Prosecution Insights
Last updated: October 04, 2026
Application No. 18/993,134

CORYNEBACTERIUM SP. MUTANT MICROORGANISM PRODUCING L-GLUTAMIC ACID AND METHOD FOR PRODUCING L-GLUTAMIC ACID USING SAME

Non-Final OA §101§112
Filed
Jan 10, 2025
Priority
Jul 11, 2022 — RE 10-2022-0085239 +1 more
Examiner
KUBELIK, ANNE R
Art Unit
1663
Tech Center
1600 — Biotechnology & Organic Chemistry
Assignee
Daesang Corporation
OA Round
2 (Non-Final)
76%
Grant Probability
Favorable
2-3
OA Rounds
1y 0m
Est. Remaining
75%
With Interview

Examiner Intelligence

Grants 76% — above average
76%
Career Allowance Rate
1021 granted / 1347 resolved
+15.8% vs TC avg
Minimal -1% lift
Without
With
+-0.7%
Interview Lift
resolved cases with interview
Typical timeline
2y 9m
Avg Prosecution
30 currently pending
Career history
1382
Total Applications
across all art units

Statute-Specific Performance

§101
5.3%
-34.7% vs TC avg
§103
18.8%
-21.2% vs TC avg
§102
21.0%
-19.0% vs TC avg
§112
39.2%
-0.8% vs TC avg
Black line = Tech Center average estimate • Based on career data from 1347 resolved cases

Office Action

§101 §112
DETAILED ACTION Claims 1-10 are pending. The non-final rejection mailed 3 September 2026 is withdrawn and replaced with the instant non-final rejection. The present application, filed on or after March 16, 2013, is being examined under the first inventor to file provisions of the AIA . Claim Rejections - 35 USC § 101 35 U.S.C. 101 reads as follows: Whoever invents or discovers any new and useful process, machine, manufacture, or composition of matter, or any new and useful improvement thereof, may obtain a patent therefor, subject to the conditions and requirements of this title. Section 33(a) of the America Invents Act reads as follows: Notwithstanding any other provision of law, no patent may issue on a claim directed to or encompassing a human organism. Claims 3, 5-7 and 9-10 are rejected under 35 U.S.C. 101 and section 33(a) of the America Invents Act as being directed to or encompassing a human organism. See also Animals - Patentability, 1077 Off. Gaz. Pat. Office 24 (April 21, 1987) (indicating that human organisms are excluded from the scope of patentable subject matter under 35 U.S.C. 101). Claim 3 is drawn to a transformant comprising the variant of SEQ ID NO:1 or a nucleic acid encoding it. Such transformants include humans. Dependent claim 5 recites that the transformant has the ability to produce L-glutamic acid, which humans can do. Claim 6 is drawn to a method of isolating L-glutamic acid from the transformant. As all these encompass humans, these claims are excluded from the scope of patentable subject matter under 35 U.S.C. 101). Claim Rejections - 35 USC § 112 The following is a quotation of 35 U.S.C. 112(a): (a) IN GENERAL.—The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same, and shall set forth the best mode contemplated by the inventor or joint inventor of carrying out the invention. The following is a quotation of 35 U.S.C. 112 (pre-AIA ), first paragraph: The specification shall contain a written description of the invention, and of the manner and process of making and using it, in such full, clear, concise, and exact terms as to enable any person skilled in the art to which it pertains, or with which it is most nearly connected, to make and use the same and shall set forth the best mode contemplated by the inventor of carrying out his invention. Claims 1-10 are rejected under 35 U.S.C. 112(a) or 35 U.S.C. 112 (pre-AIA ), first paragraph, as failing to comply with the enablement requirement. The claim(s) contains subject matter that was not described in the specification in such a way as to enable one skilled in the art to which it pertains, or with which it is most nearly connected, to make and/or use the invention. The claims are broadly drawn to a deoxyribose-phosphate aldolase variant consisting of SEQ ID NO: 2, a nucleic acid encoding it, a transformant comprising either, and a method of using the transformant to make L-glutamic acid. Applicant did not delete the cysteine at position 225 of the deoxyribose-phosphate aldolase of SEQ ID NO:4 Example 1 of the specification proports to describe the construction of a vector expressing a deoxyribose-phosphate aldolase variant that has a deletion of cysteine at position 225 of the deoxyribose-phosphate aldolase of SEQ ID NO:4 (¶63). However, this is not what was actually done. SEQ ID NO:4 is only 224 amino acids long: PNG media_image1.png 466 592 media_image1.png Greyscale Thus, SEQ ID NO:4 has no cysteine at position 225 to remove, and Applicant could not have constructed a vector expressing a deoxyribose-phosphate aldolase variant that has a deletion of cysteine at position 225 of the deoxyribose-phosphate aldolase of SEQ ID NO:4. SEQ ID NO:2 is not a deoxyribose-phosphate aldolase and expressing SEQ ID NO:2 in a transformant will not produce L-glutamic acid Second, while SEQ ID NO:2 is 214 amino acids long, it only has 75 amino acids of SEQ ID NO:4. US-18-993-134-4 Sequence 4, US/18993134 GENERAL INFORMATION APPLICANT: DAESANG CORPORATION (en) TITLE OF INVENTION: Mutant microorganism of Corynebacterium genus producing L-glutamic acid and method for producing L-glutamic acid using the same (en) FILE REFERENCE: BPX230022PCT CURRENT APPLICATION NUMBER: US/18/993,134 CURRENT FILING DATE: 2025-01-10 NUMBER OF SEQ ID NOS: 9 SEQ ID NO 4 LENGTH: 224 TYPE: PRT FEATURE: NAME/KEY: source LOCATION: 1..224 QUALIFIERS: mol_type = protein organism = Corynebacterium sp. Query Match 33.5%; Score 374; Length 224; Best Local Similarity 100.0%; Matches 75; Conservative 0; Mismatches 0; Indels 0; Gaps 0; Qy 1 MDMTISRATMAQILDYTLLGPEVTNSELAAFIDSAIELGVGTICVPNSMVNLTAKAQEAG 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MDMTISRATMAQILDYTLLGPEVTNSELAAFIDSAIELGVGTICVPNSMVNLTAKAQEAG 60 Qy 61 IRVATVAGFPHGKTP 75 ||||||||||||||| Db 61 IRVATVAGFPHGKTP 75 As SEQ ID NO:2 only comprises one-third of a deoxyribose-phosphate aldolase, it does not have any deoxyribose-phosphate aldolase activity. The specification does not teach how to use a protein comprising only one-third of a deoxyribose-phosphate aldolase; the protein itself will not have any activity in any biochemical reaction. Transformants comprising a nucleic acid encoding it would not produce L-glutamic acid. As SEQ ID NO:2 is not a deoxyribose-phosphate aldolase or a variant of one and does not have any function, an organism transformed with it will not produce L-glutamic acid in excess of what the organism does naturally. The specification does not teach any other way to use such a transformant. SEQ ID NO:1 does not encode SEQ ID NO:2 The specification implies that SEQ ID NO:1 encodes SEQ ID NO:2 (¶25-26). SEQ ID NO:1 does not encode SEQ ID NO:2: US-18-993-134-1 Sequence 1, US/18993134 GENERAL INFORMATION APPLICANT: DAESANG CORPORATION (en) TITLE OF INVENTION: Mutant microorganism of Corynebacterium genus producing L-glutamic acid and method for producing L-glutamic acid using the same (en) FILE REFERENCE: BPX230022PCT CURRENT APPLICATION NUMBER: US/18/993,134 CURRENT FILING DATE: 2025-01-10 NUMBER OF SEQ ID NOS: 9 SEQ ID NO 1 LENGTH: 674 TYPE: DNA FEATURE: NAME/KEY: source LOCATION: 1..674 QUALIFIERS: mol_type = other DNA organism = synthetic construct Alignment Scores: Length: 674 Score: 1023.00 Matches: 214 Percent Similarity: 95.5% Conservative: 0 Best Local Similarity: 95.5% Mismatches: 0 Query Match: 91.5% Indels: 10 Gaps: 9 US-18-993-134-2 (1-214) x US-18-993-134-1 (1-674) Qy 1 MetAspMetThrIleSerArgAlaThrMetAlaGlnIleLeuAspTyrThrLeuLeuGly 20 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 ATGGATATGACGATCTCCCGCGCCACCATGGCCCAAATCCTTGACTACACCCTCCTCGGA 60 Qy 21 ProGluValThrAsnSerGluLeuAlaAlaPheIleAspSerAlaIleGluLeuGlyVal 40 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 CCAGAAGTAACCAACTCCGAACTGGCCGCATTTATAGATTCCGCAATTGAGCTGGGAGTC 120 Qy 41 GlyThrIleCysValProAsnSerMetValAsnLeuThrAlaLysAlaGlnGluAlaGly 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 GGAACGATCTGTGTCCCCAATAGCATGGTCAACTTAACTGCAAAAGCCCAAGAAGCTGGA 180 Qy 61 IleArgValAlaThrValAlaGlyPheProHisGlyLysThrProArgTrp---LysPro 79 ||||||||||||||||||||||||||||||||||||||||||||||||||| |||||| Db 181 ATTCGCGTGGCCACCGTCGCAGGATTCCCGCACGGCAAAACCCCGCGTTGGTGAAAGCCG 240 Qy 80 ProLysLeuAlaLeuProTyrSerProGluLeuProLys---MetLeuPheTrpIleLeu 98 ||||||||||||||||||||||||||||||||||||||| |||||||||||||||||| Db 241 CCGAAGCTCGCCTTGCCGTACAGTCCGGAGCTTCCGAAGTAGATGTTGTTTTGGATATTG 300 Qy 99 Arg------LysArgGluMetProIleGlyCysCysArgLysLeuTrpGlnSerGlyArg 116 ||| ||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 CGGTAGTGAAAGAGGGAGATGCCAATAGGTTGCTGCAGGAAATTGTGGCAATCAGGGAGG 360 Qy 117 LeuPheHisLeuLeuTrpCys---AsnSerSerSerArgArgLeuSerTrpValMetMet 135 ||||||||||||||||||||| |||||||||||||||||||||||||||||||||||| Db 361 CTGTTCCATCTCCTGTGGTGCTGAAATTCATCCTCGAGACGGCTGTCGTGGGTGATGATG 420 Qy 136 GlnLeu---LeuGln---MetHis---LeuLeuGlnValLeuThrSerLeuLysLeuPro 152 |||||| |||||| |||||| ||||||||||||||||||||||||||||||||| Db 421 CAATTGTGACTGCAGTGAATGCATTGATTGCTGCAGGTGCTGACTTCGCTAAAACTTCCA 480 Qy 153 ArgAspSerThrGlnArgGluGluGlnLeuLeuArgLeuPheGly---TrpLeuArgLeu 171 ||||||||||||||||||||||||||||||||||||||||||||| |||||||||||| Db 481 CGGGATTCCACCCAGCGGGAGGAGCAACTGTTGAGGCTGTTCGGGTGATGGCTTCGGCTT 540 Qy 172 LeuGlyGluGlyLeuGluLeuArgLeuProValGly---ThrLeuGlyLysMetArgTrp 190 |||||||||||||||||||||||||||||||||||| ||||||||||||||||||||| Db 541 CTCGGGGAAGGGTTGGAATTAAGGCTGCCGGTGGGGTGAACACTTGGGAAGATGCGGTGG 600 Qy 191 ArgLeuLeuLysGlnGlyLeuLeuAlaLeuGluLeuLeuMetArgGluProPheTrpArg 210 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 601 CGTTTGTTGAAGCAGGGGCTACTCGCATTGGAACTTCTAATGCGGGAGCCATTTTGGAGG 660 Qy 211 ValArgArgSer 214 |||||||||||| Db 661 GTGCGCCGGAGT 672 SEQ ID NO:1 has a stop codon at bases 242-244, as well as having other in-frame stop codons (all such stop codons are in bold above). Instead, SEQ ID NO:1 is a one-base deletion of SEQ ID NO:3 at base 220: US-18-993-134-3 Sequence 3, US/18993134 GENERAL INFORMATION APPLICANT: DAESANG CORPORATION (en) TITLE OF INVENTION: Mutant microorganism of Corynebacterium genus producing L-glutamic acid and method for producing L-glutamic acid using the same (en) FILE REFERENCE: BPX230022PCT CURRENT APPLICATION NUMBER: US/18/993,134 CURRENT FILING DATE: 2025-01-10 NUMBER OF SEQ ID NOS: 9 SEQ ID NO 3 LENGTH: 675 TYPE: DNA FEATURE: NAME/KEY: source LOCATION: 1..675 QUALIFIERS: mol_type = genomic DNA organism = Corynebacterium sp. Query Match 98.4%; Score 663; Length 675; Best Local Similarity 99.9%; Matches 674; Conservative 0; Mismatches 0; Indels 1; Gaps 1; Qy 1 ATGGATATGACGATCTCCCGCGCCACCATGGCCCAAATCCTTGACTACACCCTCCTCGGA 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 ATGGATATGACGATCTCCCGCGCCACCATGGCCCAAATCCTTGACTACACCCTCCTCGGA 60 Qy 61 CCAGAAGTAACCAACTCCGAACTGGCCGCATTTATAGATTCCGCAATTGAGCTGGGAGTC 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 CCAGAAGTAACCAACTCCGAACTGGCCGCATTTATAGATTCCGCAATTGAGCTGGGAGTC 120 Qy 121 GGAACGATCTGTGTCCCCAATAGCATGGTCAACTTAACTGCAAAAGCCCAAGAAGCTGGA 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 GGAACGATCTGTGTCCCCAATAGCATGGTCAACTTAACTGCAAAAGCCCAAGAAGCTGGA 180 Qy 181 ATTCGCGTGGCCACCGTCGCAGGATTCCCGCACGGCAAAA-CCCCGCGTTGGTGAAAGCC 239 |||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||| Db 181 ATTCGCGTGGCCACCGTCGCAGGATTCCCGCACGGCAAAACCCCCGCGTTGGTGAAAGCC 240 Qy 240 GCCGAAGCTCGCCTTGCCGTACAGTCCGGAGCTTCCGAAGTAGATGTTGTTTTGGATATT 299 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 GCCGAAGCTCGCCTTGCCGTACAGTCCGGAGCTTCCGAAGTAGATGTTGTTTTGGATATT 300 Qy 300 GCGGTAGTGAAAGAGGGAGATGCCAATAGGTTGCTGCAGGAAATTGTGGCAATCAGGGAG 359 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 GCGGTAGTGAAAGAGGGAGATGCCAATAGGTTGCTGCAGGAAATTGTGGCAATCAGGGAG 360 Qy 360 GCTGTTCCATCTCCTGTGGTGCTGAAATTCATCCTCGAGACGGCTGTCGTGGGTGATGAT 419 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 GCTGTTCCATCTCCTGTGGTGCTGAAATTCATCCTCGAGACGGCTGTCGTGGGTGATGAT 420 Qy 420 GCAATTGTGACTGCAGTGAATGCATTGATTGCTGCAGGTGCTGACTTCGCTAAAACTTCC 479 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 GCAATTGTGACTGCAGTGAATGCATTGATTGCTGCAGGTGCTGACTTCGCTAAAACTTCC 480 Qy 480 ACGGGATTCCACCCAGCGGGAGGAGCAACTGTTGAGGCTGTTCGGGTGATGGCTTCGGCT 539 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 481 ACGGGATTCCACCCAGCGGGAGGAGCAACTGTTGAGGCTGTTCGGGTGATGGCTTCGGCT 540 Qy 540 TCTCGGGGAAGGGTTGGAATTAAGGCTGCCGGTGGGGTGAACACTTGGGAAGATGCGGTG 599 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 541 TCTCGGGGAAGGGTTGGAATTAAGGCTGCCGGTGGGGTGAACACTTGGGAAGATGCGGTG 600 Qy 600 GCGTTTGTTGAAGCAGGGGCTACTCGCATTGGAACTTCTAATGCGGGAGCCATTTTGGAG 659 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 601 GCGTTTGTTGAAGCAGGGGCTACTCGCATTGGAACTTCTAATGCGGGAGCCATTTTGGAG 660 Qy 660 GGTGCGCCGGAGTAG 674 ||||||||||||||| Db 661 GGTGCGCCGGAGTAG 675 Applicant produced L-glutamic acid by replacing SEQ ID NO:3 with SEQ ID NO:1 in a Corynebacterium glutamicum strain, not by expressing SEQ ID NO:2, per se. SEQ ID NO:3 encodes SEQ ID NO:4: US-18-993-134-3 Sequence 3, US/18993134 GENERAL INFORMATION APPLICANT: DAESANG CORPORATION (en) TITLE OF INVENTION: Mutant microorganism of Corynebacterium genus producing L-glutamic acid and method for producing L-glutamic acid using the same (en) FILE REFERENCE: BPX230022PCT CURRENT APPLICATION NUMBER: US/18/993,134 CURRENT FILING DATE: 2025-01-10 NUMBER OF SEQ ID NOS: 9 SEQ ID NO 3 LENGTH: 675 TYPE: DNA FEATURE: NAME/KEY: source LOCATION: 1..675 QUALIFIERS: mol_type = genomic DNA organism = Corynebacterium sp. Alignment Scores: Length: 675 Score: 1087.00 Matches: 224 Percent Similarity: 100.0% Conservative: 0 Best Local Similarity: 100.0% Mismatches: 0 Query Match: 100.0% Indels: 0 Gaps: 0 US-18-993-134-4 (1-224) x US-18-993-134-3 (1-675) Qy 1 MetAspMetThrIleSerArgAlaThrMetAlaGlnIleLeuAspTyrThrLeuLeuGly 20 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 ATGGATATGACGATCTCCCGCGCCACCATGGCCCAAATCCTTGACTACACCCTCCTCGGA 60 Qy 21 ProGluValThrAsnSerGluLeuAlaAlaPheIleAspSerAlaIleGluLeuGlyVal 40 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 CCAGAAGTAACCAACTCCGAACTGGCCGCATTTATAGATTCCGCAATTGAGCTGGGAGTC 120 Qy 41 GlyThrIleCysValProAsnSerMetValAsnLeuThrAlaLysAlaGlnGluAlaGly 60 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 121 GGAACGATCTGTGTCCCCAATAGCATGGTCAACTTAACTGCAAAAGCCCAAGAAGCTGGA 180 Qy 61 IleArgValAlaThrValAlaGlyPheProHisGlyLysThrProAlaLeuValLysAla 80 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 181 ATTCGCGTGGCCACCGTCGCAGGATTCCCGCACGGCAAAACCCCCGCGTTGGTGAAAGCC 240 Qy 81 AlaGluAlaArgLeuAlaValGlnSerGlyAlaSerGluValAspValValLeuAspIle 100 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 241 GCCGAAGCTCGCCTTGCCGTACAGTCCGGAGCTTCCGAAGTAGATGTTGTTTTGGATATT 300 Qy 101 AlaValValLysGluGlyAspAlaAsnArgLeuLeuGlnGluIleValAlaIleArgGlu 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 301 GCGGTAGTGAAAGAGGGAGATGCCAATAGGTTGCTGCAGGAAATTGTGGCAATCAGGGAG 360 Qy 121 AlaValProSerProValValLeuLysPheIleLeuGluThrAlaValValGlyAspAsp 140 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 361 GCTGTTCCATCTCCTGTGGTGCTGAAATTCATCCTCGAGACGGCTGTCGTGGGTGATGAT 420 Qy 141 AlaIleValThrAlaValAsnAlaLeuIleAlaAlaGlyAlaAspPheAlaLysThrSer 160 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 421 GCAATTGTGACTGCAGTGAATGCATTGATTGCTGCAGGTGCTGACTTCGCTAAAACTTCC 480 Qy 161 ThrGlyPheHisProAlaGlyGlyAlaThrValGluAlaValArgValMetAlaSerAla 180 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 481 ACGGGATTCCACCCAGCGGGAGGAGCAACTGTTGAGGCTGTTCGGGTGATGGCTTCGGCT 540 Qy 181 SerArgGlyArgValGlyIleLysAlaAlaGlyGlyValAsnThrTrpGluAspAlaVal 200 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 541 TCTCGGGGAAGGGTTGGAATTAAGGCTGCCGGTGGGGTGAACACTTGGGAAGATGCGGTG 600 Qy 201 AlaPheValGluAlaGlyAlaThrArgIleGlyThrSerAsnAlaGlyAlaIleLeuGlu 220 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 601 GCGTTTGTTGAAGCAGGGGCTACTCGCATTGGAACTTCTAATGCGGGAGCCATTTTGGAG 660 Qy 221 GlyAlaProGlu 224 |||||||||||| Db 661 GGTGCGCCGGAG 672 For background, SEQ ID NO:4 differs from the closest deoxyribose-phosphate aldolase in the art (GenBank AKF26444, 2015, www.ncbi.nlm.nih.gov/protein/AKF26444) by a few amino acids: A0A0F6SQM0_9CORY ID A0A0F6SQM0_9CORY Unreviewed; 224 AA. AC A0A0F6SQM0; DT 22-JUL-2015, integrated into UniProtKB/TrEMBL. DT 22-JUL-2015, sequence version 1. DT 08-OCT-2025, entry version 43. DE RecName: Full=Deoxyribose-phosphate aldolase {ECO:0000256|HAMAP-Rule:MF_00114}; DE Short=DERA {ECO:0000256|HAMAP-Rule:MF_00114}; DE EC=4.1.2.4 {ECO:0000256|HAMAP-Rule:MF_00114}; DE AltName: Full=2-deoxy-D-ribose 5-phosphate aldolase {ECO:0000256|HAMAP-Rule:MF_00114}; DE AltName: Full=Phosphodeoxyriboaldolase {ECO:0000256|HAMAP-Rule:MF_00114}; DE Short=Deoxyriboaldolase {ECO:0000256|HAMAP-Rule:MF_00114}; GN Name=deoC {ECO:0000256|HAMAP-Rule:MF_00114}; GN ORFNames=YH66_02185 {ECO:0000313|EMBL:AKF26444.1}; OS [Brevibacterium] flavum. OC Bacteria; Bacillati; Actinomycetota; Actinomycetes; Mycobacteriales; OC Corynebacteriaceae; Corynebacterium. OX NCBI_TaxID=92706 {ECO:0000313|EMBL:AKF26444.1, ECO:0000313|Proteomes:UP000034037}; RN [1] {ECO:0000313|EMBL:AKF26444.1, ECO:0000313|Proteomes:UP000034037} RP NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. RC STRAIN=ATCC 15168 {ECO:0000313|EMBL:AKF26444.1, RC ECO:0000313|Proteomes:UP000034037}; RA Ahn J., Park G., Jeon W., Jang Y., Jang M., Lee H., Lee H.; RT "Complete Genome Sequence of Brevibacterium flavum ATCC 15168."; RL Submitted (APR-2015) to the EMBL/GenBank/DDBJ databases. CC -!- FUNCTION: Catalyzes a reversible aldol reaction between acetaldehyde CC and D-glyceraldehyde 3-phosphate to generate 2-deoxy-D-ribose 5- CC phosphate. {ECO:0000256|HAMAP-Rule:MF_00114}. CC -!- CATALYTIC ACTIVITY: CC Reaction=2-deoxy-D-ribose 5-phosphate = D-glyceraldehyde 3-phosphate + CC acetaldehyde; Xref=Rhea:RHEA:12821, ChEBI:CHEBI:15343, CC ChEBI:CHEBI:59776, ChEBI:CHEBI:62877; EC=4.1.2.4; CC Evidence={ECO:0000256|ARBA:ARBA00048791, ECO:0000256|HAMAP- CC Rule:MF_00114}; CC -!- PATHWAY: Carbohydrate degradation; 2-deoxy-D-ribose 1-phosphate CC degradation; D-glyceraldehyde 3-phosphate and acetaldehyde from 2- CC deoxy-alpha-D-ribose 1-phosphate: step 2/2. {ECO:0000256|HAMAP- CC Rule:MF_00114}. CC -!- SUBCELLULAR LOCATION: Cytoplasm {ECO:0000256|HAMAP-Rule:MF_00114}. CC -!- SIMILARITY: Belongs to the DeoC/FbaB aldolase family. DeoC type 1 CC subfamily. {ECO:0000256|ARBA:ARBA00010936, ECO:0000256|HAMAP- CC Rule:MF_00114}. CC --------------------------------------------------------------------------- CC Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms CC Distributed under the Creative Commons Attribution (CC BY 4.0) License CC --------------------------------------------------------------------------- DR EMBL; CP011309; AKF26444.1; -; Genomic_DNA. DR AlphaFoldDB; A0A0F6SQM0; -. DR PATRIC; fig|92706.3.peg.455; -. DR HOGENOM; CLU_053595_0_0_11; -. DR UniPathway; UPA00002; UER00468. DR Proteomes; UP000034037; Chromosome. DR GO; GO:0005737; C:cytoplasm; IEA:UniProtKB-SubCell. DR GO; GO:0004139; F:deoxyribose-phosphate aldolase activity; IEA:UniProtKB-UniRule. DR GO; GO:0006018; P:2-deoxyribose 1-phosphate catabolic process; IEA:UniProtKB-UniRule. DR GO; GO:0016052; P:carbohydrate catabolic process; IEA:TreeGrafter. DR GO; GO:0009264; P:deoxyribonucleotide catabolic process; IEA:UniProtKB-UniRule. DR CDD; cd00959; DeoC; 1. DR Gene3D; 3.20.20.70; Aldolase class I; 1. DR HAMAP; MF_00114; DeoC_type1; 1. DR InterPro; IPR013785; Aldolase_TIM. DR InterPro; IPR011343; DeoC. DR InterPro; IPR002915; DeoC/FbaB/LacD_aldolase. DR InterPro; IPR028581; DeoC_typeI. DR NCBIfam; TIGR00126; deoC; 1. DR PANTHER; PTHR10889; DEOXYRIBOSE-PHOSPHATE ALDOLASE; 1. DR PANTHER; PTHR10889:SF1; DEOXYRIBOSE-PHOSPHATE ALDOLASE; 1. DR Pfam; PF01791; DeoC; 1. DR PIRSF; PIRSF001357; DeoC; 1. DR SMART; SM01133; DeoC; 1. DR SUPFAM; SSF51569; Aldolase; 1. PE 3: Inferred from homology; KW Cytoplasm {ECO:0000256|ARBA:ARBA00022490, ECO:0000256|HAMAP-Rule:MF_00114}; KW Lyase {ECO:0000256|ARBA:ARBA00023239, ECO:0000256|HAMAP-Rule:MF_00114}; KW Reference proteome {ECO:0000313|Proteomes:UP000034037}; KW Schiff base {ECO:0000256|ARBA:ARBA00023270, ECO:0000256|HAMAP- KW Rule:MF_00114}. FT ACT_SITE 95 FT /note="Proton donor/acceptor" FT /evidence="ECO:0000256|HAMAP-Rule:MF_00114" FT ACT_SITE 158 FT /note="Schiff-base intermediate with acetaldehyde" FT /evidence="ECO:0000256|HAMAP-Rule:MF_00114" FT ACT_SITE 188 FT /note="Proton donor/acceptor" FT /evidence="ECO:0000256|HAMAP-Rule:MF_00114" SQ SEQUENCE 224 AA; 22768 MW; 3635F963AF0B87BD CRC64; Query Match 98.6%; Score 1072; Length 224; Best Local Similarity 98.7%; Matches 221; Conservative 1; Mismatches 2; Indels 0; Gaps 0; Qy 1 MDMTISRATMAQILDYTLLGPEVTNSELAAFIDSAIELGVGTICVPNSMVNLTAKAQEAG 60 ||| |||:|||||||||||||||||||||||||||||||||||||||||||||||||||| Db 1 MDMMISRSTMAQILDYTLLGPEVTNSELAAFIDSAIELGVGTICVPNSMVNLTAKAQEAG 60 Qy 61 IRVATVAGFPHGKTPALVKAAEARLAVQSGASEVDVVLDIAVVKEGDANRLLQEIVAIRE 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Db 61 IRVATVAGFPHGKTPALVKAAEARLAVQSGASEVDVVLDIAVVKEGDANRLLQEIVAIRE 120 Qy 121 AVPSPVVLKFILETAVVGDDAIVTAVNALIAAGADFAKTSTGFHPAGGATVEAVRVMASA 180 ||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||| Db 121 AVPSPVVLKFILETAVVSDDAIVTAVNALIAAGADFAKTSTGFHPAGGATVEAVRVMASA 180 Qy 181 SRGRVGIKAAGGVNTWEDAVAFVEAGATRIGTSNAGAILEGAPE 224 |||||||||||||||||||||||||||||||||||||||||||| Db 181 SRGRVGIKAAGGVNTWEDAVAFVEAGATRIGTSNAGAILEGAPE 224 Applicant amplified DNA from wild-type C. glutamicum strain ATCC 13869 using the primers of SEQ ID NOs:6-9 (¶64-66). SEQ ID NOs:7 and 8 are complementary and span bases 216-235 of SEQ ID NO:3. However, over bases 221-225 of SEQ ID NO:3, they have only 4 Cs or Gs instead of the 5 present in SEQ ID NO:3. When the amplification product produced from SEQ ID NO:6 and 7 was joined with the one produced from SEQ ID NO:8 and 9, the resulting DNA had a deletion of a cytosine at base 220 of SEQ ID NO:3; i.e., it produced SEQ ID NO:1. Applicant then transformed this into C. glutamicum strain U3 to produce strain DDC1 (¶69-70). Strain DDC1 had about 10% increased L-glutamic acid production over strain U3 (¶78; Table 1). As SEQ ID NO:1 does not encode a deoxyribose-phosphate aldolase, what appears to have happened in strain U3 is that the functional deoxyribose-phosphate aldolase gene of SEQ ID NO:3 was replaced with the non-functional gene of SEQ ID NO:1. Strain U3 appears to be a deoxyribose-phosphate aldolase gene null mutant. The only polynucleotides encoding SEQ ID NO:2 that have use are those that can replace an endogenous deoxyribose-phosphate aldolase in a transformant. The only such polynucleotide taught in the specification is SEQ ID NO:1 and the only such transformant taught in the specification is a C. glutamicum strain. The specification is not enabled for other such polynucleotides or transformants. No claim is drawn to SEQ ID NO:1 or a C. glutamicum transformant in which it replaced the endogenous deoxyribose-phosphate aldolase gene. Given the claim breath, nature of the invention, and lack of guidance in the specification as discussed above, the instantly claimed invention is not enabled. Claims 1-10 are free of the art, given the failure of the prior art to teach or suggest a protein of SEQ ID NO:2. Conclusion No claim is allowed. Any inquiry concerning this communication or earlier communications from the examiner should be directed to Anne R. Kubelik, Ph.D., whose telephone number is (571) 272-0801. The examiner can normally be reached Monday through Friday, 9:00 am - 5:00 pm Eastern. If attempts to reach the examiner by telephone are unsuccessful, the examiner’s supervisor, Amjad Abraham, can be reached at (571) 270-7058. The fax phone number for the organization where this application or proceeding is assigned is 571-273-8300. Examiner interviews are available via telephone, in-person, and video conferencing using a USPTO supplied web-based collaboration tool. To schedule an interview, applicant is encouraged to use the USPTO Automated Interview Request (AIR) at http://www.uspto.gov/interviewpractice. Information regarding the status of published or unpublished applications may be obtained from Patent Center. Unpublished application information in Patent Center is available to registered users. To file and manage patent submissions in Patent Center, visit: https://patentcenter.uspto.gov. Visit https://www.uspto.gov/patents/apply/patent-center for more information about Patent Center and https://www.uspto.gov/patents/docx for information about filing in DOCX format. For additional questions, contact the Electronic Business Center (EBC) at 866-217-9197 (toll-free). If you would like assistance from a USPTO Customer Service Representative, call 800-786-9199 (IN USA OR CANADA) or 571-272-1000. /Anne Kubelik/Primary Examiner, Art Unit 1663
Read full office action

Prosecution Timeline

Jan 10, 2025
Application Filed
Sep 03, 2026
Non-Final Rejection mailed — §101, §112
Sep 21, 2026
Non-Final Rejection mailed — §101, §112 (current)

Precedent Cases

Applications granted by this same examiner with similar technology

Patent 12742178
INSECT INHIBITORY PROTEINS
2y 1m to grant Granted Sep 22, 2026
Patent 12702107
SOYBEAN VARIETY 01098256
2y 8m to grant Granted Aug 11, 2026
Patent 12690534
MELON VARIETY NUN 71550 MEM
3y 8m to grant Granted Jul 28, 2026
Patent 12672625
PLANTS AND SEEDS OF CORN VARIETY CV988211
2y 6m to grant Granted Jul 07, 2026
Patent 12662682
METHOD FOR PRODUCING BIOLUMINESCENT PLANTS
3y 11m to grant Granted Jun 23, 2026
Study what changed to get past this examiner. Based on 5 most recent grants.

Strategy Recommendation AI-generated — please review before filing

Get a prosecution strategy drawn from examiner precedents, rejection analysis, and claim mapping.
Typically takes 5-10 seconds — AI-generated, attorney review required before filing

Prosecution Projections

2-3
Expected OA Rounds
76%
Grant Probability
75%
With Interview (-0.7%)
2y 9m (~1y 0m remaining)
Median Time to Grant
Moderate
PTA Risk
Based on 1347 resolved cases by this examiner. Grant probability derived from career allowance rate.

Sign in with your work email

Enter your email to receive a magic link. No password needed.

Personal email addresses (Gmail, Yahoo, etc.) are not accepted.

Free tier: 3 strategy analyses per month