Prosecution Insights
Last updated: April 19, 2026
Application No. 18/255,182

COMPOSITIONS AND METHODS FOR THE TARGETING OF PTBP1

Non-Final OA §103§112§DP
Filed
May 31, 2023
Examiner
VIJAYARAGHAVAN, JAGAMYA NMN
Art Unit
1633
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Scribe Therapeutics Inc.
OA Round
1 (Non-Final)
70%
Grant Probability
Favorable
1-2
OA Rounds
3y 9m
To Grant
99%
With Interview

Examiner Intelligence

Grants 70% — above average
70%
Career Allow Rate
19 granted / 27 resolved
+10.4% vs TC avg
Strong +35% interview lift
Without
With
+34.7%
Interview Lift
resolved cases with interview
Typical timeline
3y 9m
Avg Prosecution
52 currently pending
Career history
79
Total Applications
across all art units

Statute-Specific Performance

§101
5.3%
-34.7% vs TC avg
§103
32.0%
-8.0% vs TC avg
§102
16.5%
-23.5% vs TC avg
§112
32.9%
-7.1% vs TC avg
Black line = Tech Center average estimate • Based on career data from 27 resolved cases

Office Action

§103 §112 §DP
Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Priority Applicant’s claim for the benefit of a prior-filed application under 35 U.S.C. 119(e) or under 35 U.S.C. 120, 121, 365(c), or 386(c) is acknowledged. Status of Claims Claims 184-204 are pending and under examination. Claim Objection Claim 195 should recite "the composition of 184 further comprising a donor template nucleic acid, wherein the donor template comprises a nucleic acid comprising at least a portion of a PTBP 1 gene …" to place the claim in proper form. Appropriate correction is required. Double Patenting The nonstatutory double patenting rejection is based on a judicially created doctrine grounded in public policy (a policy reflected in the statute) so as to prevent the unjustified or improper timewise extension of the “right to exclude” granted by a patent and to prevent possible harassment by multiple assignees. A nonstatutory double patenting rejection is appropriate where the conflicting claims are not identical, but at least one examined application claim is not patentably distinct from the reference claim(s) because the examined application claim is either anticipated by, or would have been obvious over, the reference claim(s). See, e.g., In re Berg, 140 F.3d 1428, 46 USPQ2d 1226 (Fed. Cir. 1998); In re Goodman, 11 F.3d 1046, 29 USPQ2d 2010 (Fed. Cir. 1993); In re Longi, 759 F.2d 887, 225 USPQ 645 (Fed. Cir. 1985); In re Van Ornum, 686 F.2d 937, 214 USPQ 761 (CCPA 1982); In re Vogel, 422 F.2d 438, 164 USPQ 619 (CCPA 1970); In re Thorington, 418 F.2d 528, 163 USPQ 644 (CCPA 1969). A timely filed terminal disclaimer in compliance with 37 CFR 1.321(c) or 1.321(d) may be used to overcome an actual or provisional rejection based on nonstatutory double patenting provided the reference application or patent either is shown to be commonly owned with the examined application, or claims an invention made as a result of activities undertaken within the scope of a joint research agreement. See MPEP § 717.02 for applications subject to examination under the first inventor to file provisions of the AIA as explained in MPEP § 2159. See MPEP § 2146 et seq. for applications not subject to examination under the first inventor to file provisions of the AIA . A terminal disclaimer must be signed in compliance with 37 CFR 1.321(b). The filing of a terminal disclaimer by itself is not a complete reply to a nonstatutory double patenting (NSDP) rejection. A complete reply requires that the terminal disclaimer be accompanied by a reply requesting reconsideration of the prior Office action. Even where the NSDP rejection is provisional the reply must be complete. See MPEP § 804, subsection I.B.1. For a reply to a non-final Office action, see 37 CFR 1.111(a). For a reply to final Office action, see 37 CFR 1.113(c). A request for reconsideration while not provided for in 37 CFR 1.113(c) may be filed after final for consideration. See MPEP §§ 706.07(e) and 714.13. The USPTO Internet website contains terminal disclaimer forms which may be used. Please visit www.uspto.gov/patent/patents-forms. The actual filing date of the application in which the form is filed determines what form (e.g., PTO/SB/25, PTO/SB/26, PTO/AIA /25, or PTO/AIA /26) should be used. A web-based eTerminal Disclaimer may be filled out completely online using web-screens. An eTerminal Disclaimer that meets all requirements is auto-processed and approved immediately upon submission. For more information about eTerminal Disclaimers, refer to www.uspto.gov/patents/apply/applying-online/eterminal-disclaimer. 11,976,277 Claims 184, 186-190, 195 are rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1-23 of U.S. Patent No. 11,976,277 (hereinafter "Fernandes") in view of Roberson (BMC Genomics 20, 528 (2019); hereinafter Roberson, See PTO-892). Although the claims at issue are not identical, they are not patentably distinct from each other because of the reasons stated below. Regarding claim 184, 186-188, 190, 195: Claim 1 of Fernandes is directed to a composition comprising a CRISPR nuclease and a CRISPR guide RNA. Claim 7 of Fernandes was directed to a CasX comprising a SEQ ID NO: 196, which is 100% identical to instant SEQ ID NO: 133 (See alignment below). Claim 11 of Fernandes taught that the CRISPR RNA comprises a scaffold sequence. It is noted that claims of Fernandes did not teach or suggest a gRNA comprising a targeting sequence that is complementary sequence to a PTBP1 gene target nucleic acid sequence. However, it would have been obvious for a person of ordinary skill in the art to arrive at a gRNA for CasX using routine experimentation. For example Roberson taught that CasX guide sites are relatively common in all their tested genomes (Roberson, p.4, col. 2, para 2). Roberson also taught a method to arrive at suitable guide sequences for CasX. For example Roberson “performed the annotations on the Washington University Center for High Performance Computing cluster. The motif location output included the location of the hit in the genome (contig, start, end) and the associated sequences.” Roberson “calculated the size of the reference genomes from their FASTA index files, determined the uniqueness of guide RNA sites amongst all editing sites, counted PAM usage, and annotated any overlaps with the exons of known genes. It is worth noting that uniqueness of a guide was determined only among editing sites. Presumably another site that matches the guide exactly, but does not have the PAM site would not be cleaved. A guide that overlaps an exon can likely be used to knockout the gene or knock-in coding variants at the exon.” (See Roberson, p. 2, para 2, as required by claims 186, 190). As such Roberson determined that arriving at a suitable gRNA for CasX is routine and systematic. One of ordinary skill in the art, given the teachings of Roberson would have readily designed a gRNA complementary to PTBP1 for use with the CasX protein taught by Fernandes, as design of such RNA is routine, predictable and well documented by prior art, as shown by Roberson. Query 1 QEIKRINKIRRRLVKDSNTKKAGKTGPMKTLLVRVMTPDLRERLENLRKKPENIPQPISN 60 QEIKRINKIRRRLVKDSNTKKAGKTGPMKTLLVRVMTPDLRERLENLRKKPENIPQPISN Sbjct 1 QEIKRINKIRRRLVKDSNTKKAGKTGPMKTLLVRVMTPDLRERLENLRKKPENIPQPISN 60 Query 61 TSRANLNKLLTDYTEMKKAILHVYWEEFQKDPVGLMSRVAQPASKKIDQNKLKPEMDEKG 120 TSRANLNKLLTDYTEMKKAILHVYWEEFQKDPVGLMSRVAQPASKKIDQNKLKPEMDEKG Sbjct 61 TSRANLNKLLTDYTEMKKAILHVYWEEFQKDPVGLMSRVAQPASKKIDQNKLKPEMDEKG 120 Query 121 NLTTAGFACSQCGQPLFVYKLEQVSEKGKAYTNYFGRCNVAEHEKLILLAQLKPEKDSDE 180 NLTTAGFACSQCGQPLFVYKLEQVSEKGKAYTNYFGRCNVAEHEKLILLAQLKPEKDSDE Sbjct 121 NLTTAGFACSQCGQPLFVYKLEQVSEKGKAYTNYFGRCNVAEHEKLILLAQLKPEKDSDE 180 Query 181 AVTYSLGKFGQRALDFYSIHVTKESTHPVKPLAQIAGNRYASGPVGKALSDACMGTIASF 240 AVTYSLGKFGQRALDFYSIHVTKESTHPVKPLAQIAGNRYASGPVGKALSDACMGTIASF Sbjct 181 AVTYSLGKFGQRALDFYSIHVTKESTHPVKPLAQIAGNRYASGPVGKALSDACMGTIASF 240 Query 241 LSKYQDIIIEHQKVVKGNQKRLESLRELAGKENLEYPSVTLPPQPHTKEGVDAYNEVIAR 300 LSKYQDIIIEHQKVVKGNQKRLESLRELAGKENLEYPSVTLPPQPHTKEGVDAYNEVIAR Sbjct 241 LSKYQDIIIEHQKVVKGNQKRLESLRELAGKENLEYPSVTLPPQPHTKEGVDAYNEVIAR 300 Query 301 VRMWVNLNLWQKLKLSRDDAKPLLRLKGFPSFPLVERQANEVDWWDMVCNVKKLINEKKE 360 VRMWVNLNLWQKLKLSRDDAKPLLRLKGFPSFPLVERQANEVDWWDMVCNVKKLINEKKE Sbjct 301 VRMWVNLNLWQKLKLSRDDAKPLLRLKGFPSFPLVERQANEVDWWDMVCNVKKLINEKKE 360 Query 361 DGKVFWQNLAGYKRQEALRPYLSSEEDRKKGKKFARYQLGDLLLHLEKKHGEDWGKVYDE 420 DGKVFWQNLAGYKRQEALRPYLSSEEDRKKGKKFARYQLGDLLLHLEKKHGEDWGKVYDE Sbjct 361 DGKVFWQNLAGYKRQEALRPYLSSEEDRKKGKKFARYQLGDLLLHLEKKHGEDWGKVYDE 420 Query 421 AWERIDKKVEGLSKHIKLEEERRSEDAQSKAALTDWLRAKASFVIEGLKEADKDEFCRCE 480 AWERIDKKVEGLSKHIKLEEERRSEDAQSKAALTDWLRAKASFVIEGLKEADKDEFCRCE Sbjct 421 AWERIDKKVEGLSKHIKLEEERRSEDAQSKAALTDWLRAKASFVIEGLKEADKDEFCRCE 480 Query 481 LKLQKWYGDLRGKPFAIEAENSILDISGFSKQYNCAFIWQKDGVKKLNLYLIINYFKGGK 540 LKLQKWYGDLRGKPFAIEAENSILDISGFSKQYNCAFIWQKDGVKKLNLYLIINYFKGGK Sbjct 481 LKLQKWYGDLRGKPFAIEAENSILDISGFSKQYNCAFIWQKDGVKKLNLYLIINYFKGGK 540 Query 541 LRFKKIKPEAFEANRFYTVINKKSGEIVPMEVNFNFDDPNLIILPLAFGKRQGREFIWND 600 LRFKKIKPEAFEANRFYTVINKKSGEIVPMEVNFNFDDPNLIILPLAFGKRQGREFIWND Sbjct 541 LRFKKIKPEAFEANRFYTVINKKSGEIVPMEVNFNFDDPNLIILPLAFGKRQGREFIWND 600 Query 601 LLSLETGSLKLANGRVIEKTLYNRRTRQDEPALFVALTFERREVLDSSNIKPMNLIGVDR 660 LLSLETGSLKLANGRVIEKTLYNRRTRQDEPALFVALTFERREVLDSSNIKPMNLIGVDR Sbjct 601 LLSLETGSLKLANGRVIEKTLYNRRTRQDEPALFVALTFERREVLDSSNIKPMNLIGVDR 660 Query 661 GENIPAVIALTDPEGCPLSRFKDSLGNPTHILRIGESYKEKQRTIQAKKEVEQRRAGGYS 720 GENIPAVIALTDPEGCPLSRFKDSLGNPTHILRIGESYKEKQRTIQAKKEVEQRRAGGYS Sbjct 661 GENIPAVIALTDPEGCPLSRFKDSLGNPTHILRIGESYKEKQRTIQAKKEVEQRRAGGYS 720 Query 721 RKYASKAKNLADDMVRNTARDLLYYAVTQDAMLIFENLSRGFGRQGKRTFMAERQYTRME 780 RKYASKAKNLADDMVRNTARDLLYYAVTQDAMLIFENLSRGFGRQGKRTFMAERQYTRME Sbjct 721 RKYASKAKNLADDMVRNTARDLLYYAVTQDAMLIFENLSRGFGRQGKRTFMAERQYTRME 780 Query 781 DWLTAKLAYEGLPSKTYLSKTLAQYTSKTCSNCGFTITSADYDRVLEKLKKTATGWMTTI 840 DWLTAKLAYEGLPSKTYLSKTLAQYTSKTCSNCGFTITSADYDRVLEKLKKTATGWMTTI Sbjct 781 DWLTAKLAYEGLPSKTYLSKTLAQYTSKTCSNCGFTITSADYDRVLEKLKKTATGWMTTI 840 Query 841 NGKELKVEGQITYYNRYKRQNVVKDLSVELDRLSEESVNNDISSWTKGRSGEALSLLKKR 900 NGKELKVEGQITYYNRYKRQNVVKDLSVELDRLSEESVNNDISSWTKGRSGEALSLLKKR Sbjct 841 NGKELKVEGQITYYNRYKRQNVVKDLSVELDRLSEESVNNDISSWTKGRSGEALSLLKKR 900 Query 901 FSHRPVQEKFVCLNCGFETHADEQAALNIARSWLFLRSQEYKKYQTNKTTGNTDKRAFVE 960 FSHRPVQEKFVCLNCGFETHADEQAALNIARSWLFLRSQEYKKYQTNKTTGNTDKRAFVE Sbjct 901 FSHRPVQEKFVCLNCGFETHADEQAALNIARSWLFLRSQEYKKYQTNKTTGNTDKRAFVE 960 Query 961 TWQSFYRKKLKEVWKPAV 978 TWQSFYRKKLKEVWKPAV Sbjct 961 TWQSFYRKKLKEVWKPAV 978 Regarding claim 189: Roberson taught that the CasX comprises a 4-basepair PAM: TTCN (See Roberson, p.1, col.2, para 2). Claims 191-192 are rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1-23 of U.S. Patent No. 11,976,277 (hereinafter "Fernandes") in view of Roberson (BMC Genomics (2019); hereinafter Roberson, See PTO-892) and Ousterout et al (Nat Commun. 2015 Feb 18; See PTO-892; hereinafter “Ousterout”). The teachings of Fernandes in view of Roberson are set forth above. Fernandes in view of Roberson did not teach a second gRNA comprising a scaffold and a targeting sequence as required by the claim. Ousterout taught that multiplex gRNA targeting to use two guide RNAs targeting the same exon or different genes are common practices in CRISPR technologies: “The versatility, efficiency and multiplexing capabilities of the CRISPR/Cas9 system enable a variety of otherwise challenging gene correction strategies. Here, we use the CRISPR/Cas9 system to restore the expression of the dystrophin gene in cells carrying dystrophin mutations that cause Duchenne muscular dystrophy (DMD). We design single or multiplexed sgRNAs to restore the dystrophin reading frame by targeting the mutational hotspot at exons 45–55 and introducing shifts within exons or deleting one or more exons.” (See Ousterout Abstract). One of ordinary skill in the art, given the teachings of Fernandes in view of Roberson and Ousterout would have readily designed multiple gRNAs for editing same exon complementary to PTBP1 for use with the CasX protein taught by Fernandes, as design of such RNAs is routine, predictable and well documented by prior art, as shown by Roberson and Ousterout. Claims 185, 195-196 are rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1-23 of U.S. Patent No. 11,976,277 (hereinafter "Fernandes") in view of Roberson (BMC Genomics (2019); hereinafter Roberson, See PTO-892) and WO2019084148A1 (Published May 2, 2019; See PTO-892; hereinafter “Nagy”). The teachings of Fernandes in view of Roberson are set forth above. Fernandes in view of Roberson did not teach a donor template comprising a scaffold and a targeting sequence as required by the claim. Nagy taught the use of donor template to introduce a nucleic acid into a target site. For example claim 12 of Nagy taught a method of modifying a target site using CasX, a gRNA and a donor template. As such one of ordinary skill in the art would have bene motivated to generate a composition comprising a CasX comprising the claimed sequence and a gRNA targeting PTBP1 and a template in view of the cited prior art. It is also noted that Nagy taught that the CasX nuclease further comprises a nuclear localization signal as required by claim 185. One of ordinary skill in the art, given the teachings of Fernandes in view of Roberson and Nagy would have readily arrived at a composition comprising a gRNA targeting PTBP1 for use with the CasX protein taught by Fernandes. The person would have been motivated to further modify the composition with a donor template to insert a sequence at the target site for further modifying the target site, as design of such RNAs is routine, predictable and well documented by prior art, as shown by Roberson and Nagy. U.S. Application No. 18/266,076 Claim 184, 186-190, 195 are provisionally rejected on the ground of nonstatutory double patenting as being unpatentable over claim 176-203 of copending Application No. 18/266,076 (reference application) in view of Roberson (BMC Genomics 20, 528 (2019); hereinafter Roberson, See PTO-892). Although the claims at issue are not identical, they are not patentably distinct from each other because of the reasons stated below. This is a provisional nonstatutory double patenting rejection because the patentably indistinct claims have not in fact been patented. Regarding claim 184, 186-188, 190, 195: Claim 1 of reference application is directed to a composition comprising a CRISPR nuclease and a CRISPR guide RNA. Claim 185 of reference application was directed to a CasX comprising a SEQ ID NO: 145, which is 100% identical to instant SEQ ID NO: 133 (See alignment below). Claim 194 of reference application taught that the CRISPR RNA comprises a scaffold sequence. It is noted that claims of reference application did not teach or suggest a gRNA comprising a targeting sequence that is complementary sequence to a PTBP1 gene target nucleic acid sequence. However, it would have been obvious for a person of ordinary skill in the art to arrive at a gRNA for CasX using routine experimentation. For example Roberson taught that CasX guide sites are relatively common in all their tested genomes (Roberson, p.4, col. 2, para 2). Roberson also taught a method to arrive at suitable guide sequences for CasX. For example Roberson “performed the annotations on the Washington University Center for High Performance Computing cluster. The motif location output included the location of the hit in the genome (contig, start, end) and the associated sequences.” Roberson “calculated the size of the reference genomes from their FASTA index files, determined the uniqueness of guide RNA sites amongst all editing sites, counted PAM usage, and annotated any overlaps with the exons of known genes. It is worth noting that uniqueness of a guide was determined only among editing sites. Presumably another site that matches the guide exactly, but does not have the PAM site would not be cleaved. A guide that overlaps an exon can likely be used to knockout the gene or knock-in coding variants at the exon.” (See Roberson, p. 2, para 2, as required by claims 186, 190). As such Roberson determined that arriving at a suitable gRNA for CasX is routine and systematic. One of ordinary skill in the art, given the teachings of Roberson would have readily designed a gRNA complementary to PTBP1 for use with the CasX protein taught by reference application, as design of such RNA is routine, predictable and well documented by prior art, as shown by Roberson. Query 1 QEIKRINKIRRRLVKDSNTKKAGKTGPMKTLLVRVMTPDLRERLENLRKKPENIPQPISN 60 QEIKRINKIRRRLVKDSNTKKAGKTGPMKTLLVRVMTPDLRERLENLRKKPENIPQPISN Sbjct 1 QEIKRINKIRRRLVKDSNTKKAGKTGPMKTLLVRVMTPDLRERLENLRKKPENIPQPISN 60 Query 61 TSRANLNKLLTDYTEMKKAILHVYWEEFQKDPVGLMSRVAQPASKKIDQNKLKPEMDEKG 120 TSRANLNKLLTDYTEMKKAILHVYWEEFQKDPVGLMSRVAQPASKKIDQNKLKPEMDEKG Sbjct 61 TSRANLNKLLTDYTEMKKAILHVYWEEFQKDPVGLMSRVAQPASKKIDQNKLKPEMDEKG 120 Query 121 NLTTAGFACSQCGQPLFVYKLEQVSEKGKAYTNYFGRCNVAEHEKLILLAQLKPEKDSDE 180 NLTTAGFACSQCGQPLFVYKLEQVSEKGKAYTNYFGRCNVAEHEKLILLAQLKPEKDSDE Sbjct 121 NLTTAGFACSQCGQPLFVYKLEQVSEKGKAYTNYFGRCNVAEHEKLILLAQLKPEKDSDE 180 Query 181 AVTYSLGKFGQRALDFYSIHVTKESTHPVKPLAQIAGNRYASGPVGKALSDACMGTIASF 240 AVTYSLGKFGQRALDFYSIHVTKESTHPVKPLAQIAGNRYASGPVGKALSDACMGTIASF Sbjct 181 AVTYSLGKFGQRALDFYSIHVTKESTHPVKPLAQIAGNRYASGPVGKALSDACMGTIASF 240 Query 241 LSKYQDIIIEHQKVVKGNQKRLESLRELAGKENLEYPSVTLPPQPHTKEGVDAYNEVIAR 300 LSKYQDIIIEHQKVVKGNQKRLESLRELAGKENLEYPSVTLPPQPHTKEGVDAYNEVIAR Sbjct 241 LSKYQDIIIEHQKVVKGNQKRLESLRELAGKENLEYPSVTLPPQPHTKEGVDAYNEVIAR 300 Query 301 VRMWVNLNLWQKLKLSRDDAKPLLRLKGFPSFPLVERQANEVDWWDMVCNVKKLINEKKE 360 VRMWVNLNLWQKLKLSRDDAKPLLRLKGFPSFPLVERQANEVDWWDMVCNVKKLINEKKE Sbjct 301 VRMWVNLNLWQKLKLSRDDAKPLLRLKGFPSFPLVERQANEVDWWDMVCNVKKLINEKKE 360 Query 361 DGKVFWQNLAGYKRQEALRPYLSSEEDRKKGKKFARYQLGDLLLHLEKKHGEDWGKVYDE 420 DGKVFWQNLAGYKRQEALRPYLSSEEDRKKGKKFARYQLGDLLLHLEKKHGEDWGKVYDE Sbjct 361 DGKVFWQNLAGYKRQEALRPYLSSEEDRKKGKKFARYQLGDLLLHLEKKHGEDWGKVYDE 420 Query 421 AWERIDKKVEGLSKHIKLEEERRSEDAQSKAALTDWLRAKASFVIEGLKEADKDEFCRCE 480 AWERIDKKVEGLSKHIKLEEERRSEDAQSKAALTDWLRAKASFVIEGLKEADKDEFCRCE Sbjct 421 AWERIDKKVEGLSKHIKLEEERRSEDAQSKAALTDWLRAKASFVIEGLKEADKDEFCRCE 480 Query 481 LKLQKWYGDLRGKPFAIEAENSILDISGFSKQYNCAFIWQKDGVKKLNLYLIINYFKGGK 540 LKLQKWYGDLRGKPFAIEAENSILDISGFSKQYNCAFIWQKDGVKKLNLYLIINYFKGGK Sbjct 481 LKLQKWYGDLRGKPFAIEAENSILDISGFSKQYNCAFIWQKDGVKKLNLYLIINYFKGGK 540 Query 541 LRFKKIKPEAFEANRFYTVINKKSGEIVPMEVNFNFDDPNLIILPLAFGKRQGREFIWND 600 LRFKKIKPEAFEANRFYTVINKKSGEIVPMEVNFNFDDPNLIILPLAFGKRQGREFIWND Sbjct 541 LRFKKIKPEAFEANRFYTVINKKSGEIVPMEVNFNFDDPNLIILPLAFGKRQGREFIWND 600 Query 601 LLSLETGSLKLANGRVIEKTLYNRRTRQDEPALFVALTFERREVLDSSNIKPMNLIGVDR 660 LLSLETGSLKLANGRVIEKTLYNRRTRQDEPALFVALTFERREVLDSSNIKPMNLIGVDR Sbjct 601 LLSLETGSLKLANGRVIEKTLYNRRTRQDEPALFVALTFERREVLDSSNIKPMNLIGVDR 660 Query 661 GENIPAVIALTDPEGCPLSRFKDSLGNPTHILRIGESYKEKQRTIQAKKEVEQRRAGGYS 720 GENIPAVIALTDPEGCPLSRFKDSLGNPTHILRIGESYKEKQRTIQAKKEVEQRRAGGYS Sbjct 661 GENIPAVIALTDPEGCPLSRFKDSLGNPTHILRIGESYKEKQRTIQAKKEVEQRRAGGYS 720 Query 721 RKYASKAKNLADDMVRNTARDLLYYAVTQDAMLIFENLSRGFGRQGKRTFMAERQYTRME 780 RKYASKAKNLADDMVRNTARDLLYYAVTQDAMLIFENLSRGFGRQGKRTFMAERQYTRME Sbjct 721 RKYASKAKNLADDMVRNTARDLLYYAVTQDAMLIFENLSRGFGRQGKRTFMAERQYTRME 780 Query 781 DWLTAKLAYEGLPSKTYLSKTLAQYTSKTCSNCGFTITSADYDRVLEKLKKTATGWMTTI 840 DWLTAKLAYEGLPSKTYLSKTLAQYTSKTCSNCGFTITSADYDRVLEKLKKTATGWMTTI Sbjct 781 DWLTAKLAYEGLPSKTYLSKTLAQYTSKTCSNCGFTITSADYDRVLEKLKKTATGWMTTI 840 Query 841 NGKELKVEGQITYYNRYKRQNVVKDLSVELDRLSEESVNNDISSWTKGRSGEALSLLKKR 900 NGKELKVEGQITYYNRYKRQNVVKDLSVELDRLSEESVNNDISSWTKGRSGEALSLLKKR Sbjct 841 NGKELKVEGQITYYNRYKRQNVVKDLSVELDRLSEESVNNDISSWTKGRSGEALSLLKKR 900 Query 901 FSHRPVQEKFVCLNCGFETHADEQAALNIARSWLFLRSQEYKKYQTNKTTGNTDKRAFVE 960 FSHRPVQEKFVCLNCGFETHADEQAALNIARSWLFLRSQEYKKYQTNKTTGNTDKRAFVE Sbjct 901 FSHRPVQEKFVCLNCGFETHADEQAALNIARSWLFLRSQEYKKYQTNKTTGNTDKRAFVE 960 Query 961 TWQSFYRKKLKEVWKPAV 978 TWQSFYRKKLKEVWKPAV Sbjct 961 TWQSFYRKKLKEVWKPAV 978 Regarding claim 189: Roberson taught that the CasX comprises a 4-basepair PAM: TTCN (See Roberson, p.1, col.2, para 2). Claims 184-204 are provisionally rejected on the ground of nonstatutory double patenting as being unpatentable over claim 176-203 of copending Application No. 18/266,076 (reference application) in view of Roberson (BMC Genomics (2019); hereinafter Roberson, See PTO-892) and Ousterout et al (Nat Commun. 2015 Feb 18; See PTO-892; hereinafter “Ousterout”). The teachings of Fernandes in view of Roberson are set forth above. Fernandes in view of Roberson did not teach a second gRNA comprising a scaffold and a targeting sequence as required by the claim. Ousterout taught that multiplex gRNA targeting to use two guide RNAs targeting the same exon or different genes are common practices in CRISPR technologies: “The versatility, efficiency and multiplexing capabilities of the CRISPR/Cas9 system enable a variety of otherwise challenging gene correction strategies. Here, we use the CRISPR/Cas9 system to restore the expression of the dystrophin gene in cells carrying dystrophin mutations that cause Duchenne muscular dystrophy (DMD). We design single or multiplexed sgRNAs to restore the dystrophin reading frame by targeting the mutational hotspot at exons 45–55 and introducing shifts within exons or deleting one or more exons.” (See Ousterout Abstract). One of ordinary skill in the art, given the teachings of Fernandes in view of Roberson and Ousterout would have readily designed multiple gRNAs for editing same exon complementary to PTBP1 for use with the CasX protein taught by Fernandes, as design of such RNAs is routine, predictable and well documented by prior art, as shown by Roberson and Ousterout. Claims 185, 195-196 are provisionally rejected on the ground of nonstatutory double patenting as being unpatentable over claim 176-203 of copending Application No. 18/266,076 (reference application) in view of in view of Roberson (BMC Genomics (2019); hereinafter Roberson, See PTO-892) and WO2019084148A1 (Published May 2, 2019; See PTO-892; hereinafter “Nagy”). The teachings of Fernandes in view of Roberson are set forth above. Fernandes in view of Roberson did not teach a donor template comprising a scaffold and a targeting sequence as required by the claim. Nagy taught the use of donor template to introduce a nucleic acid into a target site. For example claim 12 of Nagy taught a method of modifying a target site using CasX, a gRNA and a donor template. As such one of ordinary skill in the art would have bene motivated to generate a composition comprising a CasX comprising the claimed sequence and a gRNA targeting PTBP1 and a template in view of the cited prior art. It is also noted that Nagy taught that the CasX nuclease further comprises a nuclear localization signal as required by claim 185. One of ordinary skill in the art, given the teachings of Fernandes in view of Roberson and Nagy would have readily arrived at a composition comprising a gRNA targeting PTBP1 for use with the CasX protein taught by Fernandes. The person would have been motivated to further modify the composition with a donor template to insert a sequence at the target site for further modifying the target site, as design of such RNAs is routine, predictable and well documented by prior art, as shown by Roberson and Nagy. U.S. Application No. 18/255,172 Claim 184, 186-190, 195 are provisionally rejected on the ground of nonstatutory double patenting as being unpatentable over claim 209-246 of copending Application No. 18/255,172 (reference application) in view of Roberson (BMC Genomics 20, 528 (2019); hereinafter Roberson, See PTO-892). Although the claims at issue are not identical, they are not patentably distinct from each other because of the reasons stated below. This is a provisional nonstatutory double patenting rejection because the patentably indistinct claims have not in fact been patented. Regarding claim 184, 186-188, 190, 195: Claim 1 of reference application is directed to a composition comprising a CRISPR nuclease and a CRISPR guide RNA. Claim 222 of reference application was directed to a CasX comprising a SEQ ID NO: 133, which is 100% identical to instant SEQ ID NO: 133 (See alignment below). Claim 219 of reference application taught that the CRISPR RNA comprises a scaffold sequence. It is noted that claims of reference application did not teach or suggest a gRNA comprising a targeting sequence that is complementary sequence to a PTBP1 gene target nucleic acid sequence. However, it would have been obvious for a person of ordinary skill in the art to arrive at a gRNA for CasX using routine experimentation. For example Roberson taught that CasX guide sites are relatively common in all their tested genomes (Roberson, p.4, col. 2, para 2). Roberson also taught a method to arrive at suitable guide sequences for CasX. For example Roberson “performed the annotations on the Washington University Center for High Performance Computing cluster. The motif location output included the location of the hit in the genome (contig, start, end) and the associated sequences.” Roberson “calculated the size of the reference genomes from their FASTA index files, determined the uniqueness of guide RNA sites amongst all editing sites, counted PAM usage, and annotated any overlaps with the exons of known genes. It is worth noting that uniqueness of a guide was determined only among editing sites. Presumably another site that matches the guide exactly, but does not have the PAM site would not be cleaved. A guide that overlaps an exon can likely be used to knockout the gene or knock-in coding variants at the exon.” (See Roberson, p. 2, para 2, as required by claims 186, 190). As such Roberson determined that arriving at a suitable gRNA for CasX is routine and systematic. One of ordinary skill in the art, given the teachings of Roberson would have readily designed a gRNA complementary to PTBP1 for use with the CasX protein taught by reference application, as design of such RNA is routine, predictable and well documented by prior art, as shown by Roberson. Query 1 QEIKRINKIRRRLVKDSNTKKAGKTGPMKTLLVRVMTPDLRERLENLRKKPENIPQPISN 60 QEIKRINKIRRRLVKDSNTKKAGKTGPMKTLLVRVMTPDLRERLENLRKKPENIPQPISN Sbjct 1 QEIKRINKIRRRLVKDSNTKKAGKTGPMKTLLVRVMTPDLRERLENLRKKPENIPQPISN 60 Query 61 TSRANLNKLLTDYTEMKKAILHVYWEEFQKDPVGLMSRVAQPASKKIDQNKLKPEMDEKG 120 TSRANLNKLLTDYTEMKKAILHVYWEEFQKDPVGLMSRVAQPASKKIDQNKLKPEMDEKG Sbjct 61 TSRANLNKLLTDYTEMKKAILHVYWEEFQKDPVGLMSRVAQPASKKIDQNKLKPEMDEKG 120 Query 121 NLTTAGFACSQCGQPLFVYKLEQVSEKGKAYTNYFGRCNVAEHEKLILLAQLKPEKDSDE 180 NLTTAGFACSQCGQPLFVYKLEQVSEKGKAYTNYFGRCNVAEHEKLILLAQLKPEKDSDE Sbjct 121 NLTTAGFACSQCGQPLFVYKLEQVSEKGKAYTNYFGRCNVAEHEKLILLAQLKPEKDSDE 180 Query 181 AVTYSLGKFGQRALDFYSIHVTKESTHPVKPLAQIAGNRYASGPVGKALSDACMGTIASF 240 AVTYSLGKFGQRALDFYSIHVTKESTHPVKPLAQIAGNRYASGPVGKALSDACMGTIASF Sbjct 181 AVTYSLGKFGQRALDFYSIHVTKESTHPVKPLAQIAGNRYASGPVGKALSDACMGTIASF 240 Query 241 LSKYQDIIIEHQKVVKGNQKRLESLRELAGKENLEYPSVTLPPQPHTKEGVDAYNEVIAR 300 LSKYQDIIIEHQKVVKGNQKRLESLRELAGKENLEYPSVTLPPQPHTKEGVDAYNEVIAR Sbjct 241 LSKYQDIIIEHQKVVKGNQKRLESLRELAGKENLEYPSVTLPPQPHTKEGVDAYNEVIAR 300 Query 301 VRMWVNLNLWQKLKLSRDDAKPLLRLKGFPSFPLVERQANEVDWWDMVCNVKKLINEKKE 360 VRMWVNLNLWQKLKLSRDDAKPLLRLKGFPSFPLVERQANEVDWWDMVCNVKKLINEKKE Sbjct 301 VRMWVNLNLWQKLKLSRDDAKPLLRLKGFPSFPLVERQANEVDWWDMVCNVKKLINEKKE 360 Query 361 DGKVFWQNLAGYKRQEALRPYLSSEEDRKKGKKFARYQLGDLLLHLEKKHGEDWGKVYDE 420 DGKVFWQNLAGYKRQEALRPYLSSEEDRKKGKKFARYQLGDLLLHLEKKHGEDWGKVYDE Sbjct 361 DGKVFWQNLAGYKRQEALRPYLSSEEDRKKGKKFARYQLGDLLLHLEKKHGEDWGKVYDE 420 Query 421 AWERIDKKVEGLSKHIKLEEERRSEDAQSKAALTDWLRAKASFVIEGLKEADKDEFCRCE 480 AWERIDKKVEGLSKHIKLEEERRSEDAQSKAALTDWLRAKASFVIEGLKEADKDEFCRCE Sbjct 421 AWERIDKKVEGLSKHIKLEEERRSEDAQSKAALTDWLRAKASFVIEGLKEADKDEFCRCE 480 Query 481 LKLQKWYGDLRGKPFAIEAENSILDISGFSKQYNCAFIWQKDGVKKLNLYLIINYFKGGK 540 LKLQKWYGDLRGKPFAIEAENSILDISGFSKQYNCAFIWQKDGVKKLNLYLIINYFKGGK Sbjct 481 LKLQKWYGDLRGKPFAIEAENSILDISGFSKQYNCAFIWQKDGVKKLNLYLIINYFKGGK 540 Query 541 LRFKKIKPEAFEANRFYTVINKKSGEIVPMEVNFNFDDPNLIILPLAFGKRQGREFIWND 600 LRFKKIKPEAFEANRFYTVINKKSGEIVPMEVNFNFDDPNLIILPLAFGKRQGREFIWND Sbjct 541 LRFKKIKPEAFEANRFYTVINKKSGEIVPMEVNFNFDDPNLIILPLAFGKRQGREFIWND 600 Query 601 LLSLETGSLKLANGRVIEKTLYNRRTRQDEPALFVALTFERREVLDSSNIKPMNLIGVDR 660 LLSLETGSLKLANGRVIEKTLYNRRTRQDEPALFVALTFERREVLDSSNIKPMNLIGVDR Sbjct 601 LLSLETGSLKLANGRVIEKTLYNRRTRQDEPALFVALTFERREVLDSSNIKPMNLIGVDR 660 Query 661 GENIPAVIALTDPEGCPLSRFKDSLGNPTHILRIGESYKEKQRTIQAKKEVEQRRAGGYS 720 GENIPAVIALTDPEGCPLSRFKDSLGNPTHILRIGESYKEKQRTIQAKKEVEQRRAGGYS Sbjct 661 GENIPAVIALTDPEGCPLSRFKDSLGNPTHILRIGESYKEKQRTIQAKKEVEQRRAGGYS 720 Query 721 RKYASKAKNLADDMVRNTARDLLYYAVTQDAMLIFENLSRGFGRQGKRTFMAERQYTRME 780 RKYASKAKNLADDMVRNTARDLLYYAVTQDAMLIFENLSRGFGRQGKRTFMAERQYTRME Sbjct 721 RKYASKAKNLADDMVRNTARDLLYYAVTQDAMLIFENLSRGFGRQGKRTFMAERQYTRME 780 Query 781 DWLTAKLAYEGLPSKTYLSKTLAQYTSKTCSNCGFTITSADYDRVLEKLKKTATGWMTTI 840 DWLTAKLAYEGLPSKTYLSKTLAQYTSKTCSNCGFTITSADYDRVLEKLKKTATGWMTTI Sbjct 781 DWLTAKLAYEGLPSKTYLSKTLAQYTSKTCSNCGFTITSADYDRVLEKLKKTATGWMTTI 840 Query 841 NGKELKVEGQITYYNRYKRQNVVKDLSVELDRLSEESVNNDISSWTKGRSGEALSLLKKR 900 NGKELKVEGQITYYNRYKRQNVVKDLSVELDRLSEESVNNDISSWTKGRSGEALSLLKKR Sbjct 841 NGKELKVEGQITYYNRYKRQNVVKDLSVELDRLSEESVNNDISSWTKGRSGEALSLLKKR 900 Query 901 FSHRPVQEKFVCLNCGFETHADEQAALNIARSWLFLRSQEYKKYQTNKTTGNTDKRAFVE 960 FSHRPVQEKFVCLNCGFETHADEQAALNIARSWLFLRSQEYKKYQTNKTTGNTDKRAFVE Sbjct 901 FSHRPVQEKFVCLNCGFETHADEQAALNIARSWLFLRSQEYKKYQTNKTTGNTDKRAFVE 960 Query 961 TWQSFYRKKLKEVWKPAV 978 TWQSFYRKKLKEVWKPAV Sbjct 961 TWQSFYRKKLKEVWKPAV 978 Regarding claim 189: Roberson taught that the CasX comprises a 4-basepair PAM: TTCN (See Roberson, p.1, col.2, para 2). Claims 184-204 are provisionally rejected on the ground of nonstatutory double patenting as being unpatentable over claim 209-246 of copending Application No. 18/255,172 (reference application) in view of Roberson (BMC Genomics (2019); hereinafter Roberson, See PTO-892) and Ousterout et al (Nat Commun. 2015 Feb 18; See PTO-892; hereinafter “Ousterout”). The teachings of Fernandes in view of Roberson are set forth above. Fernandes in view of Roberson did not teach a second gRNA comprising a scaffold and a targeting sequence as required by the claim. Ousterout taught that multiplex gRNA targeting to use two guide RNAs targeting the same exon or different genes are common practices in CRISPR technologies: “The versatility, efficiency and multiplexing capabilities of the CRISPR/Cas9 system enable a variety of otherwise challenging gene correction strategies. Here, we use the CRISPR/Cas9 system to restore the expression of the dystrophin gene in cells carrying dystrophin mutations that cause Duchenne muscular dystrophy (DMD). We design single or multiplexed sgRNAs to restore the dystrophin reading frame by targeting the mutational hotspot at exons 45–55 and introducing shifts within exons or deleting one or more exons.” (See Ousterout Abstract). One of ordinary skill in the art, given the teachings of Fernandes in view of Roberson and Ousterout would have readily designed multiple gRNAs for editing same exon complementary to PTBP1 for use with the CasX protein taught by Fernandes, as design of such RNAs is routine, predictable and well documented by prior art, as shown by Roberson and Ousterout. Claims 185, 195-196 are provisionally rejected on the ground of nonstatutory double patenting as being unpatentable over claim 209-246 of copending Application No. 18/255,172 (reference application) in view of in view of Roberson (BMC Genomics (2019); hereinafter Roberson, See PTO-892) and WO2019084148A1 (Published May 2, 2019; See PTO-892; hereinafter “Nagy”). The teachings of Fernandes in view of Roberson are set forth above. Fernandes in view of Roberson did not teach a donor template comprising a scaffold and a targeting sequence as required by the claim. Nagy taught the use of donor template to introduce a nucleic acid into a target site. For example claim 12 of Nagy taught a method of modifying a target site using CasX, a gRNA and a donor template. As such one of ordinary skill in the art would have bene motivated to generate a composition comprising a CasX comprising the claimed sequence and a gRNA targeting PTBP1 and a template in view of the cited prior art. It is also noted that Nagy taught that the CasX nuclease further comprises a nuclear localization signal as required by claim 185. One of ordinary skill in the art, given the teachings of Fernandes in view of Roberson and Nagy would have readily arrived at a composition comprising a gRNA targeting PTBP1 for use with the CasX protein taught by Fernandes. The person would have been motivated to further modify the composition with a donor template to insert a sequence at the target site for further modifying the target site, as design of such RNAs is routine, predictable and well documented by prior art, as shown by Roberson and Nagy. U.S. Application No. 17/791,130 Claim 184, 186-190, 195 are provisionally rejected on the ground of nonstatutory double patenting as being unpatentable over claim 215-237 of copending Application No. 17/791,130 (reference application) in view of Roberson (BMC Genomics 20, 528 (2019); hereinafter Roberson, See PTO-892). Although the claims at issue are not identical, they are not patentably distinct from each other because of the reasons stated below. This is a provisional nonstatutory double patenting rejection because the patentably indistinct claims have not in fact been patented. Regarding claim 184, 186-188, 190, 195: Claim 1 of reference application is directed to a composition comprising a CRISPR nuclease and a CRISPR guide RNA. Claim 222 of reference application was directed to a CasX comprising a SEQ ID NO: 145, which is 100% identical to instant SEQ ID NO: 133 (See alignment below). Claim 226 of reference application taught that the CRISPR RNA comprises a scaffold sequence. It is noted that claims of reference application did not teach or suggest a gRNA comprising a targeting sequence that is complementary sequence to a PTBP1 gene target nucleic acid sequence. However, it would have been obvious for a person of ordinary skill in the art to arrive at a gRNA for CasX using routine experimentation. For example Roberson taught that CasX guide sites are relatively common in all their tested genomes (Roberson, p.4, col. 2, para 2). Roberson also taught a method to arrive at suitable guide sequences for CasX. For example Roberson “performed the annotations on the Washington University Center for High Performance Computing cluster. The motif location output included the location of the hit in the genome (contig, start, end) and the associated sequences.” Roberson “calculated the size of the reference genomes from their FASTA index files, determined the uniqueness of guide RNA sites amongst all editing sites, counted PAM usage, and annotated any overlaps with the exons of known genes. It is worth noting that uniqueness of a guide was determined only among editing sites. Presumably another site that matches the guide exactly, but does not have the PAM site would not be cleaved. A guide that overlaps an exon can likely be used to knockout the gene or knock-in coding variants at the exon.” (See Roberson, p. 2, para 2, as required by claims 186, 190). As such Roberson determined that arriving at a suitable gRNA for CasX is routine and systematic. One of ordinary skill in the art, given the teachings of Roberson would have readily designed a gRNA complementary to PTBP1 for use with the CasX protein taught by reference application, as design of such RNA is routine, predictable and well documented by prior art, as shown by Roberson. Query 1 QEIKRINKIRRRLVKDSNTKKAGKTGPMKTLLVRVMTPDLRERLENLRKKPENIPQPISN 60 QEIKRINKIRRRLVKDSNTKKAGKTGPMKTLLVRVMTPDLRERLENLRKKPENIPQPISN Sbjct 1 QEIKRINKIRRRLVKDSNTKKAGKTGPMKTLLVRVMTPDLRERLENLRKKPENIPQPISN 60 Query 61 TSRANLNKLLTDYTEMKKAILHVYWEEFQKDPVGLMSRVAQPASKKIDQNKLKPEMDEKG 120 TSRANLNKLLTDYTEMKKAILHVYWEEFQKDPVGLMSRVAQPASKKIDQNKLKPEMDEKG Sbjct 61 TSRANLNKLLTDYTEMKKAILHVYWEEFQKDPVGLMSRVAQPASKKIDQNKLKPEMDEKG 120 Query 121 NLTTAGFACSQCGQPLFVYKLEQVSEKGKAYTNYFGRCNVAEHEKLILLAQLKPEKDSDE 180 NLTTAGFACSQCGQPLFVYKLEQVSEKGKAYTNYFGRCNVAEHEKLILLAQLKPEKDSDE Sbjct 121 NLTTAGFACSQCGQPLFVYKLEQVSEKGKAYTNYFGRCNVAEHEKLILLAQLKPEKDSDE 180 Query 181 AVTYSLGKFGQRALDFYSIHVTKESTHPVKPLAQIAGNRYASGPVGKALSDACMGTIASF 240 AVTYSLGKFGQRALDFYSIHVTKESTHPVKPLAQIAGNRYASGPVGKALSDACMGTIASF Sbjct 181 AVTYSLGKFGQRALDFYSIHVTKESTHPVKPLAQIAGNRYASGPVGKALSDACMGTIASF 240 Query 241 LSKYQDIIIEHQKVVKGNQKRLESLRELAGKENLEYPSVTLPPQPHTKEGVDAYNEVIAR 300 LSKYQDIIIEHQKVVKGNQKRLESLRELAGKENLEYPSVTLPPQPHTKEGVDAYNEVIAR Sbjct 241 LSKYQDIIIEHQKVVKGNQKRLESLRELAGKENLEYPSVTLPPQPHTKEGVDAYNEVIAR 300 Query 301 VRMWVNLNLWQKLKLSRDDAKPLLRLKGFPSFPLVERQANEVDWWDMVCNVKKLINEKKE 360 VRMWVNLNLWQKLKLSRDDAKPLLRLKGFPSFPLVERQANEVDWWDMVCNVKKLINEKKE Sbjct 301 VRMWVNLNLWQKLKLSRDDAKPLLRLKGFPSFPLVERQANEVDWWDMVCNVKKLINEKKE 360 Query 361 DGKVFWQNLAGYKRQEALRPYLSSEEDRKKGKKFARYQLGDLLLHLEKKHGEDWGKVYDE 420 DGKVFWQNLAGYKRQEALRPYLSSEEDRKKGKKFARYQLGDLLLHLEKKHGEDWGKVYDE Sbjct 361 DGKVFWQNLAGYKRQEALRPYLSSEEDRKKGKKFARYQLGDLLLHLEKKHGEDWGKVYDE 420 Query 421 AWERIDKKVEGLSKHIKLEEERRSEDAQSKAALTDWLRAKASFVIEGLKEADKDEFCRCE 480 AWERIDKKVEGLSKHIKLEEERRSEDAQSKAALTDWLRAKASFVIEGLKEADKDEFCRCE Sbjct 421 AWERIDKKVEGLSKHIKLEEERRSEDAQSKAALTDWLRAKASFVIEGLKEADKDEFCRCE 480 Query 481 LKLQKWYGDLRGKPFAIEAENSILDISGFSKQYNCAFIWQKDGVKKLNLYLIINYFKGGK 540 LKLQKWYGDLRGKPFAIEAENSILDISGFSKQYNCAFIWQKDGVKKLNLYLIINYFKGGK Sbjct 481 LKLQKWYGDLRGKPFAIEAENSILDISGFSKQYNCAFIWQKDGVKKLNLYLIINYFKGGK 540 Query 541 LRFKKIKPEAFEANRFYTVINKKSGEIVPMEVNFNFDDPNLIILPLAFGKRQGREFIWND 600 LRFKKIKPEAFEANRFYTVINKKSGEIVPMEVNFNFDDPNLIILPLAFGKRQGREFIWND Sbjct 541 LRFKKIKPEAFEANRFYTVINKKSGEIVPMEVNFNFDDPNLIILPLAFGKRQGREFIWND 600 Query 601 LLSLETGSLKLANGRVIEKTLYNRRTRQDEPALFVALTFERREVLDSSNIKPMNLIGVDR 660 LLSLETGSLKLANGRVIEKTLYNRRTRQDEPALFVALTFERREVLDSSNIKPMNLIGVDR Sbjct 601 LLSLETGSLKLANGRVIEKTLYNRRTRQDEPALFVALTFERREVLDSSNIKPMNLIGVDR 660 Query 661 GENIPAVIALTDPEGCPLSRFKDSLGNPTHILRIGESYKEKQRTIQAKKEVEQRRAGGYS 720 GENIPAVIALTDPEGCPLSRFKDSLGNPTHILRIGESYKEKQRTIQAKKEVEQRRAGGYS Sbjct 661 GENIPAVIALTDPEGCPLSRFKDSLGNPTHILRIGESYKEKQRTIQAKKEVEQRRAGGYS 720 Query 721 RKYASKAKNLADDMVRNTARDLLYYAVTQDAMLIFENLSRGFGRQGKRTFMAERQYTRME 780 RKYASKAKNLADDMVRNTARDLLYYAVTQDAMLIFENLSRGFGRQGKRTFMAERQYTRME Sbjct 721 RKYASKAKNLADDMVRNTARDLLYYAVTQDAMLIFENLSRGFGRQGKRTFMAERQYTRME 780 Query 781 DWLTAKLAYEGLPSKTYLSKTLAQYTSKTCSNCGFTITSADYDRVLEKLKKTATGWMTTI 840 DWLTAKLAYEGLPSKTYLSKTLAQYTSKTCSNCGFTITSADYDRVLEKLKKTATGWMTTI Sbjct 781 DWLTAKLAYEGLPSKTYLSKTLAQYTSKTCSNCGFTITSADYDRVLEKLKKTATGWMTTI 840 Query 841 NGKELKVEGQITYYNRYKRQNVVKDLSVELDRLSEESVNNDISSWTKGRSGEALSLLKKR 900 NGKELKVEGQITYYNRYKRQNVVKDLSVELDRLSEESVNNDISSWTKGRSGEALSLLKKR Sbjct 841 NGKELKVEGQITYYNRYKRQNVVKDLSVELDRLSEESVNNDISSWTKGRSGEALSLLKKR 900 Query 901 FSHRPVQEKFVCLNCGFETHADEQAALNIARSWLFLRSQEYKKYQTNKTTGNTDKRAFVE 960 FSHRPVQEKFVCLNCGFETHADEQAALNIARSWLFLRSQEYKKYQTNKTTGNTDKRAFVE Sbjct 901 FSHRPVQEKFVCLNCGFETHADEQAALNIARSWLFLRSQEYKKYQTNKTTGNTDKRAFVE 960 Query 961 TWQSFYRKKLKEVWKPAV 978 TWQSFYRKKLKEVWKPAV Sbjct 961 TWQSFYRKKLKEVWKPAV 978 Regarding claim 189: Roberson taught that the CasX comprises a 4-basepair PAM: TTCN (See Roberson, p.1, col.2, para 2). Claims 184-204 are provisionally rejected on the ground of nonstatutory double patenting as being unpatentable over claim 215-237 of copending Application No. 17/791,130 (reference application) in view of Roberson (BMC Genomics (2019); hereinafter Roberson, See PTO-892) and Ousterout et al (Nat Commun. 2015 Feb 18; See PTO-892; hereinafter “Ousterout”). The teachings of Fernandes in view of Roberson are set forth above. Fernandes in view of Roberson did not teach a second gRNA comprising a scaffold and a targeting sequence as required by the claim. Ousterout taught that multiplex gRNA targeting to use two guide RNAs targeting the same exon or different genes are common practices in CRISPR technologies: “The versatility, efficiency and multiplexing capabilities of the CRISPR/Cas9 system enable a variety of otherwise challenging gene correction strategies. Here, we use the CRISPR/Cas9 system to restore the expression of the dystrophin gene in cells carrying dystrophin mutations that cause Duchenne muscular dystrophy (DMD). We design single or multiplexed sgRNAs to restore the dystrophin reading frame by targeting the mutational hotspot at exons 45–55 and introducing shifts within exons or deleting one or more exons.” (See Ousterout Abstract). One of ordinary skill in the art, given the teachings of Fernandes in view of Roberson and Ousterout would have readily designed multiple gRNAs for editing same exon complementary to PTBP1 for use with the CasX protein taught by Fernandes, as design of such RNAs is routine, predictable and well documented by prior art, as shown by Roberson and Ousterout. Claims 185, 195-196 are provisionally rejected on the ground of nonstatutory double patenting as being unpatentable over claim 215-237 of copending Application No. 17/791,130 (reference application) in view of in view of Roberson (BMC Genomics (2019); hereinafter Roberson, See PTO-892) and WO2019084148A1 (Published May 2, 2019; See PTO-892; hereinafter “Nagy”). The teachings of Fernandes in view of Roberson are set forth above. Fernandes in view of Roberson did not teach a donor template comprising a scaffold and a targeting sequence as required by the claim. Nagy taught the use of donor template to introduce a nucleic acid into a target site. For example claim 12 of Nagy taught a method of modifying a target site using CasX, a gRNA and a donor template. As such one of ordinary skill in the art would have bene motivated to generate a composition comprising a CasX comprising the claimed sequence and a gRNA targeting PTBP1 and a template in view of the cited prior art. It is also noted that Nagy taught that the CasX nuclease further comprises a nuclear localization signal as required by claim 185. One of ordinary skill in the art, given the teachings of Fernandes in view of Roberson and Nagy would have readily arrived at a composition comprising a gRNA targeting PTBP1 for use with the CasX protein taught by Fernandes. The person would have been motivated to further modify the composition with a donor template to insert a sequence at the target site for further modifying the target site, as design of such RNAs is routine, predictable and well documented by prior art, as shown by Roberson and Nagy. U.S. Application No. 18/568,029 Claim 184, 186-190, 195 are provisionally rejected on the ground of nonstatutory double patenting as being unpatentable over claim 1-4, 13-14, 18-20, 23, 25-31, 35, 37-39, 41-43, 45 of copending Application No. 18/568,029 (reference application) in view of Roberson (BMC Genomics 20, 528 (2019); hereinafter Roberson, See PTO-892). Although the claims at issue are not identical, they are not patentably distinct from each other because of the reasons stated below. This is a provisional nonstatutory double patenting rejection because the patentably indistinct claims have not in fact been patented. Regarding claim 184, 186-188, 190, 195: Claim 1 of reference application is directed to a composition comprising a CRISPR nuclease and a CRISPR guide RNA. Claim 39 of reference application was directed to a CasX comprising SEQ ID NOs: 635, 668, 892, 829, 871, 868, 828, 703, 878, 931, 928, 929, 834, which are > 90% identical to instant SEQ ID NO: 133 (See for alignment of SEQ ID NO: 635 with SEQ ID NO: 133 below). Claim 41 of reference application taught that the CRISPR RNA comprises a scaffold sequence. It is noted that claims of reference application did not teach or suggest a gRNA comprising a targeting sequence that is complementary sequence to a PTBP1 gene target nucleic acid sequence. However, it would have been obvious for a person of ordinary skill in the art to arrive at a gRNA for CasX using routine experimentation. For example Roberson taught that CasX guide sites are relatively common in all their tested genomes (Roberson, p.4, col. 2, para 2). Roberson also taught a method to arrive at suitable guide sequences for CasX. For example Roberson “performed the annotations on the Washington University Center for High Performance Computing cluster. The motif location output included the location of the hit in the genome (contig, start, end) and the associated sequences.” Roberson “calculated the size of the reference genomes from their FASTA index files, determined the uniqueness of guide RNA sites amongst all editing sites, counted PAM usage, and annotated any overlaps with the exons of known genes. It is worth noting that uniqueness of a guide was determined only among editing sites. Presumably another site that matches the guide exactly, but does not have the PAM site would not be cleaved. A guide that overlaps an exon can likely be used to knockout the gene or knock-in coding variants at the exon.” (See Roberson, p. 2, para 2, as required by claims 186, 190). As such Roberson determined that arriving at a suitable gRNA for CasX is routine and systematic. One of ordinary skill in the art, given the teachings of Roberson would have readily designed a gRNA complementary to PTBP1 for use with the CasX protein taught by reference application, as design of such RNA is routine, predictable and well documented by prior art, as shown by Roberson. Query 1 QEIKRINKIRRRLVKDSNTKKAGKTGPMKTLLVRVMTPDLRERLENLRKKPENIPQPISN 60 QEIKRINKIRRRLVKDSNTKKAGKTGPMKTLLVRVMTPDLRERLENLRKKPENIPQPISN Sbjct 1 QEIKRINKIRRRLVKDSNTKKAGKTGPMKTLLVRVMTPDLRERLENLRKKPENIPQPISN 60 Query 61 TSRANLNKLLTDYTEMKKAILHVYWEEFQKDPVGLMSRVAQPASKKIDQNKLKPEMDEKG 120 TSRANLNKLLTDYTEMKKAILHVYWEEFQKDPVGLMSRVAQPASKKIDQNKLKPEMDEKG Sbjct 61 TSRANLNKLLTDYTEMKKAILHVYWEEFQKDPVGLMSRVAQPASKKIDQNKLKPEMDEKG 120 Query 121 NLTTAGFACSQCGQPLFVYKLEQVSEKGKAYTNYFGRCNVAEHEKLILLAQLKPEKDSDE 180 NLTTAGFACSQCGQPLFVYKLEQVSEKGKAYTNYFGRCNVAEHEKLILLAQLKPEKDSDE Sbjct 121 NLTTAGFACSQCGQPLFVYKLEQVSEKGKAYTNYFGRCNVAEHEKLILLAQLKPEKDSDE 180 Query 181 AVTYSLGKFGQRALDFYSIHVTKESTHPVKPLAQIAGNRYASGPVGKALSDACMGTIASF 240 AVTYSLGKFGQRALDFYSIHVTKESTHPVKPLAQIAGNRYASGPVGKALSDACMGTIASF Sbjct 181 AVTYSLGKFGQRALDFYSIHVTKESTHPVKPLAQIAGNRYASGPVGKALSDACMGTIASF 240 Query 241 LSKYQDIIIEHQKVVKGNQKRLESLRELAGKENLEYPSVTLPPQPHTKEGVDAYNEVIAR 300 LSKYQDIIIEHQKVVKGNQKRLESLRELAGKENLEYPSVTLPPQPHTKEGVDAYNEVIAR Sbjct 241 LSKYQDIIIEHQKVVKGNQKRLESLRELAGKENLEYPSVTLPPQPHTKEGVDAYNEVIAR 300 Query 301 VRMWVNLNLWQKLKLSRDDAKPLLRLKGFPSFPLVERQANEVDWWDMVCNVKKLINEKKE 360 VRMWVNLNLWQKLKLSRDDAKPLLRLKGFPSFPLVERQANEVDWWDMVCNVKKLINEKKE Sbjct 301 VRMWVNLNLWQKLKLSRDDAKPLLRLKGFPSFPLVERQANEVDWWDMVCNVKKLINEKKE 360 Query 361 DGKVFWQNLAGYKRQEALRPYLSSEEDRKKGKKFARYQLGDLLLHLEKKHGEDWGKVYDE 420 DGKVFWQNLAGYKRQEALRPYLSSEEDRKKGKKFARYQLGDLLLHLEKKHGEDWGKVYDE Sbjct 361 DGKVFWQNLAGYKRQEALRPYLSSEEDRKKGKKFARYQLGDLLLHLEKKHGEDWGKVYDE 420 Query 421 AWERIDKKVEGLSKHIKLEEERRSEDAQSKAALTDWLRAKASFVIEGLKEADKDEFCRCE 480 AWERIDKKVEGLSKHIKLEEERRSEDAQSKAALTDWLRAKASFVIEGLKEADKDEFCRCE Sbjct 421 AWERIDKKVEGLSKHIKLEEERRSEDAQSKAALTDWLRAKASFVIEGLKEADKDEFCRCE 480 Query 481 LKLQKWYGDLRGKPFAIEAENSILDISGFSKQYNCAFIWQKDGVKKLNLYLIINYFKGGK 540 LKLQKWYGDLRGKPFAIEAENSILDISGFSKQYNCAFIWQKDGVKKLNLYLIINYFKGGK Sbjct 481 LKLQKWYGDLRGKPFAIEAENSILDISGFSKQYNCAFIWQKDGVKKLNLYLIINYFKGGK 540 Query 541 LRFKKIKPEAFEANRFYTVINKKSGEIVPMEVNFNFDDPNLIILPLAFGKRQGREFIWND 600 LRFKKIKPEAFEANRFYTVINKKSGEIVPMEVNFNFDDPNLIILPLAFGKRQGREFIWND Sbjct 541 LRFKKIKPEAFEANRFYTVINKKSGEIVPMEVNFNFDDPNLIILPLAFGKRQGREFIWND 600 Query 601 LLSLETGSLKLANGRVIEKTLYNRRTRQDEPALFVALTFERREVLDSSNIKPMNLIGVDR 660 LLSLETGSLKLANGRVIEKTLYNRRTRQDEPALFVALTFERREVLDSSNIKPMNLIGVDR Sbjct 601 LLSLETGSLKLANGRVIEKTLYNRRTRQDEPALFVALTFERREVLDSSNIKPMNLIGVDR 660 Query 661 GENIPAVIALTDPEGCPLSRFKDSLGNPTHILRIGESYKEKQRTIQAKKEVEQRRAGGYS 720 GENIPAVIALTDPEGCPLSRFKDSLGNPTHILRIGESYKEKQRTIQAKKEVEQRRAGGYS Sbjct 661 GENIPAVIALTDPEGCPLSRFKDSLGNPTHILRIGESYKEKQRTIQAKKEVEQRRAGGYS 720 Query 721 RKYASKAKNLADDMVRNTARDLLYYAVTQDAMLIFENLSRGFGRQGKRTFMAERQYTRME 780 RKYASKAKNLADDMVRNTARDLLYYAVTQDAMLIFENLSRGFGRQGKRTFMAERQYTRME Sbjct 721 RKYASKAKNLADDMVRNTARDLLYYAVTQDAMLIFENLSRGFGRQGKRTFMAERQYTRME 780 Query 781 DWLTAKLAYEGLPSKTYLSKTLAQYTSKTCSNCGFTITSADYDRVLEKLKKTATGWMTTI 840 DWLTAKLAYEGLPSKTYLSKTLAQYTSKTCSNCGFTITSADYDRVLEKLKKTATGWMTTI Sbjct 781 DWLTAKLAYEGLPSKTYLSKTLAQYTSKTCSNCGFTITSADYDRVLEKLKKTATGWMTTI 840 Query 841 NGKELKVEGQITYYNRYKRQNVVKDLSVELDRLSEESVNNDISSWTKGRSGEALSLLKKR 900 NGKELKVEGQITYYNRYKRQNVVKDLSVELDRLSEESVNNDISSWTKGRSGEALSLLKKR Sbjct 841 NGKELKVEGQITYYNRYKRQNVVKDLSVELDRLSEESVNNDISSWTKGRSGEALSLLKKR 900 Query 901 FSHRPVQEKFVCLNCGFETHADEQAALNIARSWLFLRSQEYKKYQTNKTTGNTDKRAFVE 960 FSHRPVQEKFVCLNCGFETHADEQAALNIARSWLFLRSQEYKKYQTNKTTGNTDKRAFVE Sbjct 901 FSHRPVQEKFVCLNCGFETHADEQAALNIARSWLFLRSQEYKKYQTNKTTGNTDKRAFVE 960 Query 961 TWQSFYRKKLKEVWKPAV 978 TWQSFYRKKLKEVWKPAV Sbjct 961 TWQSFYRKKLKEVWKPAV 978 Regarding claim 189: Roberson taught that the CasX comprises a 4-basepair PAM: TTCN (See Roberson, p.1, col.2, para 2). Claims 184-204 are provisionally rejected o
Read full office action

Prosecution Timeline

May 31, 2023
Application Filed
Nov 25, 2025
Non-Final Rejection — §103, §112, §DP (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12590136
ENGINEERED T CELLS
2y 5m to grant Granted Mar 31, 2026
Patent 12570987
SYNTHETICALLY EVOLVED DNA CONSTRUCTS FOR REGULATING SIGNAL PEPTIDE PERFORMANCE AS WELL AS VECTORS, HOST CELLS AND RECOMBINANT PROTEINS THEREOF
2y 5m to grant Granted Mar 10, 2026
Patent 12564607
CELL POPULATION COMPRISING MESENCHYMAL CELLS, PHARMACEUTICAL COMPOSITION COMPRISING THE SAME, AND METHOD FOR PRODUCING THE SAME
2y 5m to grant Granted Mar 03, 2026
Patent 12540335
COMPOSITIONS AND METHODS FOR THE TREATMENT OF METABOLIC LIVER DISORDERS
2y 5m to grant Granted Feb 03, 2026
Patent 12527868
MESODERMAL KILLER (MK) CELL
2y 5m to grant Granted Jan 20, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

AI Strategy Recommendation

Get an AI-powered prosecution strategy using examiner precedents, rejection analysis, and claim mapping.
Powered by AI — typically takes 5-10 seconds

Prosecution Projections

1-2
Expected OA Rounds
70%
Grant Probability
99%
With Interview (+34.7%)
3y 9m
Median Time to Grant
Low
PTA Risk
Based on 27 resolved cases by this examiner. Grant probability derived from career allow rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month