Prosecution Insights
Last updated: October 02, 2026
Application No. 18/701,456

Insect Toxin Delivery Mediated by a Begomovirus Coat Protein

Final Rejection §103§DP
Filed
Apr 15, 2024
Priority
Oct 19, 2021 — provisional 63/257,280 +2 more
Examiner
CHATTERJEE, JAYANTA
Art Unit
1662
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
University of Florida Research Foundation Inc.
OA Round
4 (Final)
46%
Grant Probability
Moderate
5-6
OA Rounds
1m
Est. Remaining
99%
With Interview

Examiner Intelligence

Grants 46% of resolved cases
46%
Career Allowance Rate
10 granted / 22 resolved
-14.5% vs TC avg
Strong +80% interview lift
Without
With
+80.0%
Interview Lift
resolved cases with interview
Typical timeline
2y 7m
Avg Prosecution
54 currently pending
Career history
82
Total Applications
across all art units

Statute-Specific Performance

§101
3.6%
-36.4% vs TC avg
§103
41.9%
+1.9% vs TC avg
§102
17.2%
-22.8% vs TC avg
§112
29.6%
-10.4% vs TC avg
Black line = Tech Center average estimate • Based on career data from 22 resolved cases

Office Action

§103 §DP
DETAILED ACTION Notice of Pre-AIA or AIA Status The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Claim Status Claims 1, 3-4, 6, 8-12, 15, 17, 20, 22 and 26-27 are pending and being examined. All previous objections and rejections not set forth below have been withdrawn in view of applicant’s amendments to the claims. Claim Rejections - 35 USC § 103 Claims 1, 6, 8-10, 15, 17, and 26-27 are rejected under 35 U.S.C. 103 as being unpatentable over Bonning et al. (US 20190239513 A1) in view of Zhao et al. (Implication of whitefly vesicle associated membrane protein-associated protein B in the transmission of Tomato yellow leaf curl virus, 2019, Virology 535:210–217). Due to applicant’s amendments, the rejection is modified from the rejection set forth on pages 8-19 in the Office action dated 05/30/2025. Claim 1 is drawn to a fusion protein comprising a carrier protein attached to an insect-specific toxin via a peptide linker, wherein the carrier protein is a Tomato yellow leaf curl virus coat protein (TYLCV-CP). Bonning et al. describes a fusion protein comprising a protease-resistant linker (page 13, para 0121) (as recited in claim 6) fused with Junonia coenia densovirus (JcDNV) coat protein (JcDNV CP) and an insect-specific toxin (page 13, para 0123) including insect-specific neurotoxin (page 13, para 0118, line 19-20) (as recited in claim 8) for controlling its target insect pest, fall armyworm (Spodoptera frugiperda) (abstract). It also describes that the protease-resistant linker ensures that the fusion protein is transported into hemocoel as an intact fusion protein comprising the insect specific toxin (page 13, para 0123). Bonning et al. teaches that for intrahemocoelic proteins such as the coat protein of an insect vectored plant virus can be used to deliver toxins into the hemocoel (page 11, para 0111). It describes a method to control insect pest by expressing toxic proteins with insecticidal activity comprising Hv1a protein (as recited in claim 10) fused with JcDNV CP using a protease resistant linker comprising SEQ ID NO: 4 (page 13, para 119). However, Bonning et al. does not explicitly teach a TYLCV CP. Zhao et al. describes a fusion protein comprising a TYLCV CP fused with GST protein via a peptide linker (page 212, left column, para 2). Zhao et al. describes that TYLCV CP is the only structural protein known to be involved in the virus transmission (page 1, right column, para 2). Once acquired orally by its insect vector, whitefly (Bemisia tabaci) (as recited in claim 27), TYLCV CP follows a sequential path of stylet-midgut-haemolymph-salivary gland, and in this journey inside whitefly, virus has to cross two major physiological barriers, namely midgut and salivary gland, to be transmitted successfully by the insect vector (page 1, left column, para 1; Fig. 5), implying that TYLCV CP has the ability to pass across the gut epithelium and moves into the hemocoel of the target insect (whitefly), as recited in claim 26. Before the effective filing date, it would have been obvious to an ordinarily skilled artisan to modify the method as described by Bonning et al. by replacing JcDNV CP in the fusion protein wherein the fusion protein comprises a protease resistant linker fusing an insect-specific neurotoxin (as taught by Bonning et al.) with the TYLCV CP (as taught by Zhao et al.) with a realistic goal to control target insect pest (whitefly). TYLCV CP is shown to be capable to reach the gut (and hemocoel in the gut) of its target insect pest, whiteflies; just like the JcDNV CP which is capable to reach the gut of its target insect pest, fall army worm. Before the effective filing date, an ordinarily skilled artisan would have been motivated to express a fusion protein comprising TYLCV CP fused with an insect-specific neurotoxin via an protease resistant linker in a plant with a realistic goal to control target insect pests by enabling the fusion protein comprising the TYLCV CP and the insect-specific toxin protein to pass across the gut epithelium and moves into the hemocoel of the target insect pest. Regarding claim 6, Bonning et al. describes a protease-resistant linker consisting of SEQ ID NO: 4 (page 13, para 119). Translating the nucleotide sequence of instant SEQ ID NO: 3 would give rise to the following sequence: GDDAPPSPGPDPGPQPPPPPPPSPTPVG. Sequence alignment of the said polypeptide sequence and SEQ ID NO: 4 of Bonning et al. shows 100% identity, as shown below. Title: AASEQ1_04302025_130720 Perfect score: 173 Sequence: 1 GDDAPPSPGPDPGPQPPPPPPPSPTPVG 28 Database : AASEQ2_04302025_130720.pep:* RESULT 1 AASEQ2_04302025_130720 Query Match 100.0%; Score 173; Length 32;Indels 0; Gaps 0; Best Local Similarity 100.0%; Matches 28; Conservative 0; Mismatches 0; Qy 1 GDDAPPSPGPDPGPQPPPPPPPSPTPVG 28 |||||||||||||||||||||||||||| Db 1 GDDAPPSPGPDPGPQPPPPPPPSPTPVG 28 Thus, instant SEQ ID NO: 3 encodes the polypeptide set forth by SEQ ID NO: 4 of Bonning et al., and they are functional equivalents. Regarding instant claim 9, Bonning et al. describes an arthropod-derived neuropeptide, enzyme or hormone (page 13, para 0120, line 9-10). Regarding claims 15 and 17, Bonning et al. describes several vectors (page 24, para 0227) comprising an expression cassette consisting of various promoters comprising plant expressible constitutive promoters including cauliflower mosaic virus (CaMV), NOS promoter and ubiquitin promoter (page 22, para 0215, line 10-12). Claims 3-4, 11-12, 20 and 22 are rejected under 35 U.S.C. 103 as being unpatentable over Bonning et al. in view of Zhou et al. as applied to claims 1, 6, 8-10, 15, 17 and 26-27 above, and further in view of Fluentes et al. (Field Trial and Molecular Characterization of RNAi-Transgenic Tomato Plants That Exhibit Resistance to Tomato Yellow Leaf Curl Geminivirus, 2016, MPMI, 29:197–209) and in evidence of Liao et al. (Removal of N-terminal methionine from recombinant proteins by engineered E. coli methionine aminopeptidase, 2004, Protein Sci., 13:1802–1810). Claims 3-4 depend from claim 1. Claim 3 is drawn to the fusion protein of claim 1, wherein the coat protein comprises the amino acid sequence set forth in SEQ ID NO: 2. Claim 4 is drawn to coat protein encoded by a nucleotide sequence set forth in SEQ ID NO: 1 encoding the said coat protein. Bonning et al. in view of Zhao et al. describes a fusion protein comprising a TYLCV CP, a protease resistant linker, and an insect specific toxin, as described above. However, Bonning et al. in view of Zhao et al. do not describe instant SEQ ID NOs: 1-2. Fuentes et al. describes a nucleotide sequence comprising 100% sequence identity to instant SEQ ID NO: 1 and encoding a TYLCV CP consisting of SEQ ID NO: 2, as shown below. The TYLCV CP polypeptide sequence is highlighted in grey. RESULT 1 KM926626 LOCUS KM926626 2781 bp DNA linear VRL 21-FEB-2018 DEFINITION Tomato yellow leaf curl virus isolate Cuba C2+, complete genome. ACCESSION KM926626 VERSION KM926626.1 SOURCE Tomato yellow leaf curl virus (TYLCV) ORGANISM Tomato yellow leaf curl virus Viruses; Monodnaviria; Shotokuvirae; Cressdnaviricota; Repensiviricetes; Geplafuvirales; Geminiviridae; Begomovirus. REFERENCE 1 (bases 1 to 2781) AUTHORS Fuentes,A., Carlos,N., Ruiz,Y., Callard,D., Sanchez,Y., Ochagavia,M.E., Seguin,J., Malpica-Lopez,N., Hohn,T., Lecca,M.R., Perez,R., Doreste,V., Rehrauer,H., Farinelli,L., Pujol,M. and Pooggin,M.M. TITLE Field Trial and Molecular Characterization of RNAi-Transgenic Tomato Plants That Exhibit Resistance to Tomato Yellow Leaf Curl Geminivirus JOURNAL Mol. Plant Microbe Interact. 29 (3), 197-209 (2016) PUBMED 26713353 REFERENCE 2 (bases 1 to 2781) AUTHORS Fuentes,A. and Pooggin,M.M. TITLE Direct Submission JOURNAL Submitted (14-OCT-2014) Department of Environmental Sciences, Botany, University of Basel, Hebelstrasse 1, Basel, BaselStadt 4056, Switzerland FEATURES Location/Qualifiers source 1..2781 /organism="Tomato yellow leaf curl virus" /mol_type="genomic DNA" /isolate="Cuba C2+" /isolation_source="symptomatic young leaf of the tomato plant" /host="Solanum lycopersicum cv. Campbell-28" /db_xref="taxon:10832" /geo_loc_name="Cuba: open field near Havana" /collection_date="20-Sep-2011" gene 148..498 /gene="V2" CDS 148..498 /gene="V2" /codon_start=1 /product="pre-coat protein" /protein_id="AJG06153.1" /translation="MWDPLLNEFPESVHGFRCMLAIKYLQSVEETYEPNTLGHDLIRD LISVVRARDYVEATRRYNHFHARLEGSPKAELRQPIQQPCCCPHCPRHKQATIMDVQA HVPKAQNIQNVSKP" gene 308..1084 /gene="V1" CDS 308..1084 /gene="V1" /codon_start=1 /product="coat protein" /protein_id="AJG06154.1" /translation="MSKRPGDIIISTPVSKVRRRLNFDSPYSNRAAVPIVQGTNKRRS WTYRPMYRKPRIYRMYRSPDVPRGCEGPCKVQSYEQRDDIKHTGVVRCVSDVTRGSGI THRVGKRFCVKSIYFLGKVWMDENIKKQNHTNQVMFFLVRDRRPYGSSPMDFGQVFNM FDNEPSTATVKNDLRDRFQVMRKFHATVIGGPSGMKEQALVKRFFKINSHVTYNHQEA AKYENHTENALLLYMACTHASNPVYATMKIRIYFYDSISN" gene complement(1081..1485) /gene="C3" CDS complement(1081..1485) /gene="C3" /note="REn" /codon_start=1 /product="replication enhancer" /protein_id="AJG06155.1" /translation="MDSRTGELITAPQAENGVFIWEIINPLYFKITDHSQRPFLMNHD IISIQIRFNHNIRKVMGIHKCFLNFRIWTTLQPQTGRFLRVFRYQVLKYLDSLGVISI NNVIRAVDHVLYDVLENTINVTEAHDIKYKFY" gene complement(1226..1633) /gene="C2" CDS complement(1226..1633) /gene="C2" /codon_start=1 /product="transcriptional transactivator" /protein_id="AJG06156.1" /translation="MQPSSPSTSHCSQVSIKVQHKIAKKKPIRRKRVDLDCGCSYYLH LNCNNHGFTHRGTHHCSSGREWRFYLGDNQSPLFQDNRPQPEAISNEPRHHFHSDKIQ PQYQEGNGDSQMFSQLPNLDDITASDWSFLKSI" gene complement(1542..2615) /gene="C1" CDS complement(1542..2615) /gene="C1" /codon_start=1 /product="replication initiator protein" /protein_id="AJG06157.1" /translation="MPRLFKIYAKNYFLTYPNCSLSKEEALSQLQNLETPTNKKYIKV CREFHENGEPHLHVLIQFEGKYQCKNQRFFDLVSPTRSAHFHPNIQAAKSSTDVKTYV EKDGDYIDFGVFQIDGRSARGGQQSANDAYAEALNSGSKSEALNILKEKAPKDYILQF HNLSSNLDRIFSPPLEVYVSPFLSSSFNQVPDELEEWVAENVVSSAARPWRPRSIVIE GDSRTGKTMWARSLGPHNYLCGHLDLSPKVYSNDAWYNVIDDVDPHYLKHFKEFMGAQ RDWQSNTKYGKPIQIKGGIPTIFLCNPGPTSSYREYLDEEKNISLKNWALKNATFVTL YEPLFASINQGPTQDSQEETNKA" gene complement(2171..2464) /gene="C4" CDS complement(2171..2464) /gene="C4" /codon_start=1 /product="C4" /protein_id="AJG06158.1" /translation="MGSLISMCLSSSRENTSARTNGSSIWYPQPGQHISIQTFRQLRA QQMSRPTWRKTETTLILEFSKSMADQLEEVSNLPTTHMPKHSIQAVNPRPSIY Best Local Similarity 100.0%; Query Match 100.0%; Score 771; Length 2781; Matches 771; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 TCGAAGCGACCAGGCGATATAATCATTTCCACGCCCGTCTCGAAGGTTCGCCGAAGGCTG 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 311 TCGAAGCGACCAGGCGATATAATCATTTCCACGCCCGTCTCGAAGGTTCGCCGAAGGCTG 370 Qy 61 AACTTCGACAGCCCATACAGCAACCGTGCTGCTGTCCCCATTGTCCAAGGCACAAACAAG 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 371 AACTTCGACAGCCCATACAGCAACCGTGCTGCTGTCCCCATTGTCCAAGGCACAAACAAG 430 Qy 121 CGACGATCATGGACGTACAGGCCCATGTACCGAAAGCCCAGAATATACAGAATGTATCGA 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 431 CGACGATCATGGACGTACAGGCCCATGTACCGAAAGCCCAGAATATACAGAATGTATCGA 490 Qy 181 AGCCCTGATGTTCCCCGTGGATGTGAAGGCCCATGTAAAGTCCAGTCTTATGAGCAGCGG 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 491 AGCCCTGATGTTCCCCGTGGATGTGAAGGCCCATGTAAAGTCCAGTCTTATGAGCAGCGG 550 Qy 241 GATGATATTAAGCACACTGGTGTTGTTCGTTGTGTTAGTGATGTTACTCGTGGATCTGGA 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 551 GATGATATTAAGCACACTGGTGTTGTTCGTTGTGTTAGTGATGTTACTCGTGGATCTGGA 610 Qy 301 ATTACTCACAGAGTCGGTAAGAGGTTCTGTGTTAAATCGATATATTTTTTAGGTAAAGTC 360 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 611 ATTACTCACAGAGTCGGTAAGAGGTTCTGTGTTAAATCGATATATTTTTTAGGTAAAGTC 670 Qy 361 TGGATGGATGAAAATATCAAGAAGCAGAATCACACTAATCAGGTCATGTTCTTTTTGGTC 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 671 TGGATGGATGAAAATATCAAGAAGCAGAATCACACTAATCAGGTCATGTTCTTTTTGGTC 730 Qy 421 CGTGATAGAAGGCCCTATGGAAGCAGTCCAATGGATTTTGGACAGGTTTTTAATATGTTC 480 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 731 CGTGATAGAAGGCCCTATGGAAGCAGTCCAATGGATTTTGGACAGGTTTTTAATATGTTC 790 Qy 481 GATAATGAGCCCAGTACCGCAACTGTGAAGAATGATTTGCGTGATAGGTTTCAAGTGATG 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 791 GATAATGAGCCCAGTACCGCAACTGTGAAGAATGATTTGCGTGATAGGTTTCAAGTGATG 850 Qy 541 AGGAAATTTCATGCTACAGTTATTGGTGGGCCCTCTGGAATGAAGGAACAGGCATTAGTT 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 851 AGGAAATTTCATGCTACAGTTATTGGTGGGCCCTCTGGAATGAAGGAACAGGCATTAGTT 910 Qy 601 AAGAGATTTTTTAAAATTAACAGTCATGTAACTTATAATCATCAGGAGGCAGCCAAGTAC 660 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 911 AAGAGATTTTTTAAAATTAACAGTCATGTAACTTATAATCATCAGGAGGCAGCCAAGTAC 970 Qy 661 GAGAACCATACTGAAAACGCCTTGTTATTGTATATGGCATGTACGCATGCCTCTAATCCA 720 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 971 GAGAACCATACTGAAAACGCCTTGTTATTGTATATGGCATGTACGCATGCCTCTAATCCA 1030 Qy 721 GTGTATGCAACTATGAAAATACGCATCTATTTCTATGATTCAATATCAAAT 771 ||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1031 GTGTATGCAACTATGAAAATACGCATCTATTTCTATGATTCAATATCAAAT 1081 There is also a 100% sequence identity between instant SEQ ID NO: 2 and the TYLCV CP as taught by Fuentes et al., as shown below. Title: US-18-701-456-2 Perfect score: 1378 Sequence: 1 SKRPGDIIISTPVSKVRRRL..........SNPVYATMKIRIYFYDSISN 257 Searched: 1 seqs, 258 residues Database : AASEQ2_04292025_112735.pep:* RESULT 1 AASEQ2_04292025_112735 Query Match 100.0%; Score 1378; DB 1; Length 258; Mismatches 0; Best Local Similarity 100.0%; Matches 257; Conservative 0; Indels 0; Gaps 0; Qy 1 SKRPGDIIISTPVSKVRRRLNFDSPYSNRAAVPIVQGTNKRRSWTYRPMYRKPRIYRMYR 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 2 SKRPGDIIISTPVSKVRRRLNFDSPYSNRAAVPIVQGTNKRRSWTYRPMYRKPRIYRMYR 61 Qy 61 SPDVPRGCEGPCKVQSYEQRDDIKHTGVVRCVSDVTRGSGITHRVGKRFCVKSIYFLGKV 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 62 SPDVPRGCEGPCKVQSYEQRDDIKHTGVVRCVSDVTRGSGITHRVGKRFCVKSIYFLGKV 121 Qy 121 WMDENIKKQNHTNQVMFFLVRDRRPYGSSPMDFGQVFNMFDNEPSTATVKNDLRDRFQVM 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 122 WMDENIKKQNHTNQVMFFLVRDRRPYGSSPMDFGQVFNMFDNEPSTATVKNDLRDRFQVM 181 Qy 181 RKFHATVIGGPSGMKEQALVKRFFKINSHVTYNHQEAAKYENHTENALLLYMACTHASNP 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 182 RKFHATVIGGPSGMKEQALVKRFFKINSHVTYNHQEAAKYENHTENALLLYMACTHASNP 241 Qy 241 VYATMKIRIYFYDSISN 257 ||||||||||||||||| Db 242 VYATMKIRIYFYDSISN 258 Before the effective filing date, it would have been obvious to an ordinarily skilled artisan to replace nucleotide sequence encoding JcDNV CP in the fusion protein, as taught by Bonning et al., with the TYLCV CP nucleotide sequence, as taught by Fuentes et al., with a realistic goal to control specific target insect pest, whitefly. The fusion protein comprising the TYLCV CP passes across the gut epithelium and moves into the hemocoel of whitefly, as taught by Zhao et al. Using any specific TYLCV CP comprising a specific polypeptide sequence encoded by any specific polynucleotide sequence is within the experimental design choice of an ordinarily skilled artisan. Before the effective filing date, an ordinarily skilled artisan would have been motivated to fuse the TYCLV CP with an insect specific toxin using a peptide linker with a realistic goal to control the target insect pest, whitefly, by enabling the fusion protein comprising the TYLCV CP and the insect-specific toxin protein to pass across the gut epithelium and moves into the hemocoel of whitefly. Regarding Claims 11-12 and 20; SEQ ID NOs: 11-12, as recited in claims 11-12, comprise the TYLCV CP sequence fused with the Hv1a insect specific toxin via a protease resistant linker. An amino acid sequence encoding the fusion protein comprising of the TYLCV CP (as described by Fuentes et al.), a protease-resistant linker peptide having the sequence “GDDAPPSPGPDPGPQPPPPPPPSPTPV G” (SEQ ID NO: 4 of Bonning et al.), and the Hv1a insecticidal protein (SEQ ID NO: 6 of Bionning et al.), as described above, excluding the start methionine (M) residues for the fused polypeptides, would give 100% sequence identity to SEQ ID NO: 12 (as recited in claim 12), as shown below. Title: US-18-701-456-12 Perfect score: 1773 Sequence: 1 SKRPGDIIISTPVSKVRRRL..........CSQSCTFKENENGNTVKRCD 322 Searched: 1 seqs, 322 residues Total number of hits satisfying chosen parameters: 1 RESULT 1 AASEQ2_04292025_153807 Query Match 100.0%; Score 1773; Length 322; Conservative 0; Gaps 0; Best Local Similarity 100.0%; Matches 322; Mismatches 0; Indel 0 Qy 1 SKRPGDIIISTPVSKVRRRLNFDSPYSNRAAVPIVQGTNKRRSWTYRPMYRKPRIYRMYR 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 SKRPGDIIISTPVSKVRRRLNFDSPYSNRAAVPIVQGTNKRRSWTYRPMYRKPRIYRMYR 60 Qy 61 SPDVPRGCEGPCKVQSYEQRDDIKHTGVVRCVSDVTRGSGITHRVGKRFCVKSIYFLGKV 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 SPDVPRGCEGPCKVQSYEQRDDIKHTGVVRCVSDVTRGSGITHRVGKRFCVKSIYFLGKV 120 Qy 121 WMDENIKKQNHTNQVMFFLVRDRRPYGSSPMDFGQVFNMFDNEPSTATVKNDLRDRFQVM 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 WMDENIKKQNHTNQVMFFLVRDRRPYGSSPMDFGQVFNMFDNEPSTATVKNDLRDRFQVM 180 Qy 181 RKFHATVIGGPSGMKEQALVKRFFKINSHVTYNHQEAAKYENHTENALLLYMACTHASNP 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 RKFHATVIGGPSGMKEQALVKRFFKINSHVTYNHQEAAKYENHTENALLLYMACTHASNP 240 Linker-polypeptide Hv1a Qy 241 VYATMKIRIYFYDSISNGDDAPPSPGPDPGPQPPPPPPPSPTPVGSPTCIPSGQPCPYNE 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 VYATMKIRIYFYDSISNGDDAPPSPGPDPGPQPPPPPPPSPTPVGSPTCIPSGQPCPYNE 300 Hv1a Qy 301 NCCSQSCTFKENENGNTVKRCD 322 |||||||||||||||||||||| Db 301 NCCSQSCTFKENENGNTVKRCD 322 The non-highlighted sequence is the TYLCV CP, the first lighter grey highlighted sequence is the protease resistant linker polypeptide, and the darker grey highlighted sequence is the Hv1a insect specific toxin. It is a standard practice in the art that the translation start or initiator methionine (M) residues are usually not included in making fusion proteins. In fact, removal of the translation initiator N-formyl-methionine or methionine from a fusion or a recombinant protein is often critical for its function and stability (Liao et al.; abstract). Before the effective filing date, it would have been obvious to an ordinarily skilled artisan to fuse a specific TYLCV CP (as described by Fuentes et al.) with an insect-specific toxin via a protease-resistant linker (as described by Bonning et al.) with a realistic goal to control target insect pests (whiteflies), as described above. Before the effective filing date of the invention, an ordinarily skilled artisan would have been motivated to express a fusion protein consisting of SEQ ID NO: 12 (as recited in claim 12) encoded by the any polynucleotide sequence including SEQ ID NO: 11 (as recited in claim 11), with the realistic goal to control target insect pest (whitefly) population. The artisan would have been motivated to develop a transgenic plant expressing a specific polynucleotide sequence including SEQ ID NO: 11 (as recited in claim 20) with a realistic goal to control target insect pests (whiteflies), as described above. Regarding claim 22, it would have been obvious to an ordinarily skilled artisan and the artisan would have been motived to introduce SEQ ID NO: 11 in a plant cell and produce transgenic plants using a well-known and routine method like Agrobacterium mediated transformation a with a realistic goal to express the fusion protein comprising SEQ ID NO: 12 to control target insect pests feeding on the plant or parts thereof. Double Patenting Claims 1, 6, 8-10, 15, 17 and 26-27 are rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1, 4, 6-7, and 12 of U.S. Patent No. US11140902B2 (hereafter referred to as ‘902B) in view of Bonning et al. (US 2019/0239513 A1) and Zhao et al. Due to applicant’s amendments, the rejection is modified from the rejection set forth on pages 19-29 in the Office action dated 05/30/2025. Instant claim 1 is drawn to a fusion protein comprising a career protein, which is a tomato yellow leaf curl virus coat protein (TYLCV CP), fused to an insect specific toxin via a peptide linker. Claim 1 of ’902B recites a fusion protein comprising a carrier protein attached to a second peptide via a peptide linker, wherein the carrier protein is JcDNV CP. Claim 7 of ’902B recites an “insect toxin” (which reads on to “insect specific toxin”) Hv1a (line 3). However, claims 1 or claim 7 of ‘902B does not teach TYLCV CP as the carrier protein. Zhao et al. describes a fusion protein comprising TYLCV CP fused with a second protein (GST). It also describes that once acquired orally by whitefly, TYLCV CP follows a sequential path of stylet-midgut-haemolymph (the fluid inside hemocoel)-salivary gland. In this journey inside whitefly, virus coat protein crosses two major physiological barriers, namely midgut and salivary gland, to be transmitted successfully by the vector (page 1, left column, para 1; Fig. 5). Zhao et al. also describes that TYLCV CP is the only structural protein known to be involved in the virus transmission (page 1, right column, para 2) implying that TYLCV CP can pass across the gut epithelium and moves into the hemocoel and haemolymph of the insect. Bonning et al. describes a fusion protein comprising JcDNV CP attached to a peptide linker and is used to deliver a fused insect specific toxin across the gut epithelium of a target insect pest, fall armyworm. The fusion protein is used for controlling the target insect pest (Abstract). Before the effective filing date, it would have been obvious to an ordinarily skilled artesian to modify the fusion protein as described in claims 1 of ’902B to replace JcDNV CP with TYLCV CP and fuse the TYCLV CP (as described by Zhao et al.) with an insect-specific toxin Hv1a (as recited in claim 7 or ‘902B) via a protease resistant linker (as taught by Bonning et al.) with a realistic objective to deliver the fusion protein into the insect hemocoel, and, thus, controlling the specific target insect population. Before the effective filing date, an ordinarily skilled artesian would have been, motivated to fuse a TYLCV CP with an insect-specific toxin Hv1a polypeptide via a peptide linker to deliver the fusion protein into insect hemocoel with a realistic goal to control the target insect pest population. Regarding instant claim 6, claim 7 of ’092B describes a protease-resistant linker consisting of SEQ ID NO: 4. Translating the nucleotide sequence of instant SEQ ID NO: 3 would give rise to the following sequence: GDDAPPSPGPDPGPQPPPPPPPSPTPVG. Sequence alignment of the said amino acid sequence and SEQ ID NO: 4 of ‘092B shows 100% identity, as shown below. Title: AASEQ1_04302025_130720 Perfect score: 173 Sequence: 1 GDDAPPSPGPDPGPQPPPPPPPSPTPVG 28 Database : AASEQ2_04302025_130720.pep:* RESULT 1 AASEQ2_04302025_130720 Query Match 100.0%; Score 173; DB 1; Length 32; Indels 0; Best Local Similarity 100.0%; Matches 28; Conservative 0; Mismatches 0; Gaps 0; Qy 1 GDDAPPSPGPDPGPQPPPPPPPSPTPVG 28 |||||||||||||||||||||||||||| Db 1 GDDAPPSPGPDPGPQPPPPPPPSPTPVG 28 Amino acid sequence consisting of SEQ ID NO: 3 in instant claim 6 is encoded by the nucleotide sequence consisting of SEQ ID NO: 4 of claim 7 of ‘902B and, thus, are functional equivalents. Regarding instant claims 8-10, claims 6 and 7 of ‘902B recite an insect-specific toxin, Hv1a. Bonning et al. teaches an insect specific neurotoxin (page 6, para 0068, line 11-13; page 13, para 0123, last line). It also teaches that Hv1a is an arthropod-derived neuropeptide (page 11, para 0107, line 1-4). Regarding instant claims 15 and 17, Bonning et al. describes a vector comprising an expression cassette consisting of plant expressible constitutive promoters including cauliflower mosaic virus (CaMV) and ubiquitin promoters (page 22, para 0215) to express the specific proteins in a plant. Using plant expressible promoters including cauliflower mosaic virus (CaMV) and ubiquitin promoters to express specific proteins in a plant is a widely used, known, and routine method to express any protein(s) including fusion protein(s) in a plant. Regarding instant claims 26-27, Claim 12 of ‘902B are drawn to a method of controlling target insect pests by feeding the target insect pest fall army worm, Spodoptera frugiperda, with a food source comprising a fusion protein comprising a viral (JcDNV) coat protein attached to an insect specific toxin via a peptide linker, thereby allowing the fusion protein to pass across the gut epithelium of the target insect and act within the hemocoel of the insect after the fusion protein is ingested by the insect. Zhao et al. describes that once acquired orally by whitefly (as recited in claim 27), TYLCV CP enables a fusion protein to pass across the gut epithelium and moves into the hemocoel of the insect. The insecticidal toxin fused to the TYLCV CP would act within the insect hemocoel. It would have been obvious to an ordinarily skilled artisan to develop a method of controlling target insect pests by feeding an insect with a food source comprising a fusion protein comprising TYLCV CP (as taught by Zhou et al.) and insect specific toxin protein fused together via a peptide linker (as taught by claim 12 of ‘092B), wherein upon ingestion, the fusion protein passes across the gut epithelium and moves into the hemocoel of the target insect pest (whitefly), as recited in instant claim 26. Claims 3-4, 11-12, 20 and 22 are rejected on the ground of nonstatutory double patenting as being unpatentable over claims 1, 4, 6-7, and 12 of U.S. Patent No. US11140902B2 in view of Bonning et al. and Zhou et al., as applied to reject claims 1, 5-6, 8-10, 15, 17, and 26-27 above under nonstatutory double patenting, and in further view of Fuentes et al. Instant claim 3 recites a fusion protein comprising the TYLCV CP having the amino acid sequence set forth in instant SEQ ID NO: 2. Instant claim 4 recites a fusion protein comprising the TYLCV CP encoded by the nucleotide sequence set forth in SEQ ID NO: 1. Claims 1, 4, 6-7, and 12 of U.S. Patent No. US11140902B2 in view of Bonning et al. and Zhou et al., describe a fusion protein comprising the TYLCV CP and an insect-specific toxin protein fused together via a peptide linker to deliver the insecticidal protein into insect hemocoel with a realistic goal to control the target insect pest population, as discussed above. However, claims 1, 4, 6-7, and 12 of U.S. Patent No. US11140902B2 in view of Bonning et al. and Zhou et al., do not describe a TYLCV CP comprising the instant SEQ ID NO: 2 or instant SEQ ID NO: 1. Fuentes et al. describes a TYLCV CP comprising 100% sequence identity to instant SEQ ID NO: 2. It also teaches a polynucleotide sequence having 100% sequence identity to instant SEQ ID NO: 1, as discussed above. Before the effective filing date of the invention, it would have been obvious to an ordinarily skilled artisan to replace the nucleotide sequence encoding the JcDNV CP in the fusion protein, as taught by claim 1 of ‘902B, with the TYLCV CP nucleotide sequence having 100% sequence identity with instant SEQ ID NO: 1 encoding a protein having 100% sequence identity with instant SEQ ID NO: 2, as taught by Fuentes et al., with the realistic goal to control specific target insect pest (i.e., whitefly) by enabling the fusion protein comprising the TYLCV CP and the insect-specific toxin protein, as taught by Bonning et al., to pass across the gut epithelium and moves into the hemocoel of whitefly, as taught by Zhao et al. It is noted that using a functional equivalent of the nucleotide sequence encoding TYLCV CP is within the experimental design choice of the Applicant. Before the effective filing date, an ordinarily skilled artisan would have been motivated to fuse the TYCLV CP with an insect specific toxin using a peptide linker with the realistic goal to control the target insect pest, whitefly, by enabling the fusion protein comprising the TYLCV CP and the insect-specific toxin protein to pass across the gut epithelium and moves into the hemocoel of whitefly. Regarding claims 11-12, instant claim 11 is drawn to fusion protein comprising the nucleotide sequence set forth in instant SEQ ID NO: 11 while the instant claim 12 recites the fusion protein of instant claim 1, comprising the amino acid sequence set forth in instant SEQ ID NO: 12. A fusion protein comprising the TYLCV CP, as described by Fuentes et al., the linker peptide having the sequence of SEQ ID NO: 4 as recited in claim 7 of ‘902B, and the Hv1a insect specific toxin having the sequence of SEQ ID NO: 6 of ‘902B without the start methionine (M) would give rise to a fusion protein having 100% sequence identity with SEQ ID NO: 12, as shown below. Title: US-18-701-456-12 Perfect score: 1773 Sequence: 1 SKRPGDIIISTPVSKVRRRL..........CSQSCTFKENENGNTVKRCD 322 Searched: 1 seqs, 322 residues Total number of hits satisfying chosen parameters: 1 RESULT 1 AASEQ2_04292025_153807 Query Match 100.0%; Conservative 0; Best Local Similarity 100.0%; Indel 0; Matches 322; Mismatches 0; Score 1773; Gaps 0; Length 322 Qy 1 SKRPGDIIISTPVSKVRRRLNFDSPYSNRAAVPIVQGTNKRRSWTYRPMYRKPRIYRMYR 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 SKRPGDIIISTPVSKVRRRLNFDSPYSNRAAVPIVQGTNKRRSWTYRPMYRKPRIYRMYR 60 Qy 61 SPDVPRGCEGPCKVQSYEQRDDIKHTGVVRCVSDVTRGSGITHRVGKRFCVKSIYFLGKV 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 SPDVPRGCEGPCKVQSYEQRDDIKHTGVVRCVSDVTRGSGITHRVGKRFCVKSIYFLGKV 120 Qy 121 WMDENIKKQNHTNQVMFFLVRDRRPYGSSPMDFGQVFNMFDNEPSTATVKNDLRDRFQVM 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 WMDENIKKQNHTNQVMFFLVRDRRPYGSSPMDFGQVFNMFDNEPSTATVKNDLRDRFQVM 180 Qy 181 RKFHATVIGGPSGMKEQALVKRFFKINSHVTYNHQEAAKYENHTENALLLYMACTHASNP 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 RKFHATVIGGPSGMKEQALVKRFFKINSHVTYNHQEAAKYENHTENALLLYMACTHASNP 240 Linker-polypeptide Hv1a Qy 241 VYATMKIRIYFYDSISNGDDAPPSPGPDPGPQPPPPPPPSPTPVGSPTCIPSGQPCPYNE 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 VYATMKIRIYFYDSISNGDDAPPSPGPDPGPQPPPPPPPSPTPVGSPTCIPSGQPCPYNE 300 Hv1a Qy 301 NCCSQSCTFKENENGNTVKRCD 322 |||||||||||||||||||||| Db 301 NCCSQSCTFKENENGNTVKRCD 322 The non-highlighted part is the TYLCV CP, the first lighter grey highlighted sequence is the linker polypeptide, and the darker grey highlighted sequence is the Hv1a insecticidal protein. Translation start or initiator methionine (M) residues are usually not included in fusion proteins. In fact, removal of the translation initiator N-formyl-methionine or methionine from a fusion or a recombinant protein is often critical for its function and stability1. Any nucleotide sequence (e.g., SEQ ID NO: 11) encoding the said fusion protein comprising SEQ ID NO: 12 would be a functional equivalent and within the experimental design choice of an ordinarily skilled artisan without having any realistic possibility to change the outcome of controlling the target insect pest, whitefly. Regarding instant claims 20 and 22, It would have been obvious to an ordinarily skilled artisan and the artisan would have been motivated to develop a transgenic plant using any routine and standard technique (e.g. agrobacterium media transformation) and express the nucleotide sequence comprising SEQ ID NO: 11 or its functional equivalent encoding a fusion protein comprising the recombinant polypeptide sequence of instant SEQ ID NO: 12, with a realistic goal to control target insect pest (whitefly) that would be feeding on the transgenic plant or parts thereof, as discussed above. Response to Applicant’s Arguments The response from the Applicant dated 6/30/2026 is fully considered but not found persuasive. The Applicant argues, “the Office has not established that a person of ordinary skill in the art would have been motivated to replace the JcDNV CP in the fusion proteins disclosed in Bonning with the TYLCV CP of Zhao as alleged by the Office” (response, p.4, para3, last 3 lines) because “Zhao provides no evidence that isolated TYLCV CP can cross the gut epithelium. Rather, Zhao only demonstrates that whole virions (detected via anti-CP antibodies) move through the whitefly” (response, p.5, para 1, last 3 lines). The Applicant argues, “Zhao provides no teaching or suggestion that TYLCV CP alone, in the absence of the whole virion, is capable of localizing within the whitefly hemocoel” (response, p.5, para 2, last 3 lines) and “Zhao does not establish how an isolated TYLCV CP would behave within a target insect” (response, p.5, para 4, line 3-4). Thus, the Applicant argues, “a person of ordinary skill in the art would not have assumed that individual coat proteins lacking the three-dimensional structure and context of the whole virion would behave the same as intact viral particles” (response, p.5, last para, line 1-3). The Examiner disagrees. A fuller reading of Zhou et al. shows that the reference describes that TYLCV CP is the only structural protein known to be involved in the virus transmission (page 1, right column, para 2). Once acquired orally by whitefly, TYLCV CP follows a sequential path of stylet-midgut-haemolymph-salivary gland, and in this journey inside whitefly, virus has to cross two major physiological barriers, namely midgut and salivary gland, to be transmitted successfully by vector (page 1, left column, para 1; Fig. 5), implying that TYLCV CP can pass across the gut epithelium and moves into the hemocoel of the insect vector (i.e., whitefly). These two teachings make it obvious to an ordinarily skilled artisan and would have motivated the artisan to express a fusion protein comprising an insect specific toxin and the TYLCV CP, which were known to pass across the gut epithelium and move into the hemocoel of the target insect pest, as discussed above, with a reasonable expectation of success. Developing fusion proteins using a linker peptide is a long known and routine process in the art to fuse different proteins and/or heterologous domain(s)/motif(s). The linkers are mostly derived from naturally-occurring multi-domain proteins and is considered to be the foundation of the linker design (Chen et al., Fusion Protein Linkers: Property, Design and Functionality, 2013, Adv Drug Deliv Rev., 65:1357–1369; Abstract, line 4-5) which retains the necessary secondary and/or tertiary structure(s) of the fused proteins to maintain specific biological functions of the individual proteins. Chen et al. describes well known methods by which selection of linkers can be done in a way to achieve optimal biological activity of the fusion proteins (p.5, para 2, last 3 lines). In fact, it is also known in the art that besides the basic role in linking the functional domains together or releasing free functional domain in-vivo, linkers can improve biological activities/functions and production for the fused proteins (Chen et al.; Abstract, line 8-11; line p.8, para 4, line 3-4). Bonning et al. describes a fusion protein comprising a protease-resistant linker (page 13, para 0121) fused with Junonia coenia densovirus (JcDNV) coat protein (JcDNV CP) and a heterologous insect-specific toxin protein (page 13, para 0123) for controlling its target insect pests, fall armyworm (Spodoptera frugiperda) (abstract). The fusion protein retains the biological function of both the proteins, as expected. Bonning et al. teaches that for intrahemocoelic proteins such as the coat protein of an insect vectored plant virus can be used to deliver toxins into the hemocoel (page 11, para 0111). Bonning et al. also describes that the protease-resistant linker ensures that the fusion protein is transported into hemocoel as an intact fusion protein comprising the insect specific toxin (page 13, para 0123). The Applicant does not provide any evidence that TYLCV CP (in absence of entire virion or fused with a heterologous protein) would have behaved differently in terms of reaching the gut and/or hemocoel of its target insect (a whitefly). Applicant’s opinion cannot take the place of evidence (MPEP 716.01(c)(II), 2145(I)). The Applicant is reminded that the test for obviousness is not whether the features of a secondary reference may be bodily incorporated into the structure of the primary reference; nor is it that the claimed invention must be expressly suggested in any one or all of the references. Rather, the test is what the combined teachings of the references would have suggested to those of ordinary skill in the art to achieve a outcome with reasonable expectation of success. In re Keller, 642 F.2d 413, 208 USPQ 871 (CCPA 1981). Explicit analysis for U.S. C. 103 obviousness rejections does not require record evidence of an explicit teaching of a motivation to combine in the prior art. See MPEP ¶ 2143. Regarding Applicant’s request to that the double patenting rejection be held in abeyance: the double patenting rejection is maintained herewith. Conclusion No claim is allowed. THIS ACTION IS MADE FINAL. Applicant is reminded of the extension of time policy as set forth in 37 CFR 1.136(a). A shortened statutory period for reply to this final action is set to expire THREE MONTHS from the mailing date of this action. In the event a first reply is filed within TWO MONTHS of the mailing date of this final action and the advisory action is not mailed until after the end of the THREE-MONTH shortened statutory period, then the shortened statutory period will expire on the date the advisory action is mailed, and any nonprovisional extension fee (37 CFR 1.17(a)) pursuant to 37 CFR 1.136(a) will be calculated from the mailing date of the advisory action. In no event, however, will the statutory period for reply expire later than SIX MONTHS from the mailing date of this final action. Communication Any inquiry concerning this communication or earlier communications from the examiner should be directed to JAY CHATTERJEE whose telephone number is (703)756-1329. The examiner can normally be reached (Mon - Fri) 8.30 am to 5.30 pm.. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Bratislav Stankovic can be reached at (571) 270-0305. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. J.C. /Jay Chatterjee/Examiner, Art Unit 1662 /BRATISLAV STANKOVIC/Supervisory Patent Examiner, Art Units 1661 & 1662
Read full office action

Prosecution Timeline

Show 1 earlier event
May 30, 2025
Non-Final Rejection mailed — §103, §DP
Aug 28, 2025
Response Filed
Oct 30, 2025
Final Rejection mailed — §103, §DP
Mar 02, 2026
Request for Continued Examination
Mar 10, 2026
Response after Non-Final Action
Mar 30, 2026
Non-Final Rejection mailed — §103, §DP
Jun 30, 2026
Response Filed
Aug 10, 2026
Final Rejection mailed — §103, §DP (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12703870
REGULATION OF ROOT DEVELOPMENT
2y 2m to grant Granted Aug 11, 2026
Patent 12662514
METHODS TO BLOCK APHID TRANSMISSION OF POLEROVIRUSES AND TO DEVELOP VIRUS MANAGEMENT TOOLS
3y 6m to grant Granted Jun 23, 2026
Patent 12649926
USE OF MfERF026 GENE REGULATION IN GROWTH, DEVELOPMENT, AND STRESS TOLERANCE OF MEDICAGO SATIVA
2y 1m to grant Granted Jun 09, 2026
Patent 12642203
TOMATO PLANTS RESISTANT TO TOBRFV, TMV, TOMV AND TOMMV AND CORRESPONDING RESISTANCE GENES
2y 12m to grant Granted Jun 02, 2026
Patent 12635627
PLANTS RESISTANT TO INFECTION BY PEPINO MOSAIC VIRUS
2y 5m to grant Granted May 26, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

Strategy Recommendation AI-generated — please review before filing

Get a prosecution strategy drawn from examiner precedents, rejection analysis, and claim mapping.
Typically takes 5-10 seconds — AI-generated, attorney review required before filing

Prosecution Projections

5-6
Expected OA Rounds
46%
Grant Probability
99%
With Interview (+80.0%)
2y 7m (~1m remaining)
Median Time to Grant
High
PTA Risk
Based on 22 resolved cases by this examiner. Grant probability derived from career allowance rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month