Prosecution Insights
Last updated: April 19, 2026
Application No. 18/597,524

DOWNY MILDEW RESISTANT LETTUCE MUTANT

Non-Final OA §103§112§DP
Filed
Mar 06, 2024
Examiner
IBRAHIM, MEDINA AHMED
Art Unit
1662
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Nunhems B.V.
OA Round
1 (Non-Final)
88%
Grant Probability
Favorable
1-2
OA Rounds
2y 5m
To Grant
99%
With Interview

Examiner Intelligence

Grants 88% — above average
88%
Career Allow Rate
1272 granted / 1452 resolved
+27.6% vs TC avg
Moderate +12% lift
Without
With
+11.8%
Interview Lift
resolved cases with interview
Typical timeline
2y 5m
Avg Prosecution
22 currently pending
Career history
1474
Total Applications
across all art units

Statute-Specific Performance

§101
6.0%
-34.0% vs TC avg
§103
13.4%
-26.6% vs TC avg
§102
16.0%
-24.0% vs TC avg
§112
51.8%
+11.8% vs TC avg
Black line = Tech Center average estimate • Based on career data from 1452 resolved cases

Office Action

§103 §112 §DP
Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Election/Restrictions Applicant's election with traverse of group I, claims 1-7 and 11-12, in the reply filed on 03/09/2026 is acknowledged. The traversal is on the ground(s) that Applicant submits that the inventions of groups I-III relate to a mutant gene encoding a mutant homoserine kinase protein of SEQ ID NO: 1, and a method of using said mutant gene and a method of detecting said gene. Applicant asserts that all claims can be examined together without undue search burden. This is not found persuasive because the method of generating a lettuce plant comprising at least 10.0 nmol L-homoserine kinase level per mg fresh weight of leaf tissue of group II and the method of detecting whether a lettuce plant comprises a mutant L-homoserine kinase allele have different modes of operation because the step of determining the presence of a nucleic acid having one or more nucleotides which are different compared to the DNA of SEQ ID NO: 2 of the method of group III is not required by the method of group II. Therefore, the search of the invention of group III would not necessarily reveal all arts relevant to the patentability of the invention of group II. Consequently, the examination of the invention of group II with the invention of group III would present search burden upon the office. Upon further consideration, the invention of group II, claims 13-15, is hereby rejoined with the elected invention of group I, claims 1-7 and 11-12. Claims 1-7 and 11-15 are hereby rejoined for examination. Claims 1-7 and 11-17 are pending. Claims 16 and 17 are withdrawn from consideration as being directed to the non-elected invention. Claims 1-7 and 11-15 are examined. Copending Applications Applicants must bring to the attention of the Examiner, or other Office official involved with the examination of a particular application, information within their knowledge as to other copending United States applications, which are "material to patentability" of the application in question. MPEP 2001.06(b). See Dayco Products Inc. v. Total Containment Inc., 66 USPQ2d 1801 (CA FC 2003). Claims 1-7 and 11-15, pending in this application, are examined. Claim Objections Claims 11-12 are objected to because of the following informalities: the claims should have been in the singular. Therefore, it is suggested that “Seeds” in claim 11 be replaced with ---A seed---; and “Lettuce leaves or heads” be replaced with --- A lettuce leaf or head---. Appropriate correction is required. Claim Rejections - 35 USC § 112 The following is a quotation of the first paragraph of 35 U.S.C. 112(a): (a) IN GENERAL.—The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor or joint inventor of carrying out the invention. The following is a quotation of the first paragraph of pre-AIA 35 U.S.C. 112: The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor of carrying out his invention. Claims 1-7 and 11-15 are rejected under 35 U.S.C. 112(a) or 35 U.S.C. 112 (pre-AIA ), first paragraph, as failing to comply with the written description requirement. The claim(s) contains subject matter which was not described in the specification in such a way as to reasonably convey to one skilled in the relevant art that the inventor or a joint inventor, or for applications subject to pre-AIA 35 U.S.C. 112, the inventor(s), at the time the application was filed, had possession of the claimed invention. The claims are broadly drawn to a cultivated plant of the species of Lactuca sativa which is homozygous for a mutant allele of the wild type homoserine kinase gene encoding SEQ ID NO: 1, which mutant allele a) encodes a mutant homoserine kinase protein comprising one or more amino acids inserted, deleted or replaced compared to the wild type protein of SEQ ID NO: 1, or b) has reduced gene expression compared to the wild type allele, wherein said mutant allele results in the leaf tissue of said lettuce plant accumulating L-homoserine, while a plant heterozygous for the mutant allele or lacking the mutant allele does not accumulate L-homoserine in the leaf tissue and wherein said L-homoserine in the leaf tissue confers resistance against Bremia Lactuca wherein the plant is homozygous for the wild type allele of the homoserine kinase gene encoding the homoserine kinase protein of SEQ ID NO: 3; wherein the mutant allele encodes a mutant homoserine kinase protein which comprises an amino acid N64 (Asn at position 64 of SEQ ID NO: 1), D70 (Asp at position 70 of SEQ ID NO: 1), N118 (Asn at position 118 of SEQ ID NO: 1), C119 (Cys at position 119 of SEQ ID NO: 1), K144 (Lys at position 144 of SEQ ID NO: 1), G149 (Gly at position 149 of SEQ ID NO: 1), G151 (Gly at position 151 of SEQ ID NO: 1), L152 (Leu at position 152 of SEQ ID NO: 1), G153 (Gly at position 153 of SEQ ID NO: 1), S154 (Ser at position 154 of SEQ ID NO: 1), S155 (Ser at position 155 of SEQ ID NO: 1), S158 (Ser at position 158 of SEQ ID NO: 1), D196 (Asp at position 196 of SEQ ID NO: 1), N197 (Asn at position 197 of SEQ ID NO: 1), T241 (Thr at position 241 of SEQ ID NO: 1), R245 (Arg at position 245 of SEQ ID NO: 1), R293 (Arg at position 293 of SEQ ID NO: 1) and A320 (Ala at position 320 of SEQ ID NO: 1) and M244 (met at position 244 of SEQ ID NO: 1) being replaced by a different amino acid or an amino acid located 1, 2, 3 or 4 positions before or after said amino acid being replaced by a different amino acid; said plant wherein the mutant allele encodes a mutant homoserine kinase protein which comprises the amino acid Arginine (Arg, R) at amino acid number 245 of SEQ ID NO: 1 being replaced by a different amino acid or by Lysine (Lys, K); wherein the leaf tissue comprises at least 10 nmol/mg fresh weight, wherein the L-homoserine in the leaf tissue confers resistance against Bremia lactucae wherein the amount of said L-homoserine in the leaf tissue is high enough to prevent sporulation of Bremia lactucae under conditions where the susceptible control plant shows 100% sporulation. The claims are also drawn to seeds from which said plant can be grown, and a lettuce leaf or head from said plant; and a method of generating a lettuce plant comprising at least 10.0 nmol per mg of fresh weight of leaf tissue. In contrast, the specification describes lactuca sativa plant and seed that produces said plant which is homozygous for a mutant allele of the homoserine kinase (HSK) protein with Arginine (Arg, R) at amino acid number 245 of SEQ ID NO: 1 is replaced by a Lysine (Lys, K) that results in a lower phosphorylation of homoserine that leads to an accumulation of L-homoserine level of 19.46 nmol per mg fresh weight in the leaf tissue; wherein said L-homoserine level in the leaf tissue confers resistance against Bremia lactucae, and prevents sporulation of Bremia lactucae. The specification does not describe a Lactuca sativa plant comprising a mutant allele encoding a homoserine kinase protein with point mutations as listed in the claims and with 10 nmol/mg of homoserine levels that resulted in resistance to Bremia in the plant. In fact, the specification data shows that a homoserine concentration of 4.41 nmol/mg does not lead to Bremia resistance in the mutated plant (Fig. 1). The specification does not show a single lettuce mutant with homoserine accumulation of 10 nmol nmol/mg fresh weight having resistance to the pathogen. In addition, the specification does not describe a single Bremia resistant lettuce plant with mutant allele encoding a mutant homoserine kinase which comprises other than an amino acid other than R245k . Therefore, the specification has not described a representative species of Bremia lactucae resistant lettuce plant/seed/leaf or head comprising the genus of mutated homoserine kinase protein comprising one or more amino acids inserted, deleted or replaced compared to the wild type protein of SEQ ID NO: 1, wherein the mutated homoserine kinase leads to a homoserine level sufficient to induce resistance against the pathogen. Furthermore, the specification fails to describe structural features common to members of the genus of mutated homoserine kinase that leads to a homoserine level sufficient to induce resistance against the pathogen. Therefore, the specification has not met either of the two elements of the written description requirement as set forth in the court's decision in Eli Lilly, and has not shown her/his possession of the claimed genus at the time of the application. Therefore, the specification fails to sufficiently describe the claimed invention in such full, clear, concise, and exact terms that a skilled artisan would recognize that Applicant was in possession of the invention as broadly claimed at the time of filing. Claim Rejections - 35 USC § 103 In the event the determination of the status of the application as subject to AIA 35 U.S.C. 102 and 103 (or as subject to pre-AIA 35 U.S.C. 102 and 103) is incorrect, any correction of the statutory basis for the rejection will not be considered a new ground of rejection if the prior art relied upon, and the rationale supporting the rejection, would be the same under either status. The following is a quotation of 35 U.S.C. 103 which forms the basis for all obviousness rejections set forth in this Office action: A patent for a claimed invention may not be obtained, notwithstanding that the claimed invention is not identically disclosed as set forth in section 102, if the differences between the claimed invention and the prior art are such that the claimed invention as a whole would have been obvious before the effective filing date of the claimed invention to a person having ordinary skill in the art to which the claimed invention pertains. Patentability shall not be negated by the manner in which the invention was made. The factual inquiries for establishing a background for determining obviousness under 35 U.S.C. 103 are summarized as follows: 1. Determining the scope and contents of the prior art. 2. Ascertaining the differences between the prior art and the claims at issue. 3. Resolving the level of ordinary skill in the pertinent art. 4. Considering objective evidence present in the application indicating obviousness or nonobviousness. This application currently names joint inventors. In considering patentability of the claims the examiner presumes that the subject matter of the various claims was commonly owned as of the effective filing date of the claimed invention(s) absent any evidence to the contrary. Applicant is advised of the obligation under 37 CFR 1.56 to point out the inventor and effective filing dates of each claim that was not commonly owned as of the effective filing date of the later invention in order for the examiner to consider the applicability of 35 U.S.C. 102(b)(2)(C) for any potential 35 U.S.C. 102(a)(2) prior art against the later invention. Claims 1-7 and 11-15 are rejected under 35 U.S.C. 103 as being unpatentable over VAN DEN et al (US 8, 237019 B2; Applicant’s IDS) in view of Reyes-Chin et al (Accession A0A2J6LHE4 and A0A2J6M5X6; deposited 2017; Applicant’s IDS ). The claims are broadly drawn to a cultivated plant of the species of Lactuca sativa which is homozygous for a mutant allele of the wild type homoserine kinase gene encoding SEQ ID NO: 1, which mutant allele a) encodes a mutant homoserine kinase protein comprising one or more amino acids inserted, deleted or replaced compared to the wild type protein of SEQ ID NO: 1, or b) has reduced gene expression compared to the wild type allele, wherein said mutant allele results in the leaf tissue of said lettuce plant accumulating L-homoserine, while a plant heterozygous for the mutant allele or lacking the mutant allele does not accumulate L-homoserine in the leaf tissue and wherein said L-homoserine in the leaf tissue confers resistance against Bremia Lactuca wherein the plant is homozygous for the wild type allele of the homoserine kinase gene encoding the homoserine kinase protein of SEQ ID NO: 3; wherein the mutant allele encodes a mutant homoserine kinase protein which comprises an amino acid N64 (Asn at position 64 of SEQ ID NO: 1), D70 (Asp at position 70 of SEQ ID NO: 1), N118 (Asn at position 118 of SEQ ID NO: 1), C119 (Cys at position 119 of SEQ ID NO: 1), K144 (Lys at position 144 of SEQ ID NO: 1), G149 (Gly at position 149 of SEQ ID NO: 1), G151 (Gly at position 151 of SEQ ID NO: 1), L152 (Leu at position 152 of SEQ ID NO: 1), G153 (Gly at position 153 of SEQ ID NO: 1), S154 (Ser at position 154 of SEQ ID NO: 1), S155 (Ser at position 155 of SEQ ID NO: 1), S158 (Ser at position 158 of SEQ ID NO: 1), D196 (Asp at position 196 of SEQ ID NO: 1), N197 (Asn at position 197 of SEQ ID NO: 1), T241 (Thr at position 241 of SEQ ID NO: 1), R245 (Arg at position 245 of SEQ ID NO: 1), R293 (Arg at position 293 of SEQ ID NO: 1) and A320 (Ala at position 320 of SEQ ID NO: 1) and M244 (met at position 244 of SEQ ID NO: 1) being replaced by a different amino acid or an amino acid located 1, 2, 3 or 4 positions before or after said amino acid being replaced by a different amino acid; said plant wherein the mutant allele encodes a mutant homoserine kinase protein which comprises the amino acid Arginine (Arg, R) at amino acid number 245 of SEQ ID NO: 1 being replaced by a different amino acid or by Lysine (Lys, K); wherein the leaf tissue comprises at least 10 nmol/mg fresh weight, wherein the L-homoserine in the leaf tissue confers resistance against Bremia lactucae wherein the amount of said L-homoserine in the leaf tissue is high enough to prevent sporulation of Bremia lactucae under conditions where the susceptible control plant shows 100% sporulation. The claims are also drawn to seeds from which said plant can be grown, and a lettuce leaf or head from said plant; and a method of generating a lettuce plant comprising at least 10.0 nmol per mg of fresh weight of leaf tissue. VAN DEN et al teach an isolated lettuce plant that is resistant to Bremia Lactucae as a result of a mutation in the homoserine kinase gene leading to a mutated homoserine kinase of SEQ ID NO: 102 with reduced activity, wherein the reduced HSK activity leads to an increased endogenous homoserine concentration/level. Van Den et al also teach that mutation in the HSK gene leads to amino acid substitutions in SEQ ID NO: 102, thereby lowering the activity of the encoded protein or reducing the expression of the gene SEQ ID NO: 101. Van Den et al further teach methods of producing said lettuce plant by targeted mutagenesis treatment and selecting mutant lettuce plants having resistance to Bremia Lactucae . Van Den et al teach the Bremia Lactuca resistant lettuce plants/seed are made homozygous by selfing. Van Den et al also teach that orthologous HSK sequences from any plant species can be identified using the HSK Arabidopsis thaliana DNA sequence and that the identified orthologous sequences can be used to prepare mutants with downregulated HSK activity (column 6 and Examples 4-5). In Figs. 3-4, Van Den et al teach 5 dmr1 mutants from Arabidopsis thaliana with a point mutation at different positions (Examples 1-2 and Table 1). At column 7, Van Den et al teaches various embodiments of downregulating the activity of HSK. In Fig. 1, Van Den et al teach amino acid sequence alignment of HSK proteins of Arabidopsis thaliana and orthologous from other plant species including Lactuca sativa and also show conserved amino acids. The figure shows that dmr1 is highly conserved across all plants. Fig. 10 shows the HSK nucleotide and amino acid sequences of Lactuca sativa (SEQ ID NO: 101-102). At [0028], Van Den et al state that two dmr1 homologs may exist in the same plant as is identified in potato, tobacco and poplar plants. This implies that two dmr1 homologs can also be found in lettuce. In addition, the sequence search results of the instant SEQ ID NO: 1 reveals that SEQ ID NO: 1 and 3 of the instant claims share high sequence similarity with SEQ ID NO: 102 of Van Den et al (see alignment of sequences shown below). Van Den et al suggest mutating the dmr1 genes, screening for homoserine level and selecting the resistant plants. While Van Den et al teach one or more mutants with amino acid point mutations as recited in the claims, any mutant not explicitly disclosed or suggested in Van Den et al may be regarded as of many of alternatives that a person skilled in the art would have selected from targeted mutagenesis to identify dmr1 mutants leading to Bremia lactucae resistance in lettuce. Van Den et al show the routine experimentation to mutate the dmr1 genes in lettuce, screening the mutated plant for increased homoserine levels, and testing dmr1 mutated plant with increased homoserine levels for resistance against the pathogen by visually examining the conidiophore formation (Example 6 and Figures 2 and 6). Figure 2 shows the more homoserine is accumulated in a plant, the pathogen resistance will be increased more. Van Den et al do not explicitly teach the least 10.0 per mg fresh weight of homoserine level in lettuce tissues. However, the prior art teaches that the Bremia lactucae resistance can be provided by the accumulation of homoserine in the dmr1-mutated plant tissues. In Example 2, Van Den et al show accumulation of homoserine level in dmr1 mutants and measuring the level of homoserine in dmr1 mutants (Table 1). Therefore, it is straight forward to find plants with the right amount of homoserine using the method disclosed Van Den et al. Therefore, given that the homoserine kinase of SEQ ID NO: 1 and 3 of the claims are known in the prior art as taught by Reyes-Chin et al (Accession A0A2J6LHE4 and A0A2J6M5X6; deposited 2017; Applicant’s IDS); given that the prior art as evidenced by Van Den et al already show production of Bremia Lactucae resistance lettuce by mutations in the HSK gene leads to a homoserine kinase of SEQ ID NO: 102 with reduced activity, wherein the reduced HSK activity leads to an increased endogenous homoserine concentration/level; given the importance of lettuce as one of the most valuable vegetable crop species in the USA, and given the problem of downy mildew in production of important crop plants such as lettuce as taught by Van Den et al; one of skilled in the art would have been obvious to one of ordinary skill in the art before the effective filing date of the claimed invention, to produce mutant lettuce plant or parts thereof having resistance to downy mildew by downregulating homoserine kinase activity or by reducing expression of homoserine kinase gene using the methods taught by Van Den et al, with a reasonable expectation of success. One would have been motivated to target homoserine kinase gene in lettuce, give the availability of genome sequences including instant SEQ ID NO: 1 and 3 taught by Reyes-Chin et al. Therefore, the claimed invention is a prima facie obvious, absent evidence to the contrary. US-12-092-253-101 (US 8, 237, 019) ; Sequence 101, Application US/12092253 ; Publication No. US20090170703A1 ; GENERAL INFORMATION ; APPLICANT: UNIVERSITEIT UTRECHT HOLDING B.V. ; APPLICANT:van den Ackerveken, Augustinus Franciscus Johannes ; APPLICANT:van Damme, Mireille Maria Augusta ; TITLE OF INVENTION: DISEASE RESISTANT PLANTS ; FILE REFERENCE: L/2DR71/3p ; CURRENT APPLICATION NUMBER: US/12/092,253 ; CURRENT FILING DATE: 2008-12-19 ; PRIOR APPLICATION NUMBER: PCT/EP2006/010535 ; PRIOR FILING DATE: 2006-11-01 ; PRIOR APPLICATION NUMBER: PCT/EP2005/011718 ; PRIOR FILING DATE: 2005-11-01 ; NUMBER OF SEQ ID NOS: 110 ; SOFTWARE: PatentIn version 3.3 ; SEQ ID NO 101 ; LENGTH: 1128 ; TYPE: DNA ; ORGANISM: Lactuca sativa US-12-092-253-101 Alignment Scores: Length: 1128 Score: 1875.00 Matches: 373 Percent Similarity: 99.7% Conservative: 1 Best Local Similarity: 99.5% Mismatches: 1 Query Match: 99.4% Indels: 0 DB: 34 Gaps: 0 US-17-283-877-3 (1-375) x US-12-092-253-101 (1-1128) Qy 1 MetAlaIleArgHisTyrGlnProProPheAlaSerThrSerSerSerIleSerSerThr 20 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 ATGGCAATTCGCCATTATCAACCTCCATTCGCCTCCACTTCTTCTTCTATCTCTAGTACA 60 Qy 21 AspLeuPheLysProProLysLeuHisLeuSerSerSerValArgCysAsnIleSerVal 40 ||||||||||||||||||||||||:::||||||||||||||||||||||||||||||||| Db 61 GATTTATTCAAACCCCCTAAACTTTATCTTTCATCGTCTGTCCGGTGCAACATCTCCGTC 120 Qy 41 AlaSerLysLeuGluProGluProHisProValPheThrSerValLysSerPheAlaPro 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 GCTTCCAAACTGGAACCCGAACCTCATCCAGTTTTCACCTCCGTTAAGTCATTCGCCCCC 180 Qy 61 AlaThrValAlaAsnLeuGlyProGlyPheAspPheLeuGlyCysAlaIleAspGlyIle 80 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 GCCACCGTAGCCAACCTCGGGCCTGGTTTCGACTTCCTCGGCTGCGCAATCGACGGCATC 240 Qy 81 GlyAspTyrValThrLeuThrValAspProGlnValGlnProGlyArgLeuSerIleAla 100 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 GGAGATTACGTTACCCTCACAGTCGACCCCCAAGTCCAACCCGGCAGATTATCAATTGCA 300 Qy 101 GluIleAsnGlyValAspLysSerSerLysArgLeuSerArgAsnProLeuTrpAsnCys 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 GAAATCAACGGCGTTGACAAGTCTTCCAAGAGGCTCAGCAGAAACCCTCTATGGAATTGC 360 Qy 121 AlaGlyIleAlaAlaIleSerValMetLysMetLeuLysIleArgSerValGlyLeuSer 140 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 GCCGGAATTGCTGCAATCTCCGTCATGAAGATGCTCAAGATCCGATCCGTTGGTCTCTCT 420 Qy 141 LeuSerIleAsnThrCysLeuProLeuArgGlyGlyLeuGlySerSerAlaAlaSerAla 160 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 TTATCCATCAATACATGTCTCCCCCTTCGAGGCGGCCTAGGCTCCAGCGCCGCTAGCGCT 480 Qy 161 AlaAlaAlaAlaValAlaValAsnGluIlePheGlyGlyLysLeuGlnAspSerAspLeu 180 ||||||||||||||||||||||||||||||||||||||||||||| |||||||||||| Db 481 GCCGCCGCCGCCGTTGCGGTTAATGAGATTTTCGGAGGGAAGTTACATGATTCCGATTTG 540 Qy 181 IleLeuAlaGlyLeuGluAlaGluAlaLysLeuSerGlyTyrHisAlaAspAsnIleAla 200 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 541 ATACTCGCGGGGCTCGAAGCTGAAGCGAAGTTATCCGGTTATCACGCCGATAACATTGCT 600 Qy 201 ProAlaIleMetGlyGlyPheValLeuIleArgSerTyrAspProLeuGluLeuIleSer 220 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 601 CCGGCGATCATGGGCGGGTTTGTGTTGATCAGAAGCTACGATCCATTAGAGTTGATCTCC 660 Qy 221 LeuLysPheProProGluLysAsnLeuPhePheValLeuValAsnProGluPheGlnAla 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 661 TTGAAGTTTCCACCGGAAAAGAATCTGTTTTTCGTGTTGGTGAATCCTGAATTCCAAGCA 720 Qy 241 GlnThrLysLysMetArgAlaValLeuProThrGluIleThrMetSerAspHisValTrp 260 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 721 CAAACGAAGAAGATGAGGGCGGTTCTACCGACGGAGATAACAATGTCGGATCATGTATGG 780 Qy 261 AsnCysSerGlnAlaAlaAlaLeuValAlaGlyValLeuGlnGlyAspLeuValGlyPhe 280 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 781 AATTGTAGTCAGGCGGCGGCGTTGGTGGCAGGCGTATTGCAGGGGGATTTGGTGGGGTTT 840 Qy 281 GlyLysAlaLeuSerSerAspArgIleValGluProArgArgAlaProLeuLeuProGly 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 841 GGGAAGGCATTGTCATCGGATAGAATAGTGGAGCCACGGCGGGCGCCATTGCTTCCGGGA 900 Qy 301 MetGluAspValLysLysAlaAlaMetGluAlaGlyAlaTyrGlyCysThrIleSerGly 320 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 901 ATGGAAGATGTGAAGAAGGCAGCAATGGAAGCAGGGGCATATGGGTGTACGATAAGTGGG 960 Qy 321 SerGlyProThrValValAlaValThrAspAspGluAspArgGlyArgGluIleGlyGlu 340 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 961 TCAGGGCCGACGGTGGTGGCGGTGACGGATGATGAAGATAGAGGGAGGGAGATCGGGGAG 1020 Qy 341 LysMetValGluAlaPheValGluLysGlyLysLeuLysAlaLeuAlaMetValLysLys 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1021 AAGATGGTGGAAGCTTTTGTAGAGAAGGGAAAGTTGAAAGCTTTGGCTATGGTGAAGAAA 1080 Qy 361 LeuAspArgValGlyAlaArgValIleSerArgIleSerSerGln 375 ||||||||||||||||||||||||||||||||||||||||||||| Db 1081 CTGGACAGAGTTGGTGCTAGAGTTATCAGTCGTATCTCCAGCCAA 1125 Search Results from instant SEQ ID NO: 1 RESULT 7 US-12-092-253-101 (US 8, 237, 019) Sequence 101, Application US/12092253 Publication No. US20090170703A1 GENERAL INFORMATION APPLICANT: UNIVERSITEIT UTRECHT HOLDING B.V. APPLICANT:van den Ackerveken, Augustinus Franciscus Johannes APPLICANT:van Damme, Mireille Maria Augusta TITLE OF INVENTION: DISEASE RESISTANT PLANTS FILE REFERENCE: L/2DR71/3p CURRENT APPLICATION NUMBER: US/12/092,253 CURRENT FILING DATE: 2008-12-19 PRIOR APPLICATION NUMBER: PCT/EP2006/010535 PRIOR FILING DATE: 2006-11-01 PRIOR APPLICATION NUMBER: PCT/EP2005/011718 PRIOR FILING DATE: 2005-11-01 NUMBER OF SEQ ID NOS: 110 SOFTWARE: PatentIn version 3.3 SEQ ID NO 101 LENGTH: 1128 TYPE: DNA ORGANISM: Lactuca sativa US-12-092-253-101 Alignment Scores: Length: 1128 Score: 1424.50 Matches: 282 Percent Similarity: 86.1% Conservative: 40 Best Local Similarity: 75.4% Mismatches: 49 Query Match: 75.3% Indels: 3 DB: 34 Gaps: 2 US-17-283-877-1 (1-373) x US-12-092-253-101 (1-1128) Qy 1 MetAlaIleCysHisHisHisGlnProSerPheThrIleProSerSerPheProPheThr 20 ||||||||| |||:::|||||| ||| |||||| ::: Db 1 ATGGCAATT---CGCCATTATCAACCTCCATTCGCCTCCACTTCTTCTTCTATCTCTAGT 57 Qy 21 ThrAsnLeuSerAsnLysSerGlnLeuHisLeuProSerSerPheArgCysAsnLeuSer 40 |||:::||| :::|||:::||| |||||| |||||||||:::||| Db 58 ACAGATTTATTCAAACCCCCTAAACTTTATCTTTCATCGTCTGTCCGGTGCAACATCTCC 117 Qy 41 ValThrThrAsnLeuGluProGlu------ProValTyrThrAlaValLysSerPheAla 58 ||| ::: |||||||||||| ||||||:::|||:::||||||||||||||| Db 118 GTCGCTTCCAAACTGGAACCCGAACCTCATCCAGTTTTCACCTCCGTTAAGTCATTCGCC 177 Qy 59 ProAlaThrValAlaAsnLeuGlyProGlyPheAspPheLeuGlyCysAlaValAspGly 78 |||||||||||||||||||||||||||||||||||||||||||||||||||:::|||||| Db 178 CCCGCCACCGTAGCCAACCTCGGGCCTGGTTTCGACTTCCTCGGCTGCGCAATCGACGGC 237 Qy 79 IleGlyAspTyrValThrLeuLysIleAspProGlnValHisProGlyGluValSerIle 98 ||||||||||||||||||||| :::|||||||||||| |||||| :::|||||| Db 238 ATCGGAGATTACGTTACCCTCACAGTCGACCCCCAAGTCCAACCCGGCAGATTATCAATT 297 Qy 99 ThrGluIleThrGlyThrGlyAsnSerAlaAsnLysLeuSerLysAsnProIleTrpAsn 118 |||||| ||| |||::: :::||||||:::||||||:::|||||| Db 298 GCAGAAATCAACGGCGTTGACAAGTCTTCCAAGAGGCTCAGCAGAAACCCTCTATGGAAT 357 Qy 119 CysAlaGlyIleAlaAlaIleSerValMetLysMetLeuAsnIleArgSerValGlyLeu 138 ||||||||||||||||||||||||||||||||||||||| |||||||||||||||||| Db 358 TGCGCCGGAATTGCTGCAATCTCCGTCATGAAGATGCTCAAGATCCGATCCGTTGGTCTC 417 Qy 139 SerLeuSerLeuGluLysGlyLeuProLeuGlySerGlyLeuGlySerSerAlaAlaSer 158 |||||||||::: ||||||||| |||||||||||||||||||||||| Db 418 TCTTTATCCATCAATACATGTCTCCCCCTTCGAGGCGGCCTAGGCTCCAGCGCCGCTAGC 477 Qy 159 AlaAlaAlaAlaAlaIleAlaValAsnGluIlePheGlyGlyLysLeuProAlaLeuAsp 178 |||||||||||||||:::|||||||||||||||||||||||||||||| ||| Db 478 GCTGCCGCCGCCGCCGTTGCGGTTAATGAGATTTTCGGAGGGAAGTTACATGATTCCGAT 537 Qy 179 LeuValLeuAlaGlyLeuGluSerGluAlaLysValSerGlyTyrHisAlaAspAsnIle 198 |||:::|||||||||||||||:::|||||||||:::|||||||||||||||||||||||| Db 538 TTGATACTCGCGGGGCTCGAAGCTGAAGCGAAGTTATCCGGTTATCACGCCGATAACATT 597 Qy 199 AlaProAlaIleMetGlyGlyPheValLeuValArgSerTyrAspProLeuGluLeuIle 218 ||||||||||||||||||||||||||||||:::||||||||||||||||||||||||||| Db 598 GCTCCGGCGATCATGGGCGGGTTTGTGTTGATCAGAAGCTACGATCCATTAGAGTTGATC 657 Qy 219 ProLeuGlnPheProValAspLysAsnLeuTyrPheValLeuValAsnProGluPheGlu 238 |||:::|||||| :::|||||||||:::||||||||||||||||||||||||::: Db 658 TCCTTGAAGTTTCCACCGGAAAAGAATCTGTTTTTCGTGTTGGTGAATCCTGAATTCCAA 717 Qy 239 AlaProThrLysLysMetArgAlaAlaLeuProLysGluIleThrMetSerHisHisVal 258 ||| |||||||||||||||||| |||||| ||||||||||||||| |||||| Db 718 GCACAAACGAAGAAGATGAGGGCGGTTCTACCGACGGAGATAACAATGTCGGATCATGTA 777 Qy 259 TrpAsnSerSerGlnAlaGlyAlaLeuValAlaAlaValLeuGlnGlyAspLeuLysGly 278 |||||| ||||||||| |||||||||||| |||||||||||||||||| ||| Db 778 TGGAATTGTAGTCAGGCGGCGGCGTTGGTGGCAGGCGTATTGCAGGGGGATTTGGTGGGG 837 Qy 279 PheGlyLysAlaLeuSerSerAspLysIleValGluProArgArgAlaProLeuIlePro 298 ||||||||||||||||||||||||:::|||||||||||||||||||||||||||:::||| Db 838 TTTGGGAAGGCATTGTCATCGGATAGAATAGTGGAGCCACGGCGGGCGCCATTGCTTCCG 897 Qy 299 GlyMetAspAlaValLysLysAlaAlaLeuGluAlaGlyAlaTyrGlyCysThrIleSer 318 ||||||::: |||||||||||||||:::|||||||||||||||||||||||||||||| Db 898 GGAATGGAAGATGTGAAGAAGGCAGCAATGGAAGCAGGGGCATATGGGTGTACGATAAGT 957 Qy 319 GlyAlaGlyProThrAlaValAlaValThrAspAsnGluGluLysGlyArgGluIleGly 338 |||:::||||||||| |||||||||||||||:::|||::::::||||||||||||||| Db 958 GGGTCAGGGCCGACGGTGGTGGCGGTGACGGATGATGAAGATAGAGGGAGGGAGATCGGG 1017 Qy 339 GluLysMetValGluAlaPheMetAlaGluGlyAsnLeuLysAlaValAlaMetValLys 358 |||||||||||||||||||||::: :::||| |||||||||:::|||||||||||| Db 1018 GAGAAGATGGTGGAAGCTTTTGTAGAGAAGGGAAAGTTGAAAGCTTTGGCTATGGTGAAG 1077 Qy 359 GlnLeuAspArgValGlyAlaArgLeuValSerSerIleSer 372 :::|||||||||||||||||||||::::::||| |||||| Db 1078 AAACTGGACAGAGTTGGTGCTAGAGTTATCAGTCGTATCTCC 1119 Results of Instant SEQ ID NO: 1 RESULT 1 JI586151/c LOCUS JI586151 1385 bp mRNA linear TSA 25-APR-2011 DEFINITION TSA: Lactuca sativa Letassy_X1_4175 mRNA sequence. ACCESSION JI586151 SOURCE Lactuca sativa ORGANISM Lactuca sativa AUTHORS Matvienko,M., Kozik,A., Xu,H. and Michelmore,R. TITLE Lettuce transcriptome assembly JOURNAL Unpublished REFERENCE 2 (bases 1 to 1385) AUTHORS Matvienko,M., Kozik,A., Xu,H. and Michelmore,R. TITLE Direct Submission JOURNAL Submitted (04-APR-2011) Genome Center, University of California Davis, Genome and Biomedical Sciences Facility, 451 Health Sciences Drive, Davis, CA 95616, USA FEATURES Location/Qualifiers source 1..1385 /organism="Lactuca sativa" /mol_type="mRNA" /isolation_source="multiple pooled tissues" /db_xref="taxon:4236" Alignment Scores: Length: 1385 Score: 1892.00 Matches: 373 Percent Similarity: 100.0% Conservative: 0 Best Local Similarity: 100.0% Mismatches: 0 Query Match: 100.0% Indels: 0 DB: 1088 Gaps: 0 US-17-283-877-1 (1-373) x JI586151 (1-1385) Qy 1 MetAlaIleCysHisHisHisGlnProSerPheThrIleProSerSerPheProPheThr 20 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1342 ATGGCGATTTGTCATCACCATCAACCTTCATTCACCATCCCTTCTTCTTTCCCATTCACT 1283 Qy 21 ThrAsnLeuSerAsnLysSerGlnLeuHisLeuProSerSerPheArgCysAsnLeuSer 40 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1282 ACTAATCTTTCAAACAAATCCCAACTTCATCTCCCATCGTCTTTCCGCTGCAATCTATCC 1223 Qy 41 ValThrThrAsnLeuGluProGluProValTyrThrAlaValLysSerPheAlaProAla 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1222 GTCACTACAAATCTCGAACCCGAACCCGTTTACACCGCCGTCAAGTCATTCGCCCCCGCC 1163 Qy 61 ThrValAlaAsnLeuGlyProGlyPheAspPheLeuGlyCysAlaValAspGlyIleGly 80 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1162 ACCGTAGCCAACCTCGGCCCTGGGTTTGACTTTCTCGGTTGCGCAGTCGACGGGATCGGA 1103 Qy 81 AspTyrValThrLeuLysIleAspProGlnValHisProGlyGluValSerIleThrGlu 100 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1102 GACTATGTCACCCTCAAAATCGACCCCCAAGTTCACCCTGGCGAGGTCTCAATCACCGAA 1043 Qy 101 IleThrGlyThrGlyAsnSerAlaAsnLysLeuSerLysAsnProIleTrpAsnCysAla 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1042 ATCACCGGAACCGGCAACTCCGCCAATAAGCTCAGCAAAAACCCTATCTGGAATTGCGCT 983 Qy 121 GlyIleAlaAlaIleSerValMetLysMetLeuAsnIleArgSerValGlyLeuSerLeu 140 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 982 GGGATTGCTGCCATTTCTGTCATGAAGATGCTCAACATCCGATCCGTCGGCCTCTCTCTA 923 Qy 141 SerLeuGluLysGlyLeuProLeuGlySerGlyLeuGlySerSerAlaAlaSerAlaAla 160 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 922 TCTCTAGAAAAGGGTCTCCCCCTCGGAAGCGGTCTCGGTTCCAGCGCCGCTAGTGCCGCC 863 Qy 161 AlaAlaAlaIleAlaValAsnGluIlePheGlyGlyLysLeuProAlaLeuAspLeuVal 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 862 GCCGCGGCAATCGCCGTTAATGAGATTTTTGGTGGAAAGTTACCTGCATTGGATTTAGTC 803 Qy 181 LeuAlaGlyLeuGluSerGluAlaLysValSerGlyTyrHisAlaAspAsnIleAlaPro 200 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 802 CTCGCAGGGCTTGAATCGGAAGCTAAAGTATCCGGATACCACGCTGATAACATTGCGCCG 743 Qy 201 AlaIleMetGlyGlyPheValLeuValArgSerTyrAspProLeuGluLeuIleProLeu 220 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 742 GCAATCATGGGTGGTTTCGTTCTCGTTCGGAGCTACGATCCTTTAGAGCTGATTCCGTTG 683 Qy 221 GlnPheProValAspLysAsnLeuTyrPheValLeuValAsnProGluPheGluAlaPro 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 682 CAGTTTCCGGTCGACAAAAACCTCTATTTCGTCTTGGTGAATCCGGAATTCGAAGCGCCG 623 Qy 241 ThrLysLysMetArgAlaAlaLeuProLysGluIleThrMetSerHisHisValTrpAsn 260 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 622 ACGAAGAAGATGAGGGCGGCGTTACCAAAAGAGATAACAATGTCGCACCATGTATGGAAC 563 Qy 261 SerSerGlnAlaGlyAlaLeuValAlaAlaValLeuGlnGlyAspLeuLysGlyPheGly 280 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 562 AGTAGTCAAGCAGGTGCCTTGGTGGCGGCGGTGTTGCAGGGGGATTTGAAGGGGTTTGGA 503 Qy 281 LysAlaLeuSerSerAspLysIleValGluProArgArgAlaProLeuIleProGlyMet 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 502 AAGGCGTTGTCTTCTGATAAGATAGTGGAACCGAGGAGGGCGCCATTGATTCCGGGAATG 443 Qy 301 AspAlaValLysLysAlaAlaLeuGluAlaGlyAlaTyrGlyCysThrIleSerGlyAla 320 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 442 GATGCTGTGAAGAAGGCTGCACTTGAGGCAGGGGCTTATGGGTGTACGATCAGTGGAGCA 383 Qy 321 GlyProThrAlaValAlaValThrAspAsnGluGluLysGlyArgGluIleGlyGluLys 340 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 382 GGGCCAACTGCGGTGGCTGTTACAGATAACGAGGAAAAAGGGAGGGAGATTGGGGAGAAG 323 Qy 341 MetValGluAlaPheMetAlaGluGlyAsnLeuLysAlaValAlaMetValLysGlnLeu 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 322 ATGGTGGAAGCTTTCATGGCGGAAGGAAATTTGAAAGCTGTGGCTATGGTGAAGCAATTG 263 Qy 361 AspArgValGlyAlaArgLeuValSerSerIleSerArg 373 ||||||||||||||||||||||||||||||||||||||| Db 262 GACAGAGTTGGTGCTAGACTTGTTAGTAGCATTTCCAGA 224 SEQ ID NO: 1 RESULT 3 KM397806 LOCUS KM397806 948 bp mRNA linear PLN 01-NOV-2014 DEFINITION Lactuca sativa homoserine kinase mRNA, partial cds. ACCESSION KM397806 VERSION KM397806.1 KEYWORDS . SOURCE Lactuca sativa AUTHORS Zeng,L., Zhang,Q., Sun,R., Kong,H., Zhang,N. and Ma,H. TITLE Resolution of deep angiosperm phylogeny using conserved nuclear genes and estimates of early divergence times JOURNAL Nat Commun 5, 4956 (2014) PUBMED 25249442 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 948) AUTHORS Zeng,L., Zhang,Q., Sun,R., Kong,H., Zhang,N. and Ma,H. TITLE Direct Submission JOURNAL Submitted (26-AUG-2014) School of Life Sciences, Fudan University, 220th Handan Road, Shanghai 200433, China COMMENT ##Assembly-Data-START## Assembly Method :: trinity v. Trinityrnaseq_r20131110 Sequencing Technology :: Illumina ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..948 /organism="Lactuca sativa" /mol_type="mRNA" /db_xref="taxon:4236" CDS <1..>948 /note="HSK; 431559" /codon_start=1 /product="homoserine kinase" /protein_id="AIU48469.1" /translation="EPEPVYTAVKSFAPATVANLGPGFDFLGCAVDGIGDYVTLKIDP QVHPGEVSITEITKLSKNPIWNCAGIAAISVMKMLNIRSVGLSLSLEKGLPLGSGLGS SAASAAAAAIA VNEIFGGKLPALDLVLAGLESEAKVSGYHADNIAPAIMGGFVLVRSY DPLELIPLQFPVDKNLYFVLVNPEFEAPTKKMRAALPKEITMSHHVWNSSQAGALVAA VLQGDLKGFGKALSSDKIVEPRRAPLIPGMDAVKKAALEAGAYGCTISGAGPTAVAVT DNEEKGREIGEKMVEAFMAEGNLKAVAMVKQLDRVGARLV" Alignment Scores: Length: 948 Score: 1576.50 Matches: 316 Percent Similarity: 97.8% Conservative: 0 Best Local Similarity: 97.8% Mismatches: 0 Query Match: 83.3% Indels: 7 DB: 536 Gaps: 1 US-17-283-877-1 (1-373) x KM397806 (1-948) Qy 46 GluProGluProValTyrThrAlaValLysSerPheAlaProAlaThrValAlaAsnLeu 65 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 GAACCCGAACCCGTTTACACCGCCGTCAAGTCATTCGCCCCCGCCACCGTAGCCAACCTC 60 Qy 66 GlyProGlyPheAspPheLeuGlyCysAlaValAspGlyIleGlyAspTyrValThrLeu 85 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 GGCCCTGGGTTTGACTTTCTCGGTTGCGCAGTCGACGGGATCGGAGACTATGTCACCCTC 120 Qy 86 LysIleAspProGlnValHisProGlyGluValSerIleThrGluIleThrGlyThrGly 105 ||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 AAAATCGACCCCCAAGTTCACCCTGGCGAGGTCTCAATCACCGAAATCACC--------- 171 Qy 106 AsnSerAlaAsnLysLeuSerLysAsnProIleTrpAsnCysAlaGlyIleAlaAlaIle 125 |||||||||||||||||||||||||||||||||||||||||||||||| Db 172 ------------AAGCTCAGCAAAAACCCTATTTGGAATTGCGCTGGTATTGCCGCCATT 219 Qy 126 SerValMetLysMetLeuAsnIleArgSerValGlyLeuSerLeuSerLeuGluLysGly 145 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 220 TCCGTCATGAAGATGCTCAACATCCGATCCGTCGGCCTCTCTCTATCTCTAGAAAAGGGT 279 Qy 146 LeuProLeuGlySerGlyLeuGlySerSerAlaAlaSerAlaAlaAlaAlaAlaIleAla 165 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 280 CTCCCCCTCGGAAGCGGTCTCGGTTCCAGCGCCGCTAGTGCCGCCGCCGCGGCAATCGCC 339 Qy 166 ValAsnGluIlePheGlyGlyLysLeuProAlaLeuAspLeuValLeuAlaGlyLeuGlu 185 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 340 GTTAATGAGATTTTTGGTGGAAAGTTACCTGCATTGGATTTAGTCCTCGCAGGGCTTGAA 399 Qy 186 SerGluAlaLysValSerGlyTyrHisAlaAspAsnIleAlaProAlaIleMetGlyGly 205 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 400 TCGGAAGCTAAAGTATCCGGATACCACGCTGATAACATTGCGCCGGCAATCATGGGTGGT 459 Qy 206 PheValLeuValArgSerTyrAspProLeuGluLeuIleProLeuGlnPheProValAsp 225 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 460 TTCGTTCTCGTTCGGAGCTACGATCCTTTAGAGCTGATTCCGTTGCAGTTTCCGGTCGAC 519 Qy 226 LysAsnLeuTyrPheValLeuValAsnProGluPheGluAlaProThrLysLysMetArg 245 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 520 AAAAACCTCTATTTCGTCTTGGTGAATCCGGAATTCGAAGCGCCGACGAAGAAGATGAGG 579 Qy 246 AlaAlaLeuProLysGluIleThrMetSerHisHisValTrpAsnSerSerGlnAlaGly 265 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 580 GCGGCGTTACCAAAAGAGATAACAATGTCGCACCATGTATGGAACAGTAGTCAAGCAGGT 639 Qy 266 AlaLeuValAlaAlaValLeuGlnGlyAspLeuLysGlyPheGlyLysAlaLeuSerSer 285 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 640 GCCTTGGTGGCGGCGGTGTTGCAGGGGGATTTGAAGGGGTTTGGAAAGGCGTTGTCTTCT 699 Qy 286 AspLysIleValGluProArgArgAlaProLeuIleProGlyMetAspAlaValLysLys 305 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 700 GATAAGATAGTGGAGCCGAGGAGGGCGCCATTGATTCCGGGAATGGATGCTGTGAAGAAG 759 Qy 306 AlaAlaLeuGluAlaGlyAlaTyrGlyCysThrIleSerGlyAlaGlyProThrAlaVal 325 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 760 GCTGCACTTGAGGCAGGGGCTTATGGGTGTACGATCAGTGGAGCAGGGCCAACTGCGGTG 819 Qy 326 AlaValThrAspAsnGluGluLysGlyArgGluIleGlyGluLysMetValGluAlaPhe 345 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 820 GCTGTTACAGATAACGAGGAAAAAGGGAGGGAGATTGGGGAGAAGATGGTGGAAGCTTTC 879 Qy 346 MetAlaGluGlyAsnLeuLysAlaValAlaMetValLysGlnLeuAspArgValGlyAla 365 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 880 ATGGCGGAAGGAAATTTGAAAGCTGTGGCTATGGTGAAGCAATTGGACAGAGTTGGTGCT 939 Qy 366 ArgLeuVal 368 ||||||||| Db 940 AGACTTGTT 948 SEQ ID NO: 1 with multiple of substitutions RESULT 7 US-12-092-253-101 (US 8, 237, 019) ; Sequence 101, Application US/12092253 ; APPLICANT:van den Ackerveken, Augustinus Franciscus Johannes ; APPLICANT:van Damme, Mireille Maria Augusta ; TITLE OF INVENTION: DISEASE RESISTANT PLANTS ; PRIOR FILING DATE: 2005-11-01 ; SEQ ID NO 101 ; LENGTH: 1128 ; TYPE: DNA ; ORGANISM: Lactuca sativa US-12-092-253-101 Alignment Scores: Length: 1128 Score: 1362.50 Matches: 267 Percent Similarity: 86.6% Conservative: 57 Best Local Similarity: 71.4% Mismatches: 47 Query Match: 75.2% Indels: 3 DB: 34 Gaps: 2 US-17-283-877-1MULTISUBX (1-373) x US-12-092-253-101 (1-1128) Qy 1 MetAlaIleCysHisHisHisGlnProSerPheThrIleProSerSerPheProPheThr 20 ||||||||| |||:::|||||| ||| |||||| ::: Db 1 ATGGCAATT---CGCCATTATCAACCTCCATTCGCCTCCACTTCTTCTTCTATCTCTAGT 57 Qy 21 ThrAsnLeuSerAsnLysSerGlnLeuHisLeuProSerSerPheArgCysAsnLeuSer 40 |||:::||| :::|||:::||| |||||| |||||||||:::||| Db 58 ACAGATTTATTCAAACCCCCTAAACTTTATCTTTCATCGTCTGTCCGGTGCAACATCTCC 117 Qy 41 ValThrThrAsnLeuGluProGlu------ProValTyrThrAlaValLysSerPheAla 58 ||| ::: |||||||||||| ||||||:::|||:::||||||||||||||| Db 118 GTCGCTTCCAAACTGGAACCCGAACCTCATCCAGTTTTCACCTCCGTTAAGTCATTCGCC 177 Qy 59 ProAlaThrValAla***LeuGlyProGlyPhe***PheLeuGlyCysAlaValAspGly 78 |||||||||||||||:::|||||||||||||||:::|||||||||||||||:::|||||| Db 178 CCCGCCACCGTAGCCAACCTCGGGCCTGGTTTCGACTTCCTCGGCTGCGCAATCGACGGC 237 Qy 79 IleGlyAspTyrValThrLeuLysIleAspProGlnValHisProGlyGluValSerIle 98 ||||||||||||||||||||| :::|||||||||||| |||||| :::|||||| Db 238 ATCGGAGATTACGTTACCCTCACAGTCGACCCCCAAGTCCAACCCGGCAGATTATCAATT 297 Qy 99 ThrGluIleThrGlyThrGlyAsnSerAlaAsnLysLeuSerLysAsnProIleTrp*** 118 |||||| ||| |||::: :::||||||:::||||||:::|||::: Db 298 GCAGAAATCAACGGCGTTGACAAGTCTTCCAAGAGGCTCAGCAGAAACCCTCTATGGAAT 357 Qy 119 ***AlaGlyIleAlaAlaIleSerValMetLysMetLeuAsnIleArgSerValGlyLeu 138 :::|||||||||||||||||||||||||||||||||||| |||||||||||||||||| Db 358 TGCGCCGGAATTGCTGCAATCTCCGTCATGAAGATGCTCAAGATCCGATCCGTTGGTCTC 417 Qy 139 SerLeuSerLeuGlu***GlyLeuProLeu***Ser***************AlaAla*** 158 |||||||||::: ::: |||||||||::: :::::::::::::::||||||::: Db 418 TCTTTATCCATCAATACATGTCTCCCCCTTCGAGGCGGCCTAGGCTCCAGCGCCGCTAGC 477 Qy 159 AlaAlaAlaAlaAlaIleAlaValAsnGluIlePheGlyGlyLysLeuProAlaLeuAsp 178 |||||||||||||||:::|||||||||||||||||||||||||||||| ||| Db 478 GCTGCCGCCGCCGCCGTTGCGGTTAATGAGATTTTCGGAGGGAAGTTACATGATTCCGAT 537 Qy 179 LeuValLeuAlaGlyLeuGluSerGluAlaLysValSerGlyTyrHisAla******Ile 198 |||:::|||||||||||||||:::|||||||||:::|||||||||||||||::::::||| Db 538 TTGATACTCGCGGGGCTCGAAGCTGAAGCGAAGTTATCCGGTTATCACGCCGATAACATT 597 Qy 199 AlaProAlaIleMetGlyGlyPheValLeuValArgSerTyrAspProLeuGluLeuIle 218 ||||||||||||||||||||||||||||||:::||||||||||||||||||||||||||| Db 598 GCTCCGGCGATCATGGGCGGGTTTGTGTTGATCAGAAGCTACGATCCATTAGAGTTGATC 657 Qy 219 ProLeuGlnPheProValAspLysAsnLeuTyrPheValLeuValAsnProGluPheGlu 238 |||:::|||||| :::|||||||||:::||||||||||||||||||||||||::: Db 658 TCCTTGAAGTTTCCACCGGAAAAGAATCTGTTTTTCGTGTTGGTGAATCCTGAATTCCAA 717 Qy 239 AlaPro***LysLysMet***AlaAlaLeuProLysGluIleThrMetSerHisHisVal 258 ||| :::|||||||||:::||| |||||| ||||||||||||||| |||||| Db 718 GCACAAACGAAGAAGATGAGGGCGGTTCTACCGACGGAGATAACAATGTCGGATCATGTA 777 Qy 259 TrpAsnSerSerGlnAlaGlyAlaLeuValAlaAlaValLeuGlnGlyAspLeuLysGly 278 |||||| ||||||||| |||||||||||| |||||||||||||||||| ||| Db 778 TGGAATTGTAGTCAGGCGGCGGCGTTGGTGGCAGGCGTATTGCAGGGGGATTTGGTGGGG 837 Qy 279 PheGlyLysAlaLeuSerSerAspLysIleValGluProArg***AlaProLeuIlePro 298 ||||||||||||||||||||||||:::|||||||||||||||:::|||||||||:::||| Db 838 TTTGGGAAGGCATTGTCATCGGATAGAATAGTGGAGCCACGGCGGGCGCCATTGCTTCCG 897 Qy 299 GlyMetAspAlaValLysLysAlaAlaLeuGluAlaGlyAlaTyrGlyCysThrIleSer 318 ||||||::: |||||||||||||||:::|||||||||||||||||||||||||||||| Db 898 GGAATGGAAGATGTGAAGAAGGCAGCAATGGAAGCAGGGGCATATGGGTGTACGATAAGT 957 Qy 319 Gly***GlyProThrAlaValAlaValThrAspAsnGluGluLysGlyArgGluIleGly 338 |||:::||||||||| |||||||||||||||:::|||::::::||||||||||||||| Db 958 GGGTCAGGGCCGACGGTGGTGGCGGTGACGGATGATGAAGATAGAGGGAGGGAGATCGGG 1017 Qy 339 GluLysMetValGluAlaPheMetAlaGluGlyAsnLeuLysAlaValAlaMetValLys 358 |||||||||||||||||||||::: :::||| |||||||||:::|||||||||||| Db 1018 GAGAAGATGGTGGAAGCTTTTGTAGAGAAGGGAAAGTTGAAAGCTTTGGCTATGGTGAAG 1077 Qy 359 GlnLeuAspArgValGlyAlaArgLeuValSerSerIleSer 372 :::|||||||||||||||||||||::::::||| |||||| Db 1078 AAACTGGACAGAGTTGGTGCTAGAGTTATCAGTCGTATCTCC 1119 RESULT 5 US-12-092-253-101 ; Sequence 101, Application US/12092253 ; Patent No. 8237019 ; GENERAL INFORMATION ; APPLICANT: UNIVERSITEIT UTRECHT HOLDING B.V. ; APPLICANT:van den Ackerveken, Augustinus Franciscus Johannes ; APPLICANT:van Damme, Mireille Maria Augusta ; TITLE OF INVENTION: DISEASE RESISTANT PLANTS ; PRIOR FILING DATE: 2005-11-01 ; NUMBER OF SEQ ID NOS: 110 ; SOFTWARE: PatentIn version 3.3 ; SEQ ID NO 101 ; LENGTH: 1128 ; TYPE: DNA ; ORGANISM: Lactuca sativa US-12-092-253-101 Alignment Scores: Length: 1128 Score: 1363.70 Matches: 267 Percent Similarity: 86.6% Conservative: 57 Best Local Similarity: 71.4% Mismatches: 47 Query Match: 75.2% Indels: 3 DB: 28 Gaps: 2 US-17-283-877-1MULTISUBX (1-373) x US-12-092-253-101 (1-1128) Qy 1 MetAlaIleCysHisHisHisGlnProSerPheThrIleProSerSerPheProPheThr 20 ||||||||| |||:::|||||| ||| |||||| ::: Db 1 ATGGCAATT---CGCCATTATCAACCTCCATTCGCCTCCACTTCTTCTTCTATCTCTAGT 57 Qy 21 ThrAsnLeuSerAsnLysSerGlnLeuHisLeuProSerSerPheArgCysAsnLeuSer 40 |||:::||| :::|||:::||| |||||| |||||||||:::||| Db 58 ACAGATTTATTCAAACCCCCTAAACTTTATCTTTCATCGTCTGTCCGGTGCAACATCTCC 117 Qy 41 ValThrThrAsnLeuGluProGlu------ProValTyrThrAlaValLysSerPheAla 58 ||| ::: |||||||||||| ||||||:::|||:::||||||||||||||| Db 118 GTCGCTTCCAAACTGGAACCCGAACCTCATCCAGTTTTCACCTCCGTTAAGTCATTCGCC 177 Qy 59 ProAlaThrValAla***LeuGlyProGlyPhe***PheLeuGlyCysAlaValAspGly 78 |||||||||||||||:::|||||||||||||||:::|||||||||||||||:::|||||| Db 178 CCCGCCACCGTAGCCAACCTCGGGCCTGGTTTCGACTTCCTCGGCTGCGCAATCGACGGC 237 Qy 79 IleGlyAspTyrValThrLeuLysIleAspProGlnValHisProGlyGluValSerIle 98 ||||||||||||||||||||| :::|||||||||||| |||||| :::|||||| Db 238 ATCGGAGATTACGTTACCCTCACAGTCGACCCCCAAGTCCAACCCGGCAGATTATCAATT 297 Qy 99 ThrGluIleThrGlyThrGlyAsnSerAlaAsnLysLeuSerLysAsnProIleTrp*** 118 |||||| ||| |||::: :::||||||:::||||||:::|||::: Db 298 GCAGAAATCAACGGCGTTGACAAGTCTTCCAAGAGGCTCAGCAGAAACCCTCTATGGAAT 357 Qy 119 ***AlaGlyIleAlaAlaIleSerValMetLysMetLeuAsnIleArgSerValGlyLeu 138 :::|||||||||||||||||||||||||||||||||||| |||||||||||||||||| Db 358 TGCGCCGGAATTGCTGCAATCTCCGTCATGAAGATGCTCAAGATCCGATCCGTTGGTCTC 417 Qy 139 SerLeuSerLeuGlu***GlyLeuProLeu***Ser***************AlaAla*** 158 |||||||||::: ::: |||||||||::: :::::::::::::::||||||::: Db 418 TCTTTATCCATCAATACATGTCTCCCCCTTCGAGGCGGCCTAGGCTCCAGCGCCGCTAGC 477 Qy 159 AlaAlaAlaAlaAlaIleAlaValAsnGluIlePheGlyGlyLysLeuProAlaLeuAsp 178 |||||||||||||||:::|||||||||||||||||||||||||||||| ||| Db 478 GCTGCCGCCGCCGCCGTTGCGGTTAATGAGATTTTCGGAGGGAAGTTACATGATTCCGAT 537 Qy 179 LeuValLeuAlaGlyLeuGluSerGluAlaLysValSerGlyTyrHisAla******Ile 198 |||:::|||||||||||||||:::|||||||||:::|||||||||||||||::::::||| Db 538 TTGATACTCGCGGGGCTCGAAGCTGAAGCGAAGTTATCCGGTTATCACGCCGATAACATT 597 Qy 199 AlaProAlaIleMetGlyGlyPheValLeuValArgSerTyrAspProLeuGluLeuIle 218 ||||||||||||||||||||||||||||||:::||||||||||||||||||||||||||| Db 598 GCTCCGGCGATCATGGGCGGGTTTGTGTTGATCAGAAGCTACGATCCATTAGAGTTGATC 657 Qy 219 ProLeuGlnPheProValAspLysAsnLeuTyrPheValLeuValAsnProGluPheGlu 238 |||:::|||||| :::|||||||||:::||||||||||||||||||||||||::: Db 658 TCCTTGAAGTTTCCACCGGAAAAGAATCTGTTTTTCGTGTTGGTGAATCCTGAATTCCAA 717 Qy 239 AlaPro***LysLysMet***AlaAlaLeuProLysGluIleThrMetSerHisHisVal 258 ||| :::|||||||||:::||| |||||| ||||||||||||||| |||||| Db 718 GCACAAACGAAGAAGATGAGGGCGGTTCTACCGACGGAGATAACAATGTCGGATCATGTA 777 Qy 259 TrpAsnSerSerGlnAlaGlyAlaLeuValAlaAlaValLeuGlnGlyAspLeuLysGly 278 |||||| ||||||||| |||||||||||| |||||||||||||||||| ||| Db 778 TGGAATTGTAGTCAGGCGGCGGCGTTGGTGGCAGGCGTATTGCAGGGGGATTTGGTGGGG 837 Qy 279 PheGlyLysAlaLeuSerSerAspLysIleValGluProArg***AlaProLeuIlePro 298 ||||||||||||||||||||||||:::|||||||||||||||:::|||||||||:::||| Db 838 TTTGGGAAGGCATTGTCATCGGATAGAATAGTGGAGCCACGGCGGGCGCCATTGCTTCCG 897 Qy 299 GlyMetAspAlaValLysLysAlaAlaLeuGluAlaGlyAlaTyrGlyCysThrIleSer 318 ||||||::: |||||||||||||||:::|||||||||||||||||||||||||||||| Db 898 GGAATGGAAGATGTGAAGAAGGCAGCAATGGAAGCAGGGGCATATGGGTGTACGATAAGT 957 Qy 319 Gly***GlyProThrAlaValAlaValThrAspAsnGluGluLysGlyArgGluIleGly 338 |||:::||||||||| |||||||||||||||:::|||::::::||||||||||||||| Db 958 GGGTCAGGGCCGACGGTGGTGGCGGTGACGGATGATGAAGATAGAGGGAGGGAGATCGGG 1017 Qy 339 GluLysMetValGluAlaPheMetAlaGluGlyAsnLeuLysAlaValAlaMetValLys 358 |||||||||||||||||||||::: :::||| |||||||||:::|||||||||||| Db 1018 GAGAAGATGGTGGAAGCTTTTGTAGAGAAGGGAAAGTTGAAAGCTTTGGCTATGGTGAAG 1077 Qy 359 GlnLeuAspArgValGlyAlaArgLeuValSerSerIleSer 372 :::|||||||||||||||||||||::::::||| |||||| Db 1078 AAACTGGACAGAGTTGGTGCTAGAGTTATCAGTCGTATCTCC 1119. Double Patenting The nonstatutory double patenting rejection is based on a judicially created doctrine grounded in public policy (a policy reflected in the statute) so as to prevent the unjustified or improper timewise extension of the “right to exclude” granted by a patent and to prevent possible harassment by multiple assignees. A nonstatutory double patenting rejection is appropriate where the conflicting claims are not identical, but at least one examined application claim is not patentably distinct from the reference claim(s) because the examined application claim is either anticipated by, or would have been obvious over, the reference claim(s). See, e.g., In re Berg, 140 F.3d 1428, 46 USPQ2d 1226 (Fed. Cir. 1998); In re Goodman, 11 F.3d 1046, 29 USPQ2d 2010 (Fed. Cir. 1993); In re Longi, 759 F.2d 887, 225 USPQ 645 (Fed. Cir. 1985); In re Van Ornum, 686 F.2d 937, 214 USPQ 761 (CCPA 1982); In re Vogel, 422 F.2d 438, 164 USPQ 619 (CCPA 1970); In re Thorington, 418 F.2d 528, 163 USPQ 644 (CCPA 1969). A timely filed terminal disclaimer in compliance with 37 CFR 1.321(c) or 1.321(d) may be used to overcome an actual or provisional rejection based on nonstatutory double patenting provided the reference application or patent either is shown to be commonly owned with the examined application, or claims an invention made as a result of activities undertaken within the scope of a joint research agreement. See MPEP § 717.02 for applications subject to examination under the first inventor to file provisions of the AIA as explained in MPEP § 2159. See MPEP § 2146 et seq. for applications not subject to examination under the first inventor to file provisions of the AIA . A terminal disclaimer must be signed in compliance with 37 CFR 1.321(b). The filing of a terminal disclaimer by itself is not a complete reply to a nonstatutory double patenting (NSDP) rejection. A complete reply requires that the terminal disclaimer be accompanied by a reply requesting reconsideration of the prior Office action. Even where the NSDP rejection is provisional the reply must be complete. See MPEP § 804, subsection I.B.1. For a reply to a non-final Office action, see 37 CFR 1.111(a). For a reply to final Office action, see 37 CFR 1.113(c). A request for reconsideration while not provided for in 37 CFR 1.113(c) may be filed after final for consideration. See MPEP §§ 706.07(e) and 714.13. The USPTO Internet website contains terminal disclaimer forms which may be used. Please visit www.uspto.gov/patent/patents-forms. The actual filing date of the application in which the form is filed determines what form (e.g., PTO/SB/25, PTO/SB/26, PTO/AIA /25, or PTO/AIA /26) should be used. A web-based eTerminal Disclaimer may be filled out completely online using web-screens. An eTerminal Disclaimer that meets all requirements is auto-processed and approved immediately upon submission. For more information about eTerminal Disclaimers, refer to www.uspto.gov/patents/apply/applying-online/eterminal-disclaimer. Claims 1-7 and 11-15 are rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1-13 of U.S. Patent No. 11, 952, 583. Although the claims at issue are not identical, they are not patentably distinct from each other because the claims of both the application and the issued patent are drawn to a cultivated lettuce plant/seed/leaf/head comprising a mutant allele encoding a mutant homoserine kinase with specific mutations relative to the wild type homoserine kinase protein of SEQ ID NO: 1, and a method generating said cultivated Lactuca sativa plant/seed/leaf/head. The claims of the instant application are broader in scope than the claims of the issued patent. Claims 1-2, 5-7, 11-13 and 15 of the instant application do not require specific amino acid mutations. Claims 3, 5 and 14 recite specific amino acid replacement but also require further mutation with any different amino acid or an amino acid located 1, 2, 3 or 4 positions before or after said amino acids being replaced by a different amino acid. Therefore, the claims of the instant application are genus claims encompassing the claims of the issued patent. Conclusion No claim is allowed. Contact Information Any inquiry concerning this communication or earlier communications from the examiner should be directed to MEDINA AHMED IBRAHIM whose telephone number is (571)272-0797. The examiner can normally be reached Monday-Friday, 9:00 - 6:00. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, BRATISLAV STANKOVIC can be reached at 571-270-0305. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. MEDINA AHMED. IBRAHIM Primary Examiner Art Unit 1662 /MEDINA A IBRAHIM/Primary Examiner, Art Unit 1662
Read full office action

Prosecution Timeline

Mar 06, 2024
Application Filed
Mar 27, 2026
Non-Final Rejection — §103, §112, §DP (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12595502
Method and System for Selectively Harvesting Products from Plant Cells in Culture
2y 5m to grant Granted Apr 07, 2026
Patent 12593766
METHODS FOR GENERATING PLANTS PRODUCING SEEDS HAVING ALTERED SEED COMPOSITION
2y 5m to grant Granted Apr 07, 2026
Patent 12593775
PLANTS AND SEEDS OF HYBRID CORN VARIETY CH010483
2y 5m to grant Granted Apr 07, 2026
Patent 12593777
PLANTS AND SEEDS OF CORN VARIETY CV606439
2y 5m to grant Granted Apr 07, 2026
Patent 12593778
PLANTS AND SEEDS OF HYBRID CORN VARIETY CH010532
2y 5m to grant Granted Apr 07, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

AI Strategy Recommendation

Get an AI-powered prosecution strategy using examiner precedents, rejection analysis, and claim mapping.
Powered by AI — typically takes 5-10 seconds

Prosecution Projections

1-2
Expected OA Rounds
88%
Grant Probability
99%
With Interview (+11.8%)
2y 5m
Median Time to Grant
Low
PTA Risk
Based on 1452 resolved cases by this examiner. Grant probability derived from career allow rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month