Prosecution Insights
Last updated: September 24, 2026
Application No. 18/748,186

KINASE-DEAD MUTATION: A NEW APPROACH TO ENHANCE SOYBEAN RESISTANCE TO SOYBEAN CYST NEMATODE

Non-Final OA §101§112
Filed
Jun 20, 2024
Priority
Apr 13, 2020 — provisional 63/009,120 +1 more
Examiner
KUBELIK, ANNE R
Art Unit
1663
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
University of Tennessee Research Foundation
OA Round
1 (Non-Final)
76%
Grant Probability
Favorable
1-2
OA Rounds
5m
Est. Remaining
75%
With Interview

Examiner Intelligence

Grants 76% — above average
76%
Career Allowance Rate
1021 granted / 1347 resolved
+15.8% vs TC avg
Minimal -1% lift
Without
With
+-0.7%
Interview Lift
resolved cases with interview
Typical timeline
2y 9m
Avg Prosecution
34 currently pending
Career history
1381
Total Applications
across all art units

Statute-Specific Performance

§101
5.3%
-34.7% vs TC avg
§103
18.8%
-21.2% vs TC avg
§102
21.0%
-19.0% vs TC avg
§112
39.2%
-0.8% vs TC avg
Black line = Tech Center average estimate • Based on career data from 1347 resolved cases

Office Action

§101 §112
Notice of Pre-AIA or AIA Status Applicant’s election of Group III and species SEQ ID NO:97 in the replies filed on 6 April 2026 and 13 May 2026 is acknowledged. Because applicant did not distinctly and specifically point out the supposed errors in the restriction requirement, the election has been treated as an election without traverse (MPEP § 818.01(a)). Claims 1-2 are withdrawn from consideration as being drawn to nonelected inventions. Claims 13-14 are drawn to nonelected species and are thus also withdrawn from consideration. Claims 3-12 are examined to the extent they read on SEQ ID NO:97. The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Claim Objections Claims 4 and 6 are objected to because the “a” before “kinase” in line 1 of claim 4 and the “a” before “nucleic” in line 1 of claim 6 should be replaced with --the--. Improper Markush Grouping Claims 3-12 are rejected on the basis that they contain an improper Markush grouping of alternatives. See In re Harnisch, 631 F.2d 716, 721-22 (CCPA 1980) and Ex parte Hozumi, 3 USPQ2d 1059, 1060 (Bd. Pat. App. & Int. 1984). A Markush grouping is proper if the alternatives defined by the Markush group (i.e., alternatives from which a selection is to be made in the context of a combination or process, or alternative chemical compounds as a whole) share a “single structural similarity” and a common use. A Markush grouping meets these requirements in two situations. First, a Markush grouping is proper if the alternatives are all members of the same recognized physical or chemical class or the same art-recognized class, and are disclosed in the specification or known in the art to be functionally equivalent and have a common use. Second, where a Markush grouping describes alternative chemical compounds, whether by words or chemical formulas, and the alternatives do not belong to a recognized class as set forth above, the members of the Markush grouping may be considered to share a “single structural similarity” and common use where the alternatives share both a substantial structural feature and a common use that flows from the substantial structural feature. See MPEP § 2117. The Markush groupings of SEQ ID NOs:92, 94-99, and 1-91 is improper because the alternatives defined by the Markush grouping do not share both a single structural similarity and a common use. SEQ ID NOs: 92, 94-99, and 1-91 are all kinase-dead mutant proteins, that is, they are all inactivated kinases. While all the wild-type proteins these sequences are based on (SEQ ID NOs:15, 17, 49, 60, 66, 75, 83, and 91, respectively, Table 2) are kinases, they do not share a single structural similarity. For example, SEQ ID NO:s 97 and 57 have only 5.1% identity over the length of the 614-amino acid long SEQ ID NO:97: Query Match 5.1%; Score 163; DB 1; Length 356; Best Local Similarity 25.8%; Matches 74; Conservative 39; Mismatches 106; Indels 68; Gaps 14; Qy 307 IIGTGRTGTVYKAVLDDGTT----LMVRRLQESQYTEKEFMSEMGTLGTVKHRNLVPLLG 362 ::| | | | : | |: | | :: : |: |: : : | : Db 75 VVGKGNGGVV-QLVQHKWTSQFFALKVIQMNIEESMRKQIAQEL----KINQQAQCPYVV 129 Qy 363 FCMTKRERLLVYKNM-PNGNLHDQLHPADGVSTLDWTTRLK---------IAIGAAKGLA 412 | |:: || : | || | | ::| | ||| Db 130 VC---------YQSFYENGVISIILEYMDGGSLADLLKKVKTIPEDYLAAICKQVLKGLV 180 Qy 413 WLHHSCNPRIIHRNISSRCILLDADFEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYV 472 :||| ||||:: :|:: | ||:|||:: :| :||: | |: Db 181 YLHH--EKHIIHRDLKPSNLLINHIGEVKITDFGVSAIMESTSGQANTFI----GTYNYM 234 Qy 473 APE--------YTRTLVATPKGDIYSFGTVLLELVTGERPTNVSKAPETFKGNLVEWITE 524 :|| | | ||:| | :||| | | ||: | | | Db 235 SPERINGSQRGYNY------KSDIWSLGLILLECALGRFPYAPPDQSETW-----ESIFE 283 Qy 525 LTSNAKLHDAIDESLVRKD---VDSELF--QFLKVACNCVSPTPKER 566 | |::| | || | :| |: ||:| Db 284 LI----------ETIVDKPPPIPPSEQFSTEFCSFISACLQKDPKDR 320 Further, plants contain large numbers of kinases, but only 10% of them are involved in signaling pathways in response to biotic or abiotic or hormonal or developmental signals (Colcombet et al, 2008, Biochem J. 413:217-226; see pg 217, left column, paragraph 2). To overcome this rejection, Applicant may set forth each alternative (or grouping of patentably indistinct alternatives) within an improper Markush grouping in a series of independent or dependent claims and/or present convincing arguments that the group members recited in the alternative within a single claim in fact share a single structural similarity as well as a common use. Claim Rejections - 35 USC § 101 35 U.S.C. 101 reads as follows: Whoever invents or discovers any new and useful process, machine, manufacture, or composition of matter, or any new and useful improvement thereof, may obtain a patent therefor, subject to the conditions and requirements of this title. Claims 3 and 11-12 are rejected under 35 U.S.C. 101 because the claimed invention is not supported by either a specific and substantial asserted utility or a well-established utility. Claim 3 and 11-12 are drawn to a kinase-dead mutant protein. The specification describes no use for isolated kinase-dead mutant proteins. It only describes a use for nucleic acids that encode them and plants transformed with the nucleic acids. There is no well-established utility for a kinase-dead mutant protein, as such proteins exhibit no or almost activity. The specification describes no substantial utility for the claimed kinase-dead mutant protein, as such, further research required to determine how to use it. It is apparent that extensive further research, not considered to be routine experimentation, would be required before one skilled in the art would know how to use the claimed invention. It has been established in the courts that a utility that requires or constitutes carrying out further research to identify or reasonably confirm a “real world” context of use is not a substantial utility: The basic quid pro quo contemplated by the Constitution and the Congress for granting a patent monopoly is the benefit derived by the public from an invention with substantial utility. Unless and until a process is refined and developed to this point-where specific benefit exists in currently available form, there is insufficient justification for permitting an application to engross what may prove to be a broad field (Brenner v. Manson, 383 U.S. 519 (1966)). Accordingly, the invention in claims 3 and 11-12 lacks a “real-world” use. Claim Rejections - 35 USC § 112 The following is a quotation of 35 U.S.C. 112(a): (a) IN GENERAL.—The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor or joint inventor of carrying out the invention. The following is a quotation of 35 U.S.C. 112 (pre-AIA ), first paragraph: The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same and shall set forth the best mode contemplated by the inventor of carrying out his invention. Claims 3 and 11-12 are also rejected under 35 U.S.C. 112(a) or pre-AIA 35 U.S.C. 112, first paragraph. Specifically, because the claimed invention is not supported by either a specific and substantial asserted utility or a well-established utility for the reasons set forth above, one skilled in the art clearly would not know how to use the claimed invention. Claims 6 and 8-9 are rejected under 35 U.S.C. 112(a) or 35 U.S.C. 112 (pre-AIA ), first paragraph, because the specification, while being enabling for a plant cell comprising a nucleic acid encoding SEQ ID NO:97, where the cell is soybean or another cyst nematode host, does not reasonably provide enablement for a plant cell comprising a nucleic acid encoding SEQ ID NO:97, where the cell is not a cyst nematode host. The specification does not enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to use the invention commensurate in scope with these claims. The claims are drawn to a plant cell comprising a nucleic acid encoding SEQ ID NO:97. SEQ ID NO:97 is a mutant kinase in which a lysine in each of the ATP-binding pocket and the substrate binding pocket has been replaced with arginines (pg 30, lines 20-33). Soybean plants transformed with a nucleic acid encoding SEQ ID NO:97 have resistance to soybean cyst nematode (example 5). However, not all plants are susceptible to soybean cyst nematode. The instant specification fails to provide guidance for how to use such plant cells (or plants regenerated from them), where the original plant was not susceptible to soybean cyst nematode. Given the nature of the invention and lack of guidance as discussed above, undue experimentation would have been required by one skilled in the art to develop and evaluate a use for such plant cells. The following is a quotation of 35 U.S.C. 112(b): (B) CONCLUSION.—The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the inventor or a joint inventor regards as the invention. The following is a quotation of the second paragraph of 35 U.S.C. 112: The specification shall conclude with one or more claims particularly pointing out and distinctly claiming the subject matter which the applicant regards as his invention. Claims 3-12 are rejected under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), second paragraph, as being indefinite for failing to particularly point out and distinctly claim the subject matter that the inventor or a joint inventor, or for pre-AIA the applicant, regards as the invention. Dependent claims are included in all rejections. Claim 3 is indefinite in its recitation of “comprising … SEQ ID NO:94-99”. It is unclear if the mutant protein comprises each of SEQ ID NO:94-99 or only one of them. The language of the claim implies that the mutant comprises each of SEQ ID NO:94-99; however, dependent claim 12, which recites that the mutant comprises SEQ ID NO:97, implies that the mutant of claim 3 comprises only one of SEQ ID NO:94-99. The metes and bounds of the claims are thus unclear. The following is a quotation of 35 U.S.C. 112(d): (d) REFERENCE IN DEPENDENT FORMS.—Subject to subsection (e), a claim in dependent form shall contain a reference to a claim previously set forth and then specify a further limitation of the subject matter claimed. A claim in dependent form shall be construed to incorporate by reference all the limitations of the claim to which it refers. The following is a quotation of 35 U.S.C. 112 (pre-AIA ), fourth paragraph: Subject to the [fifth paragraph of 35 U.S.C. 112 (pre-AIA )], a claim in dependent form shall contain a reference to a claim previously set forth and then specify a further limitation of the subject matter claimed. A claim in dependent form shall be construed to incorporate by reference all the limitations of the claim to which it refers. Claims 11-12 are rejected under 35 U.S.C. 112(d) or 35 U.S.C. 112(pre-AIA ), fourth paragraph, as being of improper dependent form for failing to further limit the subject matter of the claim upon which it depends, or for failing to include all the limitations of the claim upon which it depends. Parent claim 3 recites “a kinase-dead mutant protein comprising … SEQ ID NO:94-99”. Dependent claims 11-12 recite that the kinase-dead mutant protein is SEQ ID NO:97. These claims fail to include all the limitations of the claim upon which they depend. Applicant may cancel the claim(s), amend the claim(s) to place the claim(s) in proper dependent form, rewrite the claim(s) in independent form, or present a sufficient showing that the dependent claim(s) complies with the statutory requirements. Claims 4-5, 7 and 10 would be allowable if rewritten to overcome the objection and the rejection(s) under 35 U.S.C. 112(b) or 35 U.S.C. 112 (pre-AIA ), 2nd paragraph, set forth in this Office action and to include all of the limitations of the base claim and any intervening claims. The closest prior art to SEQ ID NO:97 is the wild-type kinase, taught in GenBank: KHN16981 (2014, www.ncbi.nlm.nih.gov/protein/KHN16981) and thought to be inactive: A0A0B2Q607_GLYSO ID A0A0B2Q607_GLYSO Unreviewed; 614 AA. AC A0A0B2Q607; DT 04-MAR-2015, integrated into UniProtKB/TrEMBL. DT 04-MAR-2015, sequence version 1. DT 28-JAN-2026, entry version 43. DE SubName: Full=Inactive leucine-rich repeat receptor-like protein kinase {ECO:0000313|EMBL:KHN16981.1, ECO:0000313|EMBL:RZB60075.1}; DE EC=2.7.10.1 {ECO:0000313|EMBL:KHN16981.1}; DE EC=2.7.11.25 {ECO:0000313|EMBL:KHN16981.1}; GN ORFNames=D0Y65_043016 {ECO:0000313|EMBL:RZB60075.1}, glysoja_035832 GN {ECO:0000313|EMBL:KHN16981.1}; OS Glycine soja (Wild soybean). OC Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; OC Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; OC rosids; fabids; Fabales; Fabaceae; Papilionoideae; 50 kb inversion clade; OC NPAAA clade; indigoferoid/millettioid clade; Phaseoleae; Glycine; OC Glycine subgen. Soja. OX NCBI_TaxID=3848 {ECO:0000313|EMBL:KHN16981.1}; RN [1] {ECO:0000313|EMBL:KHN16981.1} RP NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. RC TISSUE=Root {ECO:0000313|EMBL:KHN16981.1}; RA Lam H.-M., Qi X., Li M.-W., Liu X., Xie M., Ni M., Xu X.; RT "Identification of a novel salt tolerance gene in wild soybean by whole- RT genome sequencing."; RL Submitted (JUL-2014) to the EMBL/GenBank/DDBJ databases. RN [2] {ECO:0000313|EMBL:RZB60075.1, ECO:0000313|Proteomes:UP000289340} RP NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. RC STRAIN=cv. W05 {ECO:0000313|Proteomes:UP000289340}; RC TISSUE=Hypocotyl of etiolated seedlings {ECO:0000313|EMBL:RZB60075.1}; RA Xie M., Chung C.Y.L., Li M.-W., Wong F.-L., Chan T.-F., Lam H.-M.; RT "A high-quality reference genome of wild soybean provides a powerful tool RT to mine soybean genomes."; RL Submitted (SEP-2018) to the EMBL/GenBank/DDBJ databases. CC -!- SUBCELLULAR LOCATION: Membrane {ECO:0000256|ARBA:ARBA00004170}; CC Peripheral membrane protein {ECO:0000256|ARBA:ARBA00004170}. Membrane CC {ECO:0000256|ARBA:ARBA00004479}; Single-pass type I membrane protein CC {ECO:0000256|ARBA:ARBA00004479}. Secreted, cell wall CC {ECO:0000256|ARBA:ARBA00004191}. CC -!- SIMILARITY: Belongs to the polygalacturonase-inhibiting protein family. CC {ECO:0000256|ARBA:ARBA00038043}. CC --------------------------------------------------------------------------- CC Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms CC Distributed under the Creative Commons Attribution (CC BY 4.0) License CC --------------------------------------------------------------------------- DR EMBL; KN660432; KHN16981.1; -; Genomic_DNA. DR EMBL; QZWG01000016; RZB60075.1; -; Genomic_DNA. DR AlphaFoldDB; A0A0B2Q607; -. DR SMR; A0A0B2Q607; -. DR Gramene; XM_028350480.1; XP_028206281.1; LOC114389732. DR Proteomes; UP000053555; Unassembled WGS sequence. DR Proteomes; UP000289340; Chromosome 16. DR GO; GO:0016020; C:membrane; IEA:UniProtKB-SubCell. DR GO; GO:0005524; F:ATP binding; IEA:UniProtKB-KW. DR GO; GO:0004709; F:MAP kinase kinase kinase activity; IEA:UniProtKB-EC. DR GO; GO:0004714; F:transmembrane receptor protein tyrosine kinase activity; IEA:UniProtKB-EC. DR GO; GO:0006952; P:defense response; IEA:UniProtKB-KW. DR CDD; cd14066; STKc_IRAK; 1. DR FunFam; 1.10.510.10:FF:000609; Inactive LRR receptor-like serine/threonine-protein kinase BIR2; 1. DR FunFam; 3.30.200.20:FF:000428; Inactive LRR receptor-like serine/threonine-protein kinase BIR2; 1. DR FunFam; 3.80.10.10:FF:000400; Nuclear pore complex protein NUP107; 1. DR Gene3D; 3.30.200.20; Phosphorylase Kinase, domain 1; 1. DR Gene3D; 3.80.10.10; Ribonuclease Inhibitor; 1. DR Gene3D; 1.10.510.10; Transferase(Phosphotransferase) domain 1; 1. DR InterPro; IPR011009; Kinase-like_dom_sf. DR InterPro; IPR001611; Leu-rich_rpt. DR InterPro; IPR032675; LRR_dom_sf. DR InterPro; IPR013210; LRR_N_plant-typ. DR InterPro; IPR051824; LRR_Rcpt-Like_S/T_Kinase. DR InterPro; IPR000719; Prot_kinase_dom. DR InterPro; IPR001245; Ser-Thr/Tyr_kinase_cat_dom. DR PANTHER; PTHR48006; LEUCINE-RICH REPEAT-CONTAINING PROTEIN DDB_G0281931-RELATED; 1. DR PANTHER; PTHR48006:SF88; LRR RECEPTOR-LIKE KINASE FAMILY PROTEIN; 1. DR Pfam; PF00560; LRR_1; 2. DR Pfam; PF08263; LRRNT_2; 1. DR Pfam; PF07714; PK_Tyr_Ser-Thr; 1. DR SUPFAM; SSF52058; L domain-like; 1. DR SUPFAM; SSF56112; Protein kinase-like (PK-like); 1. DR PROSITE; PS50011; PROTEIN_KINASE_DOM; 1. PE 3: Inferred from homology; KW ATP-binding {ECO:0000256|ARBA:ARBA00022840}; KW Cell wall {ECO:0000256|ARBA:ARBA00022512}; KW Disulfide bond {ECO:0000256|ARBA:ARBA00023157}; KW Glycoprotein {ECO:0000256|ARBA:ARBA00023180}; KW Kinase {ECO:0000313|EMBL:KHN16981.1}; KW Leucine-rich repeat {ECO:0000256|ARBA:ARBA00022614}; KW Membrane {ECO:0000256|ARBA:ARBA00023136, ECO:0000256|SAM:Phobius}; KW Nucleotide-binding {ECO:0000256|ARBA:ARBA00022741}; KW Phosphoprotein {ECO:0000256|ARBA:ARBA00022553}; KW Plant defense {ECO:0000256|ARBA:ARBA00022821}; KW Receptor {ECO:0000313|EMBL:KHN16981.1}; KW Reference proteome {ECO:0000313|Proteomes:UP000289340}; KW Repeat {ECO:0000256|ARBA:ARBA00022737}; KW Secreted {ECO:0000256|ARBA:ARBA00022525}; KW Signal {ECO:0000256|ARBA:ARBA00022729, ECO:0000256|SAM:SignalP}; KW Transferase {ECO:0000313|EMBL:KHN16981.1}; KW Transmembrane {ECO:0000256|ARBA:ARBA00022692, ECO:0000256|SAM:Phobius}; KW Transmembrane helix {ECO:0000256|ARBA:ARBA00022989, KW ECO:0000256|SAM:Phobius}. FT SIGNAL 1..27 FT /evidence="ECO:0000256|SAM:SignalP" FT CHAIN 28..614 FT /evidence="ECO:0000256|SAM:SignalP" FT /id="PRO_5040666464" FT TRANSMEM 225..251 FT /note="Helical" FT /evidence="ECO:0000256|SAM:Phobius" FT DOMAIN 302..586 FT /note="Protein kinase" FT /evidence="ECO:0000259|PROSITE:PS50011" SQ SEQUENCE 614 AA; 67863 MW; 4D8EC8A909220A44 CRC64; Query Match 99.8%; Score 3206; Length 614; Best Local Similarity 99.7%; Matches 612; Conservative 2; Mismatches 0; Indels 0; Gaps 0; Qy 1 MVLHSWISSSHILVNFLLLLGCGITYGTDTDIFCLKSIKESLEDPYNYLKFSWDFNNKTE 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MVLHSWISSSHILVNFLLLLGCGITYGTDTDIFCLKSIKESLEDPYNYLKFSWDFNNKTE 60 Qy 61 GYICRFNGVECWHPDENRVLNLKLSNMGLKGQFPRGIQNCSSLTGLDLSINKLSGTIPGD 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 GYICRFNGVECWHPDENRVLNLKLSNMGLKGQFPRGIQNCSSLTGLDLSINKLSGTIPGD 120 Qy 121 ISTLIPFATSIDLSTNEFSGAIPVSLANCTFLNTLKLDQNRLTGQIPPQFGVLSRIKVFS 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 ISTLIPFATSIDLSTNEFSGAIPVSLANCTFLNTLKLDQNRLTGQIPPQFGVLSRIKVFS 180 Qy 181 VSNNLLTGQVPIFRDGVELHYANNQGLCGGNTLAPCQATPSKSNMAVIAGAAAGGVTLAA 240 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 VSNNLLTGQVPIFRDGVELHYANNQGLCGGNTLAPCQATPSKSNMAVIAGAAAGGVTLAA 240 Qy 241 LGLGIGMFFFVRRVSFKKKEEDPEGNKWARSLKGTKRIKVSMFEKSISKMKLSDLMKATN 300 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 LGLGIGMFFFVRRVSFKKKEEDPEGNKWARSLKGTKRIKVSMFEKSISKMKLSDLMKATN 300 Qy 301 NFSNTNIIGTGRTGTVYKAVLDDGTTLMVRRLQESQYTEKEFMSEMGTLGTVKHRNLVPL 360 |||||||||||||||||||||||||||||:|||||||||||||||||||||||||||||| Db 301 NFSNTNIIGTGRTGTVYKAVLDDGTTLMVKRLQESQYTEKEFMSEMGTLGTVKHRNLVPL 360 Qy 361 LGFCMTKRERLLVYKNMPNGNLHDQLHPADGVSTLDWTTRLKIAIGAAKGLAWLHHSCNP 420 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 LGFCMTKRERLLVYKNMPNGNLHDQLHPADGVSTLDWTTRLKIAIGAAKGLAWLHHSCNP 420 Qy 421 RIIHRNISSRCILLDADFEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEYTRTL 480 |||||||||:|||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 RIIHRNISSKCILLDADFEPKISDFGLARLMNPIDTHLSTFVNGEFGDLGYVAPEYTRTL 480 Qy 481 VATPKGDIYSFGTVLLELVTGERPTNVSKAPETFKGNLVEWITELTSNAKLHDAIDESLV 540 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 481 VATPKGDIYSFGTVLLELVTGERPTNVSKAPETFKGNLVEWITELTSNAKLHDAIDESLV 540 Qy 541 RKDVDSELFQFLKVACNCVSPTPKERPTMFEVYQLLRAIGGRYNFTTEDDILVPTDIGNT 600 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 541 RKDVDSELFQFLKVACNCVSPTPKERPTMFEVYQLLRAIGGRYNFTTEDDILVPTDIGNT 600 Qy 601 DNMQELIVAQEGSY 614 |||||||||||||| Db 601 DNMQELIVAQEGSY 614 It would not be obvious to one of ordinary skill in the art that further inactivation of this kinase would confer soybean cyst nematode resistance on a soybean plant. Conclusion No claim is allowed. Any inquiry concerning this communication or earlier communications from the examiner should be directed to Anne R. Kubelik, Ph.D., whose telephone number is (571) 272-0801. The examiner -+can normally be reached Monday through Friday, 9:00 am - 5:00 pm Eastern. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Amjad Abraham, can be reached at (571) 270-7058. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /Anne Kubelik/Primary Examiner, Art Unit 1663
Read full office action

Prosecution Timeline

Jun 20, 2024
Application Filed
Apr 06, 2026
Response after Non-Final Action
Jul 21, 2026
Non-Final Rejection mailed — §101, §112 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12702107
SOYBEAN VARIETY 01098256
2y 8m to grant Granted Aug 11, 2026
Patent 12690534
MELON VARIETY NUN 71550 MEM
3y 8m to grant Granted Jul 28, 2026
Patent 12672625
PLANTS AND SEEDS OF CORN VARIETY CV988211
2y 6m to grant Granted Jul 07, 2026
Patent 12662682
METHOD FOR PRODUCING BIOLUMINESCENT PLANTS
3y 11m to grant Granted Jun 23, 2026
Patent 12642227
SOYBEAN VARIETY '21850087'
3y 5m to grant Granted Jun 02, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

Strategy Recommendation AI-generated — please review before filing

Get a prosecution strategy drawn from examiner precedents, rejection analysis, and claim mapping.
Typically takes 5-10 seconds — AI-generated, attorney review required before filing

Prosecution Projections

1-2
Expected OA Rounds
76%
Grant Probability
75%
With Interview (-0.7%)
2y 9m (~5m remaining)
Median Time to Grant
Low
PTA Risk
Based on 1347 resolved cases by this examiner. Grant probability derived from career allowance rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month