Prosecution Insights
Last updated: July 17, 2026
Application No. 18/293,040

ENGINEERING AAV VECTORS WITH IMPROVED CNS TARGETING

Non-Final OA §103
Filed
Jan 29, 2024
Priority
Jul 30, 2021 — provisional 63/227,959 +1 more
Examiner
BARRON, SEAN C
Art Unit
1653
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
University of Florida Research Foundation Inc.
OA Round
1 (Non-Final)
53%
Grant Probability
Moderate
1-2
OA Rounds
1y 1m
Est. Remaining
84%
With Interview

Examiner Intelligence

Grants 53% of resolved cases
53%
Career Allowance Rate
326 granted / 612 resolved
-6.7% vs TC avg
Strong +31% interview lift
Without
With
+30.6%
Interview Lift
resolved cases with interview
Typical timeline
3y 7m
Avg Prosecution
99 currently pending
Career history
694
Total Applications
across all art units

Statute-Specific Performance

§101
1.5%
-38.5% vs TC avg
§103
68.4%
+28.4% vs TC avg
§102
10.3%
-29.7% vs TC avg
§112
5.5%
-34.5% vs TC avg
Black line = Tech Center average estimate • Based on career data from 612 resolved cases

Office Action

§103
DETAILED ACTION The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Election/Restrictions Applicant’s election of Group I, presently claims 1, 2, 4, 6, and 8-12, in the reply filed on 5/15/2026 is acknowledged. Because applicant did not distinctly and specifically point out the supposed errors in the restriction requirement, the election has been treated as an election without traverse (MPEP § 818.01(a)). Claims 5, 13, 14, 16, 18, 19, and 21-25 are withdrawn from further consideration pursuant to 37 CFR 1.142(b) as being drawn to nonelected inventions, there being no allowable generic or linking claim. Election was made without traverse in the reply filed on 5/15/2026. Claims 1, 2, 4, 6, and 8-12 are under consideration on the merits. Claim Objections Claims 5, 13, 14, 16, 18, 19, are 21-25 are withdrawn but were not amended in reply to indicate as such. See 37 C.F.R. § 1.121(c). Appropriate correction is required with the next reply. Claim Rejections - 35 USC § 103 The following is a quotation of 35 U.S.C. 103 which forms the basis for all obviousness rejections set forth in this Office action: A patent for a claimed invention may not be obtained, notwithstanding that the claimed invention is not identically disclosed as set forth in section 102, if the differences between the claimed invention and the prior art are such that the claimed invention as a whole would have been obvious before the effective filing date of the claimed invention to a person having ordinary skill in the art to which the claimed invention pertains. Patentability shall not be negated by the manner in which the invention was made. The factual inquiries for establishing a background for determining obviousness under 35 U.S.C. 103 are summarized as follows: 1. Determining the scope and contents of the prior art. 2. Ascertaining the differences between the prior art and the claims at issue. 3. Resolving the level of ordinary skill in the pertinent art. 4. Considering objective evidence present in the application indicating obviousness or nonobviousness. This application currently names joint inventors. In considering patentability of the claims the examiner presumes that the subject matter of the various claims was commonly owned as of the effective filing date of the claimed invention(s) absent any evidence to the contrary. Applicant is advised of the obligation under 37 CFR 1.56 to point out the inventor and effective filing dates of each claim that was not commonly owned as of the effective filing date of the later invention in order for the examiner to consider the applicability of 35 U.S.C. 102(b)(2)(C) for any potential 35 U.S.C. 102(a)(2) prior art against the later invention. Claims 1, 4, 6, and 8-12 are rejected under 35 U.S.C. 103 as being unpatentable over Schaffer et al. (US 2020/009559; provided in the IDS 9/06/2024) in view of Berezin et al. (US 2007/0116702; provided in the IDS 9/06/2024). Schaffer teaches recombinant AAV virions with variant AAV capsid protein and having increased ability to infect neural stem cells or neuronal cells (Abstract) and recombinant virion therein (claim 1). Schaffer teaches AAV capsid protein comprising an insertion of 5-20 amino acids in loop IV within amino acids (e.g. residues) 411-650 or amino acids 587-588 ([0141]-[0142]), reading in-part on claim 1 and reading on claim 4. Schaffer teaches AAV capsid protein selected from AAV1, AAV9 or AAVrh10 (Fig. 4 and [0285]), reading on claim 12. Schaffer teaches that AAV utilizes heparin sulfate proteoglycans for cell transduction ([0927]), reading in-part on claims 1, 6, and 8-11. Regarding claim 1, Schaffer does not teach the embodiment of SEQ ID NO: 15 (i.e. GRILARGEINFK) or SEQ ID NO: 16 (i.e. ASKKPKRNIKA). Regarding claims 6 and 8-11, Schaffer does not teach the functional properties of the modified AAV capsid protein of claim 1. Berezin teaches peptides comprising at least 5 contiguous amino acid residues of NCAM (Abstract). Berezin teaches a peptide comprising the NCAM Ig2 domain and consisting of the sequence ASKKPKRNIKA ([0075]-[0076], SEQ ID NO: 1) or GRILARGEINFK ([0084]-[0086])), reading on SEQ IDs NO: 16 and 15 respectively. Berezin teaches that ligands of NCAM comprise in-part heparin sulfate proteoglycans ([0004] and [0029]), reading in-part on claims 1, 6, and 8-11. Berezin teaches that NCAM is a cell adhesion molecule abundant in the nervous system, and binds to NCAM, proteins, and glycoconjugates expressed on nerve cells ([0002]), reading in-part on claims 1, 6, and 8-11. Regarding claim 1, it would have been obvious to a person of ordinary skill in the art before the invention was filed to substitute the peptides comprising the NCAM Ig2 domain of Berezin for loop IV in Schaffer’s AAV capsid protein. A person of ordinary skill in the art would have had a reasonable expectation of success to do so because Schaffer teaches insertion of peptides at loop IV of AAV capsid protein, and because Berezin teaches peptides comprising the NCAM Ig2 domain. The skilled artisan would have been motivated to do so because both Schaffer and Berezin are related as Schaffer teaches variant AAV capsid proteins with increased infectivity of neural cells, Schaffer teaches that AAV utilizes heparin sulfate proteoglycans for cell transduction and Berezin teaches that NCAM in-part binds to heparin sulfate proteoglycans on nerve cells. The prior art as a whole suggests that the substitution would be predictably advantageous to improve the binding of Schaffer’s recombinant AAV virion comprising the variant AAV capsid protein to NCAM ligands such as to improve viral transduction of neural cells. Regarding the functional properties of claims 6 and 9-11, where the claimed and prior art products are identical or substantially identical in structure or composition, or are produced by identical or substantially identical processes, a prima facie case of either anticipation or obviousness has been established. In re Best, 562 F.2d 1252, 1255, 195 USPQ 430, 433 (CCPA 1977). Also see M.P.E.P. § 2112.01. In this case, the combination of peptides comprising the NCAM Ig2 domain of Berezin inserted into loop IV of the AAV capsid protein of a Schaffer would inherently generate increased binding to glycans for claim 6, polysialic acid attached to NCAM for claim 8, a neuronal cell for claims 9 and 10, and a brain neuronal cell for claim 11 because Berezin teaches that NCAM is a cell adhesion molecule abundant in the nervous system, and binds to NCAM, proteins, and glycoconjugates expressed on nerve cells. Therefore and absent any showing to the contrary, the functional properties of claims 6 and 8-11 are reasonably presumed to be inherent to the substantially identical AAV capsid protein yielded by the combination of Schaffer and Berezin. Therefore, the invention as a whole would have been prima facie obvious to a person of ordinary skill before the invention was filed. Claim 2 is rejected under 35 U.S.C. 103 as being unpatentable over Schaffer and Berezin as applied to claim 1 above, and further in view of Schaffer et al. (WO 2012/0145601; Reference N, and hereafter referred to as “the Schaffer WIPO publication”). The teachings of Schaffer and Berezin are relied upon as set forth above. Schafer further teaches variant AAV capsid comprising a peptide insert or a peptide replacement ([0102]), reading in-part on claim 2. Schaffer further teaches AAV1 capsid protein as set forth in GenBank Accession No. NP_049542 ([0142]), wherein SEQ ID NO: 1 is 100% identical to NP_049542a and so reading in-part on claim 2. Regarding claim 2, Schaffer and Berezin do not teach insertion of the embodiment of SEQ ID NO: 15 or 16 between positions 450 and 459 or replacement the amino acids at positions 451-458 in the AAV1 capsid protein of SEQ ID NO: 1. The Schaffer WIPO publication teaches AAV virions with altered capsid proteins and having greater infectivity of retinal cells (Abstract). The Schaffer WIPO publication teaches inserting peptides at 450-460 in AAV1 capsid protein and which corresponds to loop IV (i.e. variable region IV or VRIV) (Fig. 17, [0078], and [00100]), reading on claim 2. It would have been obvious to a person of ordinary skill in the art before the invention was filed to substitute the peptides comprising the NCAM Ig2 domain of Berezin for either inserted between residues Q450-K459 or replacing residues 451-458 in loop IV of AAV1 in Schaffer’s AAV capsid protein in view of the Schaffer WIPO publication. A person of ordinary skill in the art would have had a reasonable expectation of success to do so because Schaffer teaches insertion of peptides and replacement of residues in loop IV of AAV1 capsid protein, because Berezin teaches peptides comprising the NCAM Ig2 domain, and because Schaffer and the Schaffer WIPO publication are both directed towards variant AAV1 capsid protein with improved infectivity of neural cells. The skilled artisan would have been motivated to do so because the Schaffer WIPO teaches that loop IV of the AAV capsid protein is confined to a smaller region of residues, and so it would be predictably advantageous to then confine the insertion of replacement of residues within loop IV of AAV in the AAV1 capsid protein of Schaffer over the broader range of residues 411-650 in view of the Schaffer WIPO publication. Therefore, the invention as a whole would have been prima facie obvious to a person of ordinary skill before the invention was filed. Conclusion No claims are allowed. No claims are free of the art. The prior art made of record and not relied upon is considered pertinent to applicant's disclosure. Billman et al. (US 2005/0222041; Reference A) for SEQ ID NO: 17, and Bock et al. (US 2008/0249004; Reference B) for SEQ ID NO: 18-20. See [0198] of Billman, with SEQ ID NO: 1 = instant SEQ ID NO: 17. And, see [0123]-[0125] of Bock, with SEQ ID NO: 19 = instant SEQ ID NO: 18, SEQ ID NO: 20 = instant SEQ ID NO: 19, and SEQ ID NO: 13 = instant SEQ ID NO: 20. Any inquiry concerning this communication or earlier communications from the examiner should be directed to SEAN C BARRON whose telephone number is (571)270-5111. The examiner can normally be reached 7:30am-3:30pm EDT/EST (M-F). Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Sharmila Landau can be reached at 571-272-0614. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /Sean C. Barron/Primary Examiner, Art Unit 1653 SEQ ID NO: 1 capsid protein [Adeno-associated virus - 1] Sequence ID: NP_049542.1Length: 736Number of Matches: 1 Related Information Gene-associated gene details Range 1: 1 to 736GenPeptGraphicsNext MatchPrevious Match Alignment statistics for match #1 Score Expect Method Identities Positives Gaps 1531 bits(3963) 0.0 Compositional matrix adjust. 736/736(100%) 736/736(100%) 0/736(0%) Query 1 MAADGYLPDWLEDNLSEGIREWWDLKPGAPKPKANQQKQDDGRGLVLPGYKYLGPFNGLD 60 MAADGYLPDWLEDNLSEGIREWWDLKPGAPKPKANQQKQDDGRGLVLPGYKYLGPFNGLD Sbjct 1 MAADGYLPDWLEDNLSEGIREWWDLKPGAPKPKANQQKQDDGRGLVLPGYKYLGPFNGLD 60 Query 61 KGEPVNAADAAALEHDKAYDQQLKAGDNPYLRYNHADAEFQERLQEDTSFGGNLGRAVFQ 120 KGEPVNAADAAALEHDKAYDQQLKAGDNPYLRYNHADAEFQERLQEDTSFGGNLGRAVFQ Sbjct 61 KGEPVNAADAAALEHDKAYDQQLKAGDNPYLRYNHADAEFQERLQEDTSFGGNLGRAVFQ 120 Query 121 AKKRVLEPLGLVEEGAKTAPGKKRPVEQSPQEPDSSSGIGKTGQQPAKKRLNFGQTGDSE 180 AKKRVLEPLGLVEEGAKTAPGKKRPVEQSPQEPDSSSGIGKTGQQPAKKRLNFGQTGDSE Sbjct 121 AKKRVLEPLGLVEEGAKTAPGKKRPVEQSPQEPDSSSGIGKTGQQPAKKRLNFGQTGDSE 180 Query 181 SVPDPQPLGEPPATPAAVGPTTMASGGGAPMADNNEGADGVGNASGNWHCDSTWLGDRVI 240 SVPDPQPLGEPPATPAAVGPTTMASGGGAPMADNNEGADGVGNASGNWHCDSTWLGDRVI Sbjct 181 SVPDPQPLGEPPATPAAVGPTTMASGGGAPMADNNEGADGVGNASGNWHCDSTWLGDRVI 240 Query 241 TTSTRTWALPTYNNHLYKQISSASTGASNDNHYFGYSTPWGYFDFNRFHCHFSPRDWQRL 300 TTSTRTWALPTYNNHLYKQISSASTGASNDNHYFGYSTPWGYFDFNRFHCHFSPRDWQRL Sbjct 241 TTSTRTWALPTYNNHLYKQISSASTGASNDNHYFGYSTPWGYFDFNRFHCHFSPRDWQRL 300 Query 301 INNNWGFRPKRLNFKLFNIQVKEVTTNDGVTTIANNLTSTVQVFSDSEYQLPYVLGSAHQ 360 INNNWGFRPKRLNFKLFNIQVKEVTTNDGVTTIANNLTSTVQVFSDSEYQLPYVLGSAHQ Sbjct 301 INNNWGFRPKRLNFKLFNIQVKEVTTNDGVTTIANNLTSTVQVFSDSEYQLPYVLGSAHQ 360 Query 361 GCLPPFPADVFMIPQYGYLTLNNGSQAVGRSSFYCLEYFPSQMLRTGNNFTFSYTFEEVP 420 GCLPPFPADVFMIPQYGYLTLNNGSQAVGRSSFYCLEYFPSQMLRTGNNFTFSYTFEEVP Sbjct 361 GCLPPFPADVFMIPQYGYLTLNNGSQAVGRSSFYCLEYFPSQMLRTGNNFTFSYTFEEVP 420 Query 421 FHSSYAHSQSLDRLMNPLIDQYLYYLNRTQNQSGSAQNKDLLFSRGSPAGMSVQPKNWLP 480 FHSSYAHSQSLDRLMNPLIDQYLYYLNRTQNQSGSAQNKDLLFSRGSPAGMSVQPKNWLP Sbjct 421 FHSSYAHSQSLDRLMNPLIDQYLYYLNRTQNQSGSAQNKDLLFSRGSPAGMSVQPKNWLP 480 Query 481 GPCYRQQRVSKTKTDNNNSNFTWTGASKYNLNGRESIINPGTAMASHKDDEDKFFPMSGV 540 GPCYRQQRVSKTKTDNNNSNFTWTGASKYNLNGRESIINPGTAMASHKDDEDKFFPMSGV Sbjct 481 GPCYRQQRVSKTKTDNNNSNFTWTGASKYNLNGRESIINPGTAMASHKDDEDKFFPMSGV 540 Query 541 MIFGKESAGASNTALDNVMITDEEEIKATNPVATERFGTVAVNFQSSSTDPATGDVHAMG 600 MIFGKESAGASNTALDNVMITDEEEIKATNPVATERFGTVAVNFQSSSTDPATGDVHAMG Sbjct 541 MIFGKESAGASNTALDNVMITDEEEIKATNPVATERFGTVAVNFQSSSTDPATGDVHAMG 600 Query 601 ALPGMVWQDRDVYLQGPIWAKIPHTDGHFHPSPLMGGFGLKNPPPQILIKNTPVPANPPA 660 ALPGMVWQDRDVYLQGPIWAKIPHTDGHFHPSPLMGGFGLKNPPPQILIKNTPVPANPPA Sbjct 601 ALPGMVWQDRDVYLQGPIWAKIPHTDGHFHPSPLMGGFGLKNPPPQILIKNTPVPANPPA 660 Query 661 EFSATKFASFITQYSTGQVSVEIEWELQKENSKRWNPEVQYTSNYAKSANVDFTVDNNGL 720 EFSATKFASFITQYSTGQVSVEIEWELQKENSKRWNPEVQYTSNYAKSANVDFTVDNNGL Sbjct 661 EFSATKFASFITQYSTGQVSVEIEWELQKENSKRWNPEVQYTSNYAKSANVDFTVDNNGL 720 Query 721 YTEPRPIGTRYLTRPL 736 YTEPRPIGTRYLTRPL Sbjct 721 YTEPRPIGTRYLTRPL 736
Read full office action

Prosecution Timeline

Jan 29, 2024
Application Filed
Jul 01, 2026
Non-Final Rejection mailed — §103 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12680089
ADMINISTRATION OF KYNURENINE DEPLETING ENZYMES FOR TUMOR THERAPY
3y 7m to grant Granted Jul 14, 2026
Patent 12644086
ROLLED SCAFFOLD FOR LARGE SCALE CELL CULTURE IN MONOLAYER
5y 10m to grant Granted Jun 02, 2026
Patent 12629356
EXPANSION OF TUMOR INFILTRATING LYMPHOCYTES WITH POTASSIUM CHANNEL AGONISTS AND THERAPEUTIC USES THEREOF
3y 11m to grant Granted May 19, 2026
Patent 12618044
SPECIFICATION OF FUNCTIONAL CRANIAL PLACODE DERIVATIVES FROM HUMAN PLURIPOTENT STEM CELLS
3y 4m to grant Granted May 05, 2026
Patent 12611440
FUSION PROTEINS AND USES THEREOF
4y 1m to grant Granted Apr 28, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

Strategy Recommendation AI-generated — please review before filing

Get a prosecution strategy drawn from examiner precedents, rejection analysis, and claim mapping.
Typically takes 5-10 seconds — AI-generated, attorney review required before filing

Prosecution Projections

1-2
Expected OA Rounds
53%
Grant Probability
84%
With Interview (+30.6%)
3y 7m (~1y 1m remaining)
Median Time to Grant
Low
PTA Risk
Based on 612 resolved cases by this examiner. Grant probability derived from career allowance rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month