Prosecution Insights
Last updated: August 18, 2026
Application No. 18/278,896

METHOD FOR PRODUCING FERMENTED FOOD OR BEVERAGE, AND ANAEROBIC FERMENTATION METHOD

Non-Final OA §103
Filed
Aug 25, 2023
Priority
Feb 26, 2021 — JP 2021-031032 +2 more
Examiner
LACHICA, ERICSON M
Art Unit
1792
Tech Center
1700 — Chemical & Materials Engineering
Assignee
Amano Enzyme Inc.
OA Round
4 (Non-Final)
30%
Grant Probability
At Risk
4-5
OA Rounds
4m
Est. Remaining
65%
With Interview

Examiner Intelligence

Grants only 30% of cases
30%
Career Allowance Rate
158 granted / 518 resolved
-34.5% vs TC avg
Strong +35% interview lift
Without
With
+34.9%
Interview Lift
resolved cases with interview
Typical timeline
3y 3m
Avg Prosecution
79 currently pending
Career history
596
Total Applications
across all art units

Statute-Specific Performance

§101
0.9%
-39.1% vs TC avg
§103
50.5%
+10.5% vs TC avg
§102
5.5%
-34.5% vs TC avg
§112
37.5%
-2.5% vs TC avg
Black line = Tech Center average estimate • Based on career data from 518 resolved cases

Office Action

§103
DETAILED ACTION Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Continued Examination Under 37 CFR 1.114 A request for continued examination under 37 CFR 1.114, including the fee set forth in 37 CFR 1.17(e), was filed in this application after final rejection. Since this application is eligible for continued examination under 37 CFR 1.114, and the fee set forth in 37 CFR 1.17(e) has been timely paid, the finality of the previous Office action has been withdrawn pursuant to 37 CFR 1.114. Applicant's submission filed on June 3, 2026 has been entered. Claim Rejections - 35 USC § 103 In the event the determination of the status of the application as subject to AIA 35 U.S.C. 102 and 103 (or as subject to pre-AIA 35 U.S.C. 102 and 103) is incorrect, any correction of the statutory basis for the rejection will not be considered a new ground of rejection if the prior art relied upon, and the rationale supporting the rejection, would be the same under either status. The following is a quotation of 35 U.S.C. 103 which forms the basis for all obviousness rejections set forth in this Office action: A patent for a claimed invention may not be obtained, notwithstanding that the claimed invention is not identically disclosed as set forth in section 102 of this title, if the differences between the claimed invention and the prior art are such that the claimed invention as a whole would have been obvious before the effective filing date of the claimed invention to a person having ordinary skill in the art to which the claimed invention pertains. Patentability shall not be negated by the manner in which the invention was made. The factual inquiries set forth in Graham v. John Deere Co., 383 U.S. 1, 148 USPQ 459 (1966), that are applied for establishing a background for determining obviousness under 35 U.S.C. 103 are summarized as follows: 1. Determining the scope and contents of the prior art. 2. Ascertaining the differences between the prior art and the claims at issue. 3. Resolving the level of ordinary skill in the pertinent art. 4. Considering objective evidence present in the application indicating obviousness or nonobviousness Claims 1, 4-6, and 8 are rejected under 35 U.S.C. 103 as being unpatentable over Tams et al. WO 2009/016257 (cited on Information Disclosure Statement filed October 22, 2025) in view of Loetzbeyer et al. US 2018/0020702, Yemoo’s Nourishing Cultures “Open or Closed Lid for Milk Kefir Fermenting” <https://www.yemoos.com/blogs/yemoos-blog/open-or-closed-lid-for-milk-kefir-fermenting?srsltid=AfmBOopscRutRg0qYMhTNYoaVep5ThLZTyIeKDJRmAyRWF50qHMyNgEi> (published November 5, 2019) (herein referred to as “Yemoo’s Nourishing Cultures”) and Nagaya et al. US 2015/0232813 (cited on Information Disclosure Statement filed August 25, 2023). Regarding Claim 1, Tams et al. discloses a method for producing a fermented food or beverage (fermented milk drink) (‘257, Page 2, lines 19-22). The method comprises a saccharide oxidase action step (reducing the dissolved oxygen level of a milk substrate by using an oxygen scavenging enzyme of glucose oxidase or lactose oxidase) for allowing a saccharide oxidase (carbohydrate oxidase, glucose oxidase, or lactose oxidase) to act on a portion or the whole of a saccharide in a raw material (milk substrate) (‘257, Page 11, lines 34-38). The microorganisms used for the fermented milk product is an anaerobic lactic acid bacterium (‘257, Page 7, lines 18-28). Tams et al. further discloses the saccharide oxidase step (reducing the dissolved oxygen level of the milk substrate) being performed before the anaerobic fermentation step and/or simultaneously with the anaerobic fermentation step (‘257, Page 12, lines 2-4). Tams et al. also discloses the saccharide oxidase (oxygen scavenging enzyme) having a property of acting on saccharides of cellobiose or glucose or lactose (‘257, Page 11, lines 34-38). Tams et al. discloses that the dissolved oxygen level of the milk substrate is reduced using an oxygen scavenging enzyme (‘257, Page 11, lines 34-38, which does not necessarily read on the claimed anaerobic conditions of fermentation as some levels of oxygen could be present and since anaerobic conditions require the lack of oxygen. Tams et al. is also silent regarding the saccharide oxidase having a property of acting on one or more saccharides selected from maltotriose, maltose, galactose, maltoteraose, and maltodextrin in addition to acting on glucose. Loetzbeyer et al. discloses a method for the anaerobic fermentation wherein before and/or during the use of anaerobic microorganisms the removal of oxygen is carried out completely enzymatically by means of glucose oxidase and catalase reactions (‘702, Paragraph [0052]) in which the complete removal of oxygen by means of the enzymatic reaction processes of glucose oxidase and catalase reactions enables the production of an anaerobic reaction conditions (‘702, Paragraphs [0047] and [0053]) wherein the fermentation process is applied to foods or beverages (‘702, Paragraphs [0025] and [0065]). Loetzbeyer et al. also discloses a method of reduction of sugar substances (‘702, Paragraph [0001]) including glucose, galactose, or maltose (‘702, Paragraph [0009]) comprising an enzymatic degradation of glucose (‘702, Paragraph [0041]) and removal of oxygen before and/or during the use of anaerobic microorganisms enzymatically by means of the reaction processes of glucose oxidase and catalase reactions (‘702, Paragraph [0052]). Tams et al. already discloses the fermentation process using an anaerobic bacterium of lactic acid (‘257, Page 7, lines 18-22) and also reducing the oxygen levels of the milk substrate using an oxygen scavenging enzyme of a glucose oxidase and an enzyme having a catalase activity (‘257, Page 11, lines 34-38). Both Tams et al. and Loetzbeyer et al. are directed towards the same field of endeavor of methods of fermentation of foods or beverages comprising a step of reducing oxygen enzymatically by means of glucose oxidase and catalase reactions. It would have been obvious to one of ordinary skill in the art at the time of the invention to modify the process of Tams et al. that reduces the oxygen levels of the milk substrate using glucose oxidase and an enzyme having a catalase activity and completely remove the oxygen before and/or during the use of anaerobic microorganisms in an anaerobic fermentation method since Loetzbeyer et al. teaches that it was known and conventional in the food fermentation art to anaerobically ferment foods or beverages. Furthermore, Yemoo’s Nourishing Cultures teaches that fermenting food or beverages such as milk can be done with aerobic fermentation or anaerobic fermentation based on personal preference. Some bacteria strains within milk grains thrive in anaerobic (non-oxygen) environments. Additionally, one of the biggest benefits of anaerobic ferments is that it prevents airborne yeast or mold contamination. It also would have been obvious to one of ordinary skill in the art at the time of the invention to modify the process of Tams et al. that reduces the oxygen levels of the milk substrate using glucose oxidase and an enzyme having a catalase activity and completely remove the oxygen before and/or during the use of anaerobic microorganisms in an anaerobic fermentation method as taught by Loetzbeyer et al. based upon the personal preference of an individual consumer and to prevent airborne yeast or mold contamination as taught by Yemoo’s Nourishing Cultures. Further regarding Claim 1, Loetzbeyer et al. discloses a method for the anaerobic fermentation wherein before and/or during the use of anaerobic microorganisms the removal of oxygen is carried out completely enzymatically by means of glucose oxidase and catalase reactions (‘702, Paragraph [0052]). However, Tams et al. in view of Loetzbeyer et al. and Yemoo’s Nourishing Cultures is silent regarding the saccharide oxidase having a property of acting on one or more saccharides selected from maltotriose, maltose, galactose, maltoteraose, and maltodextrin in addition to acting on glucose. Nagaya et al. discloses a method of making a food product comprising the step of using a protein for oxidizing a saccharide in the food product (‘813, Paragraph [0080]) comprising a saccharide oxidase action step for allowing a saccharide oxidase to act on a portion of a saccharide in a raw material wherein the saccharide oxidase has a property of acting on glucose and maltotriose, maltose, galactose, and maltotetraose saccharides (‘813, Paragraphs [0023]-[0026] and [0105]). Both modified Tams et al. and Nagaya et al. are directed towards the same field of endeavor of methods of making food products using a protein for oxidizing a saccharide in the food product. It would have been obvious to one of ordinary skill in the art at the time of the invention to modify the process of modified Tams et al. and use a saccharide oxidase that acts on saccharides of maltotriose, maltose, galactose, and maltotetraose in addition to glucose as taught by Nagaya et al. since the selection of a known material (the saccharide acting on the claimed saccharides in addition to glucose) based on its suitability for its intended use (to allow for a saccharide oxidase action step for allowing a saccharide oxidase to act on saccharides) supports a prima facie obviousness determination in view of Sinclair & Carroll Co. v. Interchemical Corp., 325 U.S. 327, 65 USPQ 297 (1945) (MPEP § 2144.07). Furthermore, the simple substitution of one known element (using a saccharide oxidase to act on the claimed saccharides in addition to glucose) for another (using a saccharide oxidase acting only on glucose) to obtain predictable results is prima facie obviousness (MPEP § 2143.I.(B).). Further regarding Claim 1, the limitations “wherein the method shortens the fermentation time as, in the saccharide oxidase action step, the time for reaching to a dissolved oxygen level below 10% of that at the start of the fermentation is 0.3 hrs or less vs 2.5 hrs if without the saccharide oxidase action step” are limitations with respect to the properties of the saccharide oxidase action step affecting the fermentation time. Products of identical chemical composition can not have mutually exclusive properties in view of In re Spada, 911 F.2d 705, 709, 15 USPQ2d 1655, 1658 (Fed. Cir. 1990) (MPEP § 2112.01.II.). One of ordinary skill in the art would expect Tams et al. modified with Loetzbeyer et al., Yemoo’s Nourishing Cultures, and Nagaya et al. to behave in the same manner as claimed, i.e. the method shortens the fermentation time as, in the saccharide oxidase action step, the time for reaching to a dissolved oxygen level below 10% of that at the start of the fermentation is 0.3 hrs or less vs 2.5 hrs if without the saccharide oxidase action step, since the prior art combination is made of an identical composition as the claimed composition. Regarding Claim 4, Nagaya et al. discloses a method of fermenting a food or beverage (‘813, Paragraph [0166]) comprising a step of producing lactobionic acid by oxidizing lactose (‘813, Paragraph [0184]) with a protein with carbohydrate activity sharing 100% identity relative to instant SEQ ID NO:1 (see sequence alignment below): US-14-428-105-10 Sequence 10, US/14428105 Publication No. US20150232813A1 GENERAL INFORMATION APPLICANT: Amano Enzyme Inc. APPLICANT: NAGAYA, Miho APPLICANT: SUGITA, Akiko APPLICANT: MATSUMOTO, Naoki APPLICANT: Okada, Masamichi TITLE OF INVENTION: Proteins with carbohydrate oxidase activity, TITLE OF INVENTION: production methods of the proteins and uses the TITLE OF INVENTION: proteins FILE REFERENCE: P1626 CURRENT APPLICATION NUMBER: US/14/428,105 CURRENT FILING DATE: 2015-03-13 NUMBER OF SEQ ID NOS: 10 SEQ ID NO 10 LENGTH: 505 TYPE: PRT ORGANISM: Acremonium chrysogenum Query Match 100.0%; Score 2645; Length 505; Best Local Similarity 100.0%; Matches 505; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MRSLAPLLSIAALARASPVDTSLLTRQETLNTCLEAAELSYVDVNSEDWEDAIVPHNLRV 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MRSLAPLLSIAALARASPVDTSLLTRQETLNTCLEAAELSYVDVNSEDWEDAIVPHNLRV 60 Qy 61 PVVPRAVVYATATEQIQAAVKCAVESEIRVSAKSGGHSYASMGLGGEDGSLVIQLDHWHD 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 PVVPRAVVYATATEQIQAAVKCAVESEIRVSAKSGGHSYASMGLGGEDGSLVIQLDHWHD 120 Qy 121 VTLRDDNTAVVSAGTRLGVVALELYAQGKRGISHGTCPSVGVGGHVVHGGYGFSSHTHGL 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 VTLRDDNTAVVSAGTRLGVVALELYAQGKRGISHGTCPSVGVGGHVVHGGYGFSSHTHGL 180 Qy 181 ALDAVVGANVVLADGSLVHASETENTDLFWALRGGGSSFGIVAEFEFETFDVSHNFSYFS 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 ALDAVVGANVVLADGSLVHASETENTDLFWALRGGGSSFGIVAEFEFETFDVSHNFSYFS 240 Qy 241 IDSDISQETAEEATASLLAFQDALEEGLMDRKLNMRLSLGRPKVTLEAVYHGAKEDGRKA 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 IDSDISQETAEEATASLLAFQDALEEGLMDRKLNMRLSLGRPKVTLEAVYHGAKEDGRKA 300 Qy 301 LELFDDILGLNWSSNRTRANEADWLTMLESWTYGDPLNITYPYEGHDNAYTSSLVTRHIP 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 LELFDDILGLNWSSNRTRANEADWLTMLESWTYGDPLNITYPYEGHDNAYTSSLVTRHIP 360 Qy 361 EDAMASFMTYWKGVGQDRETPNWWLQMDVHGDANSRISEVDADSTAYSHRDKLWLFQFSS 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 EDAMASFMTYWKGVGQDRETPNWWLQMDVHGDANSRISEVDADSTAYSHRDKLWLFQFSS 420 Qy 421 PLNPLRPDPEAAFALVNGYMDSIKDHLGDGEWGRYANYIDSELSREDAQTQYWSDHLDKL 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 PLNPLRPDPEAAFALVNGYMDSIKDHLGDGEWGRYANYIDSELSREDAQTQYWSDHLDKL 480 Qy 481 QAIKAELDPTQVFYNPQSIDPAAVE 505 ||||||||||||||||||||||||| Db 481 QAIKAELDPTQVFYNPQSIDPAAVE 505 Both modified Tams et al. and Nagaya et al. are directed towards the same field of endeavor of methods of producing a fermented food or beverage wherein the method comprises a saccharide oxidase action step for allowing a saccharide oxidase derived from acremonium chrysogenum to act on a portion or the whole of a glucose saccharide in a raw material of a food or beverage. It would have been obvious to one of ordinary skill in the art at the time of the invention to modify the process of modified Tams et al. to have 100% sequence identity as set forth in SEQ ID NO:1 as taught by Nagaya et al. since the selection of a known material (the sequence as set forth in the claimed SEQ ID NO:1) based on its suitability for its intended use (to allow for a saccharide oxidase action step for allowing a saccharide oxidase of acremonium chrysogenum to act on a saccharide in a raw food material) supports a prima facie obviousness determination in view of Sinclair & Carroll Co. v. Interchemical Corp., 325 U.S. 327, 65 USPQ 297 (1945) (MPEP § 2144.07). Furthermore, the simple substitution of one known element (using a saccharide oxidase to act on a saccharide in a raw material of food in fermentation processes) for another (using a saccharide oxidase having a sequence as set forth in the claimed SEQ ID NO:1) to obtain predictable results is prima facie obviousness (MPEP § 2143.I.(B).). Regarding Claim 5, Tams et al. discloses performing a lactic acid fermentation in the anaerobic fermentation step (‘257, Page 7, lines 11-13). Regarding Claim 6, Tams et al. discloses the fermented food or beverage being a fermented milk (‘257, Page 7, lines 15-19). Regarding Claim 8, Tams et al. discloses a method for producing a fermented food or beverage (fermented milk drink) (‘257, Page 2, lines 19-22). The method comprises a saccharide oxidase action step (reducing the dissolved oxygen level of a milk substrate by using an oxygen scavenging enzyme of glucose oxidase or lactose oxidase) for allowing a saccharide oxidase (carbohydrate oxidase, glucose oxidase, or lactose oxidase) to act on a portion or the whole of a saccharide in a raw material (milk substrate) (‘257, Page 11, lines 34-38). The microorganisms used for the fermented milk product is an anaerobic lactic acid bacterium (‘257, Page 7, lines 18-28). Tams et al. further discloses the saccharide oxidase step (reducing the dissolved oxygen level of the milk substrate) being performed before the anaerobic fermentation step and/or simultaneously with the anaerobic fermentation step (‘257, Page 12, lines 2-4). Tams et al. discloses the dissolved oxygen level of the milk substrate is reduced using an oxygen scavenging enzyme (‘257, Page 11, lines 34-38, which does not necessarily read on the claimed anaerobic conditions of fermentation as some levels of oxygen could be present and since anaerobic conditions require the lack of oxygen. Tams et al. is also silent regarding the saccharide oxidase having a property of acting on one or more saccharides selected from maltotriose, maltose, galactose, maltoteraose, and maltodextrin in addition to acting on glucose. Loetzbeyer et al. discloses a method for the anaerobic fermentation wherein before and/or during the use of anaerobic microorganisms the removal of oxygen is carried out completely enzymatically by means of glucose oxidase and catalase reactions (‘702, Paragraph [0052]) in which the complete removal of oxygen by means of the enzymatic reaction processes of glucose oxidase and catalase reactions enables the production of an anaerobic reaction conditions (‘702, Paragraphs [0047] and [0053]) wherein the fermentation process is applied to foods or beverages (‘702, Paragraphs [0025] and [0065]). Loetzbeyer et al. also discloses a method of reduction of sugar substances (‘702, Paragraph [0001]) including glucose, galactose, or maltose (‘702, Paragraph [0009]) comprising an enzymatic degradation of glucose (‘702, Paragraph [0041]) and removal of oxygen before and/or during the use of anaerobic microorganisms enzymatically by means of the reaction processes of glucose oxidase and catalase reactions (‘702, Paragraph [0052]). Tams et al. already discloses the fermentation process using an anaerobic bacterium of lactic acid (‘257, Page 7, lines 18-22) and also reducing the oxygen levels of the milk substrate using an oxygen scavenging enzyme of a glucose oxidase and an enzyme having a catalase activity (‘257, Page 11, lines 34-38). Both Tams et al. and Loetzbeyer et al. are directed towards the same field of endeavor of methods of fermentation of foods or beverages comprising a step of reducing oxygen enzymatically by means of glucose oxidase and catalase reactions. It would have been obvious to one of ordinary skill in the art at the time of the invention to modify the process of Tams et al. that reduces the oxygen levels of the milk substrate using glucose oxidase and an enzyme having a catalase activity and completely remove the oxygen before and/or during the use of anaerobic microorganisms in an anaerobic fermentation method since Loetzbeyer et al. teaches that it was known and conventional in the food fermentation art to anaerobically ferment foods or beverages. Furthermore, Yemoo’s Nourishing Cultures teaches that fermenting food or beverages such as milk can be done with aerobic fermentation or anaerobic fermentation based on personal preference. Some bacteria strains within milk grains thrive in anaerobic (non-oxygen) environments. Additionally, one of the biggest benefits of anaerobic ferments is that it prevents airborne yeast or mold contamination. It would have also been obvious to one of ordinary skill in the art at the time of the invention to modify the process of Tams et al. that reduces the oxygen levels of the milk substrate using glucose oxidase and an enzyme having a catalase activity and completely remove the oxygen before and/or during the use of anaerobic microorganisms in an anaerobic fermentation method as taught by Loetzbeyer et al. based upon the personal preference of an individual consumer and to prevent airborne yeast or mold contamination as taught by Yemoo’s Nourishing Cultures. Further regarding Claim 8, Loetzbeyer et al. discloses a method for the anaerobic fermentation wherein before and/or during the use of anaerobic microorganisms the removal of oxygen is carried out completely enzymatically by means of glucose oxidase and catalase reactions (‘702, Paragraph [0052]). However, Tams et al. in view of Loetzbeyer et al. and Yemoo’s Nourishing Cultures is silent regarding the saccharide oxidase having a property of acting on one or more saccharides selected from maltotriose, maltose, galactose, maltoteraose, and maltodextrin in addition to acting on glucose. Nagaya et al. discloses a method of making a food product comprising the step of using a protein for oxidizing a saccharide in the food product (‘813, Paragraph [0080]) comprising a saccharide oxidase action step for allowing a saccharide oxidase to act on a portion of a saccharide in a raw material wherein the saccharide oxidase has a property of acting on glucose and maltotriose, maltose, galactose, and maltotetraose saccharides (‘813, Paragraphs [0023]-[0026] and [0105]). Both modified Tams et al. and Nagaya et al. are directed towards the same field of endeavor of methods of making food products using a protein for oxidizing a saccharide in the food product. It would have been obvious to one of ordinary skill in the art at the time of the invention to modify the process of modified Tams et al. and use a saccharide oxidase that acts on saccharides of maltotriose, maltose, galactose, and maltotetraose in addition to glucose as taught by Nagaya et al. since the selection of a known material (the saccharide acting on the claimed saccharides in addition to glucose) based on its suitability for its intended use (to allow for a saccharide oxidase action step for allowing a saccharide oxidase to act on saccharides) supports a prima facie obviousness determination in view of Sinclair & Carroll Co. v. Interchemical Corp., 325 U.S. 327, 65 USPQ 297 (1945) (MPEP § 2144.07). Furthermore, the simple substitution of one known element (using a saccharide oxidase to act on the claimed saccharides in addition to glucose) for another (using a saccharide oxidase acting only on glucose) to obtain predictable results is prima facie obviousness (MPEP § 2143.I.(B).). Further regarding Claim 8, the limitations “wherein the method shortens the fermentation time as, in the saccharide oxidase action step, the time for reaching to a dissolved oxygen level below 10% of that at the start of the fermentation is 0.3 hrs or less vs 2.5 hrs if without the saccharide oxidase action step” are limitations with respect to the properties of the saccharide oxidase action step affecting the fermentation time. Products of identical chemical composition can not have mutually exclusive properties in view of In re Spada, 911 F.2d 705, 709, 15 USPQ2d 1655, 1658 (Fed. Cir. 1990) (MPEP § 2112.01.II.). One of ordinary skill in the art would expect Tams et al. modified with Loetzbeyer et al., Yemoo’s Nourishing Cultures, and Nagaya et al. to behave in the same manner as claimed, i.e. the method shortens the fermentation time as, in the saccharide oxidase action step, the time for reaching to a dissolved oxygen level below 10% of that at the start of the fermentation is 0.3 hrs or less vs 2.5 hrs if without the saccharide oxidase action step, since the prior art combination is made of an identical composition as the claimed composition. Claims 1, 4-6, and 8 are rejected under 35 U.S.C. 103 as being unpatentable over Weusthuis et al. US 2018/0016604 in view of Tams et al. WO 2009/016257 (cited on Information Disclosure Statement filed October 22, 2025) and Nagaya et al. US 2015/0232813 (cited on Information Disclosure Statement filed August 25, 2023). Regarding Claim 1, Weusthuis et al. discloses a method for producing a fermented food or beverage (‘604, Paragraph [0013]). The method comprises the step of producing itaconic acid by fermentation (‘604, Paragraph [0001]) by growing E. coli in bioreactors under anaerobic conditions with glucose as a carbon source (‘604, Paragraph [0118]). Weusthuis et al. discloses the conversion of glucose to itaconate is an oxidation reaction (‘604, Paragraph [0006]). Therefore, the disclosure of a particular example wherein E. coli is grown in bioreactors under anaerobic conditions with glucose as the carbon source (‘604, Paragraph [0118]) reads on the claimed saccharide oxidase action step for allowing a saccharide oxidase to act on a portion or the whole of a saccharide in a raw material. Weusthuis et al. also discloses an anerobic fermentation step for performing anaerobic fermentation (‘604, Paragraphs [0010] and [0065]). Weusthuis et al. is silent regarding the saccharide oxidase step being performed before the anaerobic fermentation step and/or simultaneously with the anaerobic fermentation step. Tams et al. discloses a method for producing a fermented food or beverage (fermented milk drink) (‘257, Page 2, lines 19-22). The method comprises a saccharide oxidase action step (reducing the dissolved oxygen level of a milk substrate by using an oxygen scavenging enzyme of glucose oxidase or lactose oxidase) for allowing a saccharide oxidase (carbohydrate oxidase, glucose oxidase, or lactose oxidase) to act on a portion or the whole of a saccharide in a raw material (milk substrate) (‘257, Page 11, lines 34-38) and a fermentation step for performing fermentation (‘257, Page 12, lines 2-5). Tams et al. further discloses the saccharide oxidase step (reducing the dissolved oxygen level of the milk substrate) being performed before the fermentation step and/or simultaneously with the fermentation step (‘257, Page 12, lines 2-4). Both Weusthuis et al. and Tams et al. are directed towards the same field of endeavor of methods of producing fermented foods or beverages by a saccharide oxidase action step for allowing a saccharide oxidase to act on a saccharide in a raw material. It would have been obvious to one of ordinary skill in the art at the time of the invention to modify the fermentation process of Weusthuis et al. and perform the saccharide oxidase action step before the fermentation step or simultaneously with the anaerobic fermentation step as taught by Tams et al. since the selection of any order of performing process steps is prima facie obvious in the absence of new or unexpected results in view of In re Burhans, 154 F.2d 690, 69 USPQ 330 (CCPA 1946) (MPEP § 2144.04.IV.C.). Tams et al. teaches that there was known utility in the fermentation art to perform the saccharide oxidase action step before the fermentation step or to perform the saccharide oxidase action step simultaneously with the fermentation step. Further regarding Claim 1, Weusthuis et al. discloses the saccharide oxidase having a property of acting on saccharides of glucose (‘604, Paragraphs [0114] and [0118]). However, Weusthuis et al. in view of Tams et al. is silent regarding the saccharide oxidase having a property of acting on one or more saccharides selected from maltotriose, maltose, galactose, maltoteraose, and maltodextrin in addition to acting on glucose. Nagaya et al. discloses a method of making a food product comprising the step of using a protein for oxidizing a saccharide in the food product (‘813, Paragraph [0080]) comprising a saccharide oxidase action step for allowing a saccharide oxidase to act on a portion of a saccharide in a raw material wherein the saccharide oxidase has a property of acting on glucose and maltotriose, maltose, galactose, and maltotetraose saccharides (‘813, Paragraphs [0023]-[0026] and [0105]). Both modified Weusthuis et al. and Nagaya et al. are directed towards the same field of endeavor of methods of making food products using a protein for oxidizing a saccharide in the food product. It would have been obvious to one of ordinary skill in the art at the time of the invention to modify the process of modified Weusthuis et al. and use a saccharide oxidase that acts on saccharides of maltotriose, maltose, galactose, and maltotetraose in addition to glucose as taught by Nagaya et al. since the selection of a known material (the saccharide acting on the claimed saccharides in addition to glucose) based on its suitability for its intended use (to allow for a saccharide oxidase action step for allowing a saccharide oxidase to act on saccharides) supports a prima facie obviousness determination in view of Sinclair & Carroll Co. v. Interchemical Corp., 325 U.S. 327, 65 USPQ 297 (1945) (MPEP § 2144.07). Furthermore, the simple substitution of one known element (using a saccharide oxidase to act on the claimed saccharides in addition to glucose) for another (using a saccharide oxidase acting only on glucose) to obtain predictable results is prima facie obviousness (MPEP § 2143.I.(B).). Further regarding Claim 1, the limitations “wherein the method shortens the fermentation time as, in the saccharide oxidase action step, the time for reaching to a dissolved oxygen level below 10% of that at the start of the fermentation is 0.3 hrs or less vs 2.5 hrs if without the saccharide oxidase action step” are limitations with respect to the properties of the saccharide oxidase action step affecting the fermentation time. Products of identical chemical composition can not have mutually exclusive properties in view of In re Spada, 911 F.2d 705, 709, 15 USPQ2d 1655, 1658 (Fed. Cir. 1990) (MPEP § 2112.01.II.). One of ordinary skill in the art would expect Westhuis et al. modified with Tams et al. and Nagaya et al. to behave in the same manner as claimed, i.e. the method shortens the fermentation time as, in the saccharide oxidase action step, the time for reaching to a dissolved oxygen level below 10% of that at the start of the fermentation is 0.3 hrs or less vs 2.5 hrs if without the saccharide oxidase action step, since the prior art combination is made of an identical composition as the claimed composition. Regarding Claim 4, Weusthuis et al. modified with Tams et al. is silent regarding the saccharide oxidase consisting of a polypeptide having a sequence identity of 90% or more to the amino acid sequence represented by SEQ ID NO:1 in the amino acid sequence represented by SEQ ID NO:1 and which exhibits a substrate specificity equivalent to that of the polypeptide consisting of the amino acid sequence represented by SEQ ID NO:1. Nagaya et al. discloses a protein with carbohydrate activity sharing 100% identity relative to instant SEQ ID NO:1 (see sequence alignment below): US-14-428-105-10 Sequence 10, US/14428105 Publication No. US20150232813A1 GENERAL INFORMATION APPLICANT: Amano Enzyme Inc. APPLICANT: NAGAYA, Miho APPLICANT: SUGITA, Akiko APPLICANT: MATSUMOTO, Naoki APPLICANT: Okada, Masamichi TITLE OF INVENTION: Proteins with carbohydrate oxidase activity, TITLE OF INVENTION: production methods of the proteins and uses the TITLE OF INVENTION: proteins FILE REFERENCE: P1626 CURRENT APPLICATION NUMBER: US/14/428,105 CURRENT FILING DATE: 2015-03-13 NUMBER OF SEQ ID NOS: 10 SEQ ID NO 10 LENGTH: 505 TYPE: PRT ORGANISM: Acremonium chrysogenum Query Match 100.0%; Score 2645; Length 505; Best Local Similarity 100.0%; Matches 505; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MRSLAPLLSIAALARASPVDTSLLTRQETLNTCLEAAELSYVDVNSEDWEDAIVPHNLRV 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MRSLAPLLSIAALARASPVDTSLLTRQETLNTCLEAAELSYVDVNSEDWEDAIVPHNLRV 60 Qy 61 PVVPRAVVYATATEQIQAAVKCAVESEIRVSAKSGGHSYASMGLGGEDGSLVIQLDHWHD 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 PVVPRAVVYATATEQIQAAVKCAVESEIRVSAKSGGHSYASMGLGGEDGSLVIQLDHWHD 120 Qy 121 VTLRDDNTAVVSAGTRLGVVALELYAQGKRGISHGTCPSVGVGGHVVHGGYGFSSHTHGL 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 VTLRDDNTAVVSAGTRLGVVALELYAQGKRGISHGTCPSVGVGGHVVHGGYGFSSHTHGL 180 Qy 181 ALDAVVGANVVLADGSLVHASETENTDLFWALRGGGSSFGIVAEFEFETFDVSHNFSYFS 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 ALDAVVGANVVLADGSLVHASETENTDLFWALRGGGSSFGIVAEFEFETFDVSHNFSYFS 240 Qy 241 IDSDISQETAEEATASLLAFQDALEEGLMDRKLNMRLSLGRPKVTLEAVYHGAKEDGRKA 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 IDSDISQETAEEATASLLAFQDALEEGLMDRKLNMRLSLGRPKVTLEAVYHGAKEDGRKA 300 Qy 301 LELFDDILGLNWSSNRTRANEADWLTMLESWTYGDPLNITYPYEGHDNAYTSSLVTRHIP 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 LELFDDILGLNWSSNRTRANEADWLTMLESWTYGDPLNITYPYEGHDNAYTSSLVTRHIP 360 Qy 361 EDAMASFMTYWKGVGQDRETPNWWLQMDVHGDANSRISEVDADSTAYSHRDKLWLFQFSS 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 EDAMASFMTYWKGVGQDRETPNWWLQMDVHGDANSRISEVDADSTAYSHRDKLWLFQFSS 420 Qy 421 PLNPLRPDPEAAFALVNGYMDSIKDHLGDGEWGRYANYIDSELSREDAQTQYWSDHLDKL 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 PLNPLRPDPEAAFALVNGYMDSIKDHLGDGEWGRYANYIDSELSREDAQTQYWSDHLDKL 480 Qy 481 QAIKAELDPTQVFYNPQSIDPAAVE 505 ||||||||||||||||||||||||| Db 481 QAIKAELDPTQVFYNPQSIDPAAVE 505 Both modified Weusthuis et al. and Nagaya et al. are directed towards the same field of endeavor of methods of producing a fermented food or beverage wherein the method comprises a saccharide oxidase action step for allowing a saccharide oxidase derived from acremonium chrysogenum to act on a portion or the whole of a glucose saccharide in a raw material of a food or beverage. It would have been obvious to one of ordinary skill in the art at the time of the invention to modify the process of modified Weusthuis et al. to have 100% sequence identity as set forth in SEQ ID NO:1 as taught by Nagaya et al. since the selection of a known material (the sequence as set forth in the claimed SEQ ID NO:1) based on its suitability for its intended use (to allow for a saccharide oxidase action step for allowing a saccharide oxidase of acremonium chrysogenum to act on a saccharide in a raw food material) supports a prima facie obviousness determination in view of Sinclair & Carroll Co. v. Interchemical Corp., 325 U.S. 327, 65 USPQ 297 (1945) (MPEP § 2144.07). Furthermore, the simple substitution of one known element (using a saccharide oxidase to act on a saccharide in a raw material of food in fermentation processes) for another (using a saccharide oxidase having a sequence as set forth in the claimed SEQ ID NO:1) to obtain predictable results is prima facie obviousness (MPEP § 2143.I.(B).). Regarding Claim 5, Weusthuis et al. discloses the method comprising a step of anaerobic fermentation having main fermentation produces of lactate and pyruvate (‘604, Paragraphs [0118]-[0119]). Tams et al. discloses the method comprising conversion of lactose to lactic acid (‘257, Page 7, lines 11-13). Therefore, the combination of Weusthuis et al. modified with Tams et al. teaches a lactic acid fermentation being performed. Regarding Claim 6, Weusthuis et al. discloses the fermentation method being applied to make a fermented food (‘604, Paragraphs [0013] and [0070]). Tams et al. discloses the method being used to make a fermented milk drink (‘257, Page 2, lines 19-22). It would have been obvious to one of ordinary skill in the art to apply the method of making a fermented food of Weusthuis et al. to make a fermented milk as taught by Tams et al. based upon the particular type of food or beverage desired to be made using the disclosed fermentation processes. Regarding Claim 8, Weusthuis et al. discloses an anaerobic fermentation method (‘604, Paragraphs [0010] and [0063]). The method comprises the step of producing itaconic acid by fermentation (‘604, Paragraph [0001]) by growing E. coli in bioreactors under anaerobic conditions with glucose as a carbon source (‘604, Paragraph [0118]). Weusthuis et al. discloses the conversion of glucose to itaconate is an oxidation reaction (‘604, Paragraph [0006]). Therefore, the disclosure of a particular example wherein E. coli is grown in bioreactors under anaerobic conditions with glucose as the carbon source (‘604, Paragraph [0118]) reads on the claimed saccharide oxidase action step for allowing a saccharide oxidase to act on a portion or the whole of a saccharide in a raw material. Weusthuis et al. is silent regarding the saccharide oxidase step being performed before an anaerobic fermentation step and/or simultaneously with the anaerobic fermentation step. Tams et al. discloses a fermentation method (fermented milk drink) (‘257, Page 2, lines 19-22). The method comprises a saccharide oxidase action step (reducing the dissolved oxygen level of a milk substrate by using an oxygen scavenging enzyme of glucose oxidase or lactose oxidase) for allowing a saccharide oxidase (carbohydrate oxidase, glucose oxidase, or lactose oxidase) to act on a portion or the whole of a saccharide in a raw material (milk substrate) (‘257, Page 11, lines 34-38) and a fermentation step for performing fermentation (‘257, Page 12, lines 2-4). Tams et al. further discloses the saccharide oxidase step (reducing the dissolved oxygen level of the milk substrate) being performed before the fermentation step and/or simultaneously with the fermentation step (‘257, Page 12, lines 2-4). Both Weusthuis et al. and Tams et al. are directed towards the same field of endeavor of methods of producing fermented foods or beverages by a saccharide oxidase action step for allowing a saccharide oxidase to act on a saccharide in a raw material. It would have been obvious to one of ordinary skill in the art at the time of the invention to modify the fermentation process of Weusthuis et al. and perform the saccharide oxidase action step before the fermentation step or simultaneously with the fermentation step as taught by Tams et al. since the selection of any order of performing process steps is prima facie obvious in the absence of new or unexpected results in view of In re Burhans, 154 F.2d 690, 69 USPQ 330 (CCPA 1946) (MPEP § 2144.04.IV.C.). Tams et al. teaches that there was known utility in the fermentation art to perform the saccharide oxidase action step before the fermentation step or to perform the saccharide oxidase action step simultaneously with the fermentation step. Further regarding Claim 8, Weusthuis et al. discloses the saccharide oxidase having a property of acting on saccharides of glucose (‘604, Paragraphs [0114] and [0118]). However, Weusthuis et al. in view of Tams et al. is silent regarding the saccharide oxidase having a property of acting on one or more saccharides selected from maltotriose, maltose, galactose, maltoteraose, and maltodextrin in addition to acting on glucose. Nagaya et al. discloses a method of making a food product comprising the step of using a protein for oxidizing a saccharide in the food product (‘813, Paragraph [0080]) comprising a saccharide oxidase action step for allowing a saccharide oxidase to act on a portion of a saccharide in a raw material wherein the saccharide oxidase has a property of acting on glucose and maltotriose, maltose, galactose, and maltotetraose saccharides (‘813, Paragraphs [0023]-[0026] and [0105]). Both modified Weusthuis et al. and Nagaya et al. are directed towards the same field of endeavor of methods of making food products using a protein for oxidizing a saccharide in the food product. It would have been obvious to one of ordinary skill in the art at the time of the invention to modify the process of modified Weusthuis et al. and use a saccharide oxidase that acts on saccharides of maltotriose, maltose, galactose, and maltotetraose in addition to glucose as taught by Nagaya et al. since the selection of a known material (the saccharide acting on the claimed saccharides in addition to glucose) based on its suitability for its intended use (to allow for a saccharide oxidase action step for allowing a saccharide oxidase to act on saccharides) supports a prima facie obviousness determination in view of Sinclair & Carroll Co. v. Interchemical Corp., 325 U.S. 327, 65 USPQ 297 (1945) (MPEP § 2144.07). Furthermore, the simple substitution of one known element (using a saccharide oxidase to act on the claimed saccharides in addition to glucose) for another (using a saccharide oxidase acting only on glucose) to obtain predictable results is prima facie obviousness (MPEP § 2143.I.(B).). Further regarding Claim 1, the limitations “wherein the method shortens the fermentation time as, in the saccharide oxidase action step, the time for reaching to a dissolved oxygen level below 10% of that at the start of the fermentation is 0.3 hrs or less vs 2.5 hrs if without the saccharide oxidase action step” are limitations with respect to the properties of the saccharide oxidase action step affecting the fermentation time. Products of identical chemical composition can not have mutually exclusive properties in view of In re Spada, 911 F.2d 705, 709, 15 USPQ2d 1655, 1658 (Fed. Cir. 1990) (MPEP § 2112.01.II.). One of ordinary skill in the art would expect Westhuis et al. modified with Tams et al. and Nagaya et al. to behave in the same manner as claimed, i.e. the method shortens the fermentation time as, in the saccharide oxidase action step, the time for reaching to a dissolved oxygen level below 10% of that at the start of the fermentation is 0.3 hrs or less vs 2.5 hrs if without the saccharide oxidase action step, since the prior art combination is made of an identical composition as the claimed composition. Response to Arguments Applicant's arguments filed June 3, 2026 have been fully considered but they are not persuasive. Applicant argues on Page 6 of the Remarks with respect to Claims 1 and 8 that the obviousness rejections based on the cited references does not address the newly presented limitations “wherein the method shortens the fermentation time as, in the saccharide oxidase action step, the time for reaching to a dissolved oxygen level below 10% of that at the start of the fermentation is 0.3 hrs or less vs 2.5 hrs if without the saccharide oxidase action step.” Examiner argues the limitations “wherein the method shortens the fermentation time as, in the saccharide oxidase action step, the time for reaching to a dissolved oxygen level below 10% of that at the start of the fermentation is 0.3 hrs or less vs 2.5 hrs if without the saccharide oxidase action step” are limitations with respect to the properties of the saccharide oxidase action step affecting the fermentation time. Products of identical chemical composition can not have mutually exclusive properties in view of In re Spada, 911 F.2d 705, 709, 15 USPQ2d 1655, 1658 (Fed. Cir. 1990) (MPEP § 2112.01.II.). One of ordinary skill in the art would expect Tams et al. modified with Loetzbeyer et al., Yemoo’s Nourishing Cultures, and Nagaya et al. or alternatively Westhuis et al. modified with Tams et al. and Nagaya et al. to behave in the same manner as claimed, i.e. the method shortens the fermentation time as, in the saccharide oxidase action step, the time for reaching to a dissolved oxygen level below 10% of that at the start of the fermentation is 0.3 hrs or less vs 2.5 hrs if without the saccharide oxidase action step, since the prior art combination is made of an identical composition as the claimed composition. Applicant argues on Pages 6-8 of the Remarks that Example 1 of the specification allegedly uncovers the advantages of the recited saccharide oxidase action step. Example 1 uses a prepared milk raw material mix using a mixture of cow milk, skimmed milk, and water, sterilizing the prepared milk raw material, cooling the sterilized milk raw material mix, combining with an enzyme containing saccharide oxidase in an amount of 5 to 120 U based on the milk raw material mix, combining with 2 v/v% of a lactic acid bacterium starter containing Lactobacillus delbrueckii subsp. Bulgaricus and Streptococcus thermophilus, and then fermenting for several hours at 37°C in a water bath. The pH and dissolved oxygen during the fermentation were monitored using a pH sensor and a DO sensor, respectively. Applicant concludes that Table 1 shows that the saccharide oxidase action step, the time for reaching to a dissolved oxygen level below 10% of that at the initiation of the fermentation is about one tenth (0.3 hrs or less vs. 2.5 hrs) of that when no saccharide oxidase action step was included and that the claimed method greatly shortened the fermentation process. Examiner argues Table 1 shows the variable of the amount of saccharide oxidase added being adjusted to different concentrations. Claims 1 and 8 do not specify any particular saccharide oxidase concentration. Additionally, applicant asserts that the method comprises a step of combining a lactic acid bacterium starter containing Lactobacillus delbrueckii subsp. Bulgaricus and Streptococcus thermophilus. However, Claims 1 and 8 also do not recite a lactic acid bacterium starter. Applicant’s data in Experiment Example 1 of the specification and Table 1 is not commensurate in scope with the claimed invention. Evidence of unexpected properties may be in the form of a direct or indirect comparison of the claimed invention with the closest prior art which is commensurate in scope with the claims in view of In re Boesch, 617 F.2d 272, 205 USPQ 215 (CCPA 1980) (MPEP § 716.02(b).III.). Applicant has not provided data that is commensurate in scope with the claimed invention, i.e. Claims 1 and 8 do not recite at least a particular concentration of saccharide oxidase and/or a lactic acid bacterium starter, which are both present in Example 1 of applicant’s specification. Therefore, applicant’s allegations of unexpected results are not commensurate in scope with the claimed invention to rebut the obviousness rejections. Additionally, Tams discloses using a lactic acid bacterium starter including Lactobacillus delbrueckii subsp. Bulgaricus or Streptococcus thermophilus (‘257, Page 8, lines 21-23). Tams also discloses the enzyme being added in a suitable amount such as between 0.001 and 0,1 g/L milk substrate (‘257, Page 10, lines 19-21). Conclusion Any inquiry concerning this communication or earlier communications from the examiner should be directed to ERICSON M LACHICA whose telephone number is (571)270-0278. The examiner can normally be reached M-F, 8:30am-5pm, EST. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Erik Kashnikow can be reached at 571-270-3475. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /ERICSON M LACHICA/Examiner, Art Unit 1792
Read full office action

Prosecution Timeline

Show 1 earlier event
Sep 02, 2025
Non-Final Rejection mailed — §103
Nov 14, 2025
Response Filed
Dec 11, 2025
Non-Final Rejection mailed — §103
Mar 02, 2026
Response Filed
Mar 11, 2026
Final Rejection mailed — §103
Jun 03, 2026
Request for Continued Examination
Jun 04, 2026
Response after Non-Final Action
Jul 07, 2026
Non-Final Rejection mailed — §103 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12672733
CAPSULE, SYSTEM AND USE OF THE SYSTEM FOR PREPARING DOUBLE BEVERAGES LIKE A DOUBLE ESPRESSO, A DOUBLE LUNGO AND A DOUBLE RISTRETTO
7y 5m to grant Granted Jul 07, 2026
Patent 12648667
Method for producing coffee, and a device for carrying out said method
4y 2m to grant Granted Jun 09, 2026
Patent 12568984
INSTANT BEVERAGE FOAMING COMPOSITION
3y 2m to grant Granted Mar 10, 2026
Patent 12520860
INFUSION KIT AND TOOLS AND METHOD FOR USING SAME
3y 10m to grant Granted Jan 13, 2026
Patent 12515874
CAPSULE FOR PREPARING BEVERAGES
2y 12m to grant Granted Jan 06, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

Strategy Recommendation AI-generated — please review before filing

Get a prosecution strategy drawn from examiner precedents, rejection analysis, and claim mapping.
Typically takes 5-10 seconds — AI-generated, attorney review required before filing

Prosecution Projections

4-5
Expected OA Rounds
30%
Grant Probability
65%
With Interview (+34.9%)
3y 3m (~4m remaining)
Median Time to Grant
High
PTA Risk
Based on 518 resolved cases by this examiner. Grant probability derived from career allowance rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month