines 6-23).
WO’190 differs from the instantly claimed invention in that WO’190 does not disclose that the VH and VL regions of the MUC18 antibody have the claimed sequences or that the peptide linker is one with an amino acid sequence having at least 80% identity to SEQ ID NO: 3. WO’190 also does not teach that the immune cell further expresses a second CAR polypeptide comprising an NKG2D receptor or fragment thereof.
The teachings of US’360, US’108, and US’804 are as discussed in detail above.
It would have been prima facie obvious to one of ordinary skill in the art prior to the effective filing date of the claimed invention to substitute the VH and VL antibody domains in the MUC18 CAR taught by WO’190 with the VH and VL anti-MUC18 antibody domains taught by US’360 and to use the linker taught by US’108 to form an scFv for the antigen binding domain. It would have further been obvious to modify the MUC18 targeting CAR immune cells to further include a second CAR, forming a compound CAR expressing immune cell, as taught by US’108 and to have used the NKG2D chimeric receptor disclosed by US’804 as the second CAR, which is also further supported by US’108.
It would have been obvious to substitute the VH/VL antibody domains with those taught by US’360 as the antibody disclosed by US’360 also binds MUC18, which is the same binding target as the MUC18 CAR in WO’190. An ordinarily skilled artisan would have had a reasonable expectation of success as the use of either antibody VH/VL regions would target and bind to MUC18. It would have further been obvious to use the peptide linker disclosed by US’108 to form a scFv by linking the VH and VL domains as US’108 demonstrates the use of the peptide linker to fuse VH and VL domains for the formation of scFvs for use in CARs as the extracellular binding domain, which is the same general method taught by WO’190 for construction of MUC18 CARs.
An ordinarily skilled artisan would have been motivated to form a cCAR expressing immune cell in order to target multiple antigens simultaneously with a multiple CAR unit preventing selection of resistant clones and reducing tumor occurrence as taught by US’108. US’108 also teaches that using cCARs can overcome antigen escape while also increasing specificity, affinity, and tracking to the tumor cells expressing both antigens, thereby reducing off-target toxicity compared to cells expressing only one CAR. An ordinarily skilled artisan would have further been motivated to use the NKG2D chimeric receptor disclosed by US’804 as the second CAR in the cCAR as US’804 teaches that, when expressed in immune cells, the NKG2D chimeric receptors activate host immunity while also reducing immunosuppressive cells, such as Treg cells in the tumor microenvironment leading to destruction of advanced tumor cells. An ordinarily skilled artisan would have had a reasonable expectation of success as US’108 demonstrates the production of compound CARs and their expression in immune cells, including cCARs that target both a tumor antigen and NKG2D. Additionally, both WO’190 and US’804 teach that the MUC18 CAR and the NKG2D chimeric receptor are active in overlapping cancers including melanoma and breast cancer.
Claim 559 is rejected under 35 U.S.C. 103 as being unpatentable over WO 2020/132190 A1 (Hou, B., et al) 25 JUN 2020 in view of US 6,924,360 B2 (Green, L.L, an dM. Bar-Eli) 2 AUG 2005, US 2019/0255108 A1 (Yupo, M. et al) 22 Aug 2019, and US 10,336,804 B2 (Zhang, T. and C.L. Sentman) 2 Jul 2019 as applied to claim 557 above, and in further view of WO 2018/161017 (Suri, V. et al) 07 Sept 2018.
The combination of WO’190, US’360, US’108, and US’804 teach the composition of claim 557 as discussed in detail above.
As discussed above, the combination of applied references teaches the scFv of instant SEQ ID NOs: 12 and 13, including the VH, VL, and linkers in the CARs.
The combination of applied references, however, does not disclose that the first CAR comprises SEQ ID NO: 12, 13, 14, or 15 and/or the second CAR comprises SEQ ID NO: 20.
The teachings of WO’017 are as discussed in detail above.
As discussed in detail above in the rejection of claim 544, the combination of WO’190, US’360, WO’017, US’108, and US’804 teach the amino acid sequences of SEQ ID NO: 12 and 13, rendering the claimed sequences obvious.
It would have been prima facie obvious to one of ordinary skill in the art prior to the effective filing date of the claimed invention to add a leader, such as the CD8 leader sequence taught by US’108, to the CAR and to have substituted the CD8 hinge with an IgG1 hinge as taught by US’108 and to substitute the CD8 transmembrane domain with a CD28 transmembrane domain as taught by WO’190. It would have further been obvious to use the sequences disclosed by WO’017 for the hinge, transmembrane, and co-stimulatory regions. It would have been obvious to use the leader disclosed by US’108 as US’108 teaches the leader sequence in the construction of cCARs and also teaches an appropriate leader sequence for surface expression of the CARs is needed. An ordinarily skilled artisan would have had a reasonable expectation of success as US’108 demonstrates the use of the CD8 leader sequence in construction and expression of cCARs. It would have been obvious to substitute the hinge and the transmembrane domain as US’108, WO’190, and WO’017 all demonstrate the use of IgG1 hinges as an alternative to CD8 hinges in CAR design and also demonstrate CD28 transmembrane domains as an alternative to a CD8 transmembrane domain. An ordinarily skilled artisan would have had a reasonable expectation of success as the domains are taught as alternatives to one another suggesting that they have analogous properties. It would have further been obvious to use the sequences disclosed by WO’017 for the hinge, transmembrane, and co-stimulatory regions as WO’017 is teaching known amino acid sequences for domains that are typically used in the generation of CARs. Thus, an ordinarily skilled artisan would have had a reasonable expectation of success that the alternative domains would have analogous properties.
The combination of WO’190, US’360, WO’017, US’108, US’804, and WO’017 teach a MUC18 CAR comprising SEQ ID NO: 12 and 13 as discussed in detail above. These teachings meet the instant claim limitation based on the use of “and/or”, which indicates that only one of the first or second CAR sequences recited are required.
Response to Arguments
Applicant’s arguments in the response filed 04/28/2026 have been fully considered, but are not persuasive.
With regards to the rejection of the claims under 35 USC 103 over WO’190 (referenced by applicant as “Hou”), US’108 (referenced by applicant as “Yupo”), and US’804 (referenced by applicant as “Zhang”), applicant argues the following.
Applicant argues that a POSITA would lack motivation to combine a MUC18 and NKG2D CAR for reasons related to safety and effectiveness. Specifically, applicant argues that both antigens are expressed on healthy tissues and that combination of multiple CARs created concerning off-tumor toxicity risks. Applicant cites VanSeggelen for support in explaining that on-target off-tumor toxicity is a concern for all immunotherapy approaches and cites VanSeggelen as teaching that NKG2DL is present on normal healthy tissues and WO’190 as teaching that MUC18 is expressed at detectable levels in endothelial cells within vascular tissue, including vascular smooth muscle. Applicant argues that, combining two CARs, each with off tumor expression patterns, would be expected to create dangerous adverse effects. Applicant argues that this would caution a POSITA against selecting NKG2D as a CAR target, especially when US’804 acknowledges a need to prevent side effects that may occur from uncontrolled inflammation or response against non-tumor tissue.
This argument; however, is not persuasive.
While the citations by applicant do suggest that both MUC18 and NKG2DL may separately be present on healthy cells to some degree, this alone does not teach away from the claimed invention because it does not directly criticize, discredit, or otherwise discourage the development of the cCAR. See MPEP 2123 (II). Furthermore, in contrast to applicant’s arguments that an ordinarily skilled artisan would not be motivated to combine a MUC18 and NKG2D CAR for safety and effectiveness reasons, the cited prior art provides motivation to combine the CARs and also teaches that toxicity, including on target off site toxicity, could be reduced.
For instance, as discussed in the rejections, US’108 teaches engineered cells having compound CARs comprising two complete and distinct chimeric antigen receptor polypeptides. US’108 also teaches that NKG2D can bind to at least 8 different ligands and teaches that these ligands are induced-self proteins that are virtually absent or present only at very low levels on the surface of normal cells but are overexpressed in cancer cells. US’108 directly teaches that this makes them good candidates for CAR targeting (page 25, [0382]). US’108 also teaches cCARs comprising a tumor antigen and NKG2D.
US’108 provides motivation to use cCARs teaching that the addition of the NKG2D as a target in addition to the tumor antigen enhances antitumor response and reduces the risk of antigen escape associated with disease relapse, allowing for a more complete elimination of cancerous cells and reducing antigen escape before resistance develops (page 25, [0384]-[0388]).
US’108 also teaches that cCARs exhibit less toxicity compared to a single CAR and that the use of two CARs increases the affinity or trafficking to the tumor cell expressing two target antigens rather than off-target cells that express only one target antigen. In this way, the compound CAR may elicit selectivity and prefer to target cells expressing both antigens, rather than only one (pages 24-25, [0375]).
Based on these teachings, an ordinarily skilled artisan would not only have been motivated to combine the MUC18 and NKG2D CARs, but would also have reasonably expected that safety could be maintained or even enhanced.
It is also noted that the rejection relies on the combination of the applied references and what the combination would have suggested prior to the effective filing date of the claimed invention, not on each reference individually. See MPEP 2145 (IV). As discussed above, US’108 suggests that a CAR targeting two different antigens can result in improved efficacy and safety providing a reasonable expectation of success in combining the anti-MUC18 and NKG2D CARs.
Applicant further argues that NKG2D CARs were known to cause fratricide reducing the efficacy of the engineered cells and discouraging their use in combination therapies. Applicant cites VanSeggelen for support as observing NKG2DL on CAR-engineered T cells across CAR type and T cell type. Applicant argues that NKG2D CAR T cells killed each other due to the expression of NKG2D ligands on the T cells themselves, citing the specification at paragraph [0501]) for support. Applicant argues that VanSeggelen teaches that NKG2D CARs are toxic and potentially lethal. Applicant argues that, in view of this, the results presented are surprising at least because the CAR cells are shown to be effective while maintaining their survival and proliferative abilities referencing Fig. 18.
Applicant’s arguments are not persuasive.
It is noted that VanSeggelen is cited on a PTO-892 and a copy of the reference is uploaded to the file for clarity.
In the instant office action, the use of the NKG2D chimeric receptor disclosed by US’804 is proposed. As discussed in the rejection, the chimeric receptor in US’804 comprises NKG2D in combination with a N-terminally attached CD3ζ domain and expressed in T cells. US’804 also demonstrates cytotoxicity of T cells expressing the receptor. US’804 exemplified and studied the NKG2D chimeric receptors and does not discuss or suggest that there was any issue with fratricide reducing the efficacy of the engineered cells. Furthermore, US’804 studied toxicity and teaches that, as for toxicity of treatment with chimeric NKG2D-modified T cells, the animals treated with the chimeric NKG2D bearing T cells did not show any overt evidence of inflammatory damage, i.e. ruffled hair, hunchback, or diarrhea, etc., indicating that there was no overt toxicity (col. 7, lines 4-50). Results which do not suggest that the CAR expressing cells were toxic or potentially lethal as suggested by applicant.
Based on these teachings, US’804, which is applied in the rejection for teaching the NKG2D chimeric receptor, provides a reasonable expectation of success in using a CAR that targets NKG2D ligands without significant fratricide or toxicity while providing anti-tumor toxicity.
VanSeggelen, referenced by applicant in the response, does teach that the NKG2D CAR based therapies that were studied induced significant clinical toxicity resulting in morbidity and mortality (abstract); however, it is not clear that these NKG2D CARs had the same structure as those taught by US’804, which are referenced in the rejection. For instance, as discussed above, US’804 teaches receptors in which the CD3ζ domain is attached N-terminally to the NKG2D. As such, when expressed, the CD3ζ domain is reversed. It is not clear that this is the structure of the CAR studied in VanSeggelen.
Furthermore, even if it was the case that T cells expressing the CARs would express NKG2DL resulting fratricide; the claims do not require that the CARs be expressed in T cells. For instance, the independent claims 540 and 557 do not limit the immune cell in which the CARs are expressed. Dependent claim 549, which is the only claim that limits the immune effector cell to a specific type of cell, recites that the immune effector cells are natural killer (NK) cells, a limitation which is met in the rejection by the teachings of WO’190, which teaches that immune cells expressing the CARs can include T cells or NK cells. As discussed in the rejection, US’108 also teaches the use of NK cells teaching that the cell expressing both CARs is a primary NK cell. As discussed, US’108 also teaches that such cells do not require pre-activation and constitutively exhibit cytolytic functions and effectively kill cancer cells without the risk of inducing GVHD. In the case that NK cells were used to express the combination CAR, as suggested by these references, the expression of NKG2DL on the T cells comprising the CARs, such as in the teachings of VanSeggelen and instant specification paragraph [0501], would be a moot point. Along these lines, it is also noted that in Fig. 18, which applicant alleges as surprisingly showing that the CAR cells are effective while maintaining their survival and proliferative abilities, the cells used were NK cells. As such, the results are not surprising and are also not commensurate in scope with the claims. See MPEP 716.02.
Conclusion
No claims are allowed.
Applicant's amendment necessitated the new ground(s) of rejection presented in this Office action. Accordingly, THIS ACTION IS MADE FINAL. See MPEP § 706.07(a). Applicant is reminded of the extension of time policy as set forth in 37 CFR 1.136(a).
A shortened statutory period for reply to this final action is set to expire THREE MONTHS from the mailing date of this action. In the event a first reply is filed within TWO MONTHS of the mailing date of this final action and the advisory action is not mailed until after the end of the THREE-MONTH shortened statutory period, then the shortened statutory period will expire on the date the advisory action is mailed, and any nonprovisional extension fee (37 CFR 1.17(a)) pursuant to 37 CFR 1.136(a) will be calculated from the mailing date of the advisory action. In no event, however, will the statutory period for reply expire later than SIX MONTHS from the mailing date of this final action.
Any inquiry concerning this communication or earlier communications from the examiner should be directed to AUDREY L BUTTICE whose telephone number is (571)270-5049. The examiner can normally be reached M-Th 8:00-4:00.
Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice.
If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Joanne Hama can be reached on 571-272-2911. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300.
Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000.
/AUDREY L BUTTICE/Examiner, Art Unit 1647
/SCARLETT Y GOON/Supervisory Patent Examiner
Art Unit 1693